1IC7H

Crystal structure of hyhel-10 fv mutant(hd32a99a)-hen lysozyme complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSAYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWAGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSOZYME BINDING IG KAPPA CHAIN
publication title Structural evidence for entropic contribution of salt bridge formation to a protein antigen-antibody interaction: the case of hen lysozyme-HyHEL-10 Fv complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding/hydrolase
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ic7H00
1EA9C 3MA7A 4O58H 5C0ND 4BQCA 2E9BA 2PO6C 3MMEA 1A64A 2UZIH 1U3JA 5B39B 4LLMB 3INUH 4S1DC 2AK4B 4OKVA 4BFIB 4HDIB 4GW4B 1TNMA 4KZDH 1QR4A 2GEEA 1AR2A 3MJ9H 3VRLF 1IL1B 2NLJA 4WUKL 2E7LA 4UIMA 4IJ3B 5IBLC 1I7TB 1FG9C 2BNUA 5HJ3A 3SOBH 5I9QB 4Y1AD 3SDXF 5BO1H 3WJJC 3LEXB 4N1HB 4Y4KB 3CPLB 1F90L 3Q6FB 3EJYD 3BKCL 1F4XH 1F6LL 1FFPB 4PB0H 5BMFL 4EI5C 3O4LA 3C08L 5J1AA 2EC9U 5C9JB 4IS6B 3QH3B 1MF2L 1XF2A 1CQYA 2Z93A 1NGPL 5D7IB 4JFFB 5E95B 2NMSA 1G7HA 5IFHH 3PXJA 5ECJE 1OP5H 2P5WD 1XCTB 5T3XL 5I0DA 3RWFA 3RZWA 4WI7A 3VMPA 1B4JL 1L6XA 1DUZA 1YEHH 1A6UL 4FXKA 1Q94B 2A38A 4JCLA 2EO9A 1WFOA 1FNEB 4OI7A 5DUBB 2FATH 4TNWF 1LK2A 3VGAB 4K23L 4D0CB 1P2CB 2DLFH 2NXZC 3IFLL 1OARL 4PJCA 1LDPH 1ADQH 3DX8B 3R4DA 3MJ7A 3UBXA 4HUVA 3AVEA 4ZOBA 3V52L 1D5MA 1H15A 2DQJL 2YD7A 3L3JA 4KXZH 5ILTL 1FP5A 4JZNA 1A7PL 4TOYH 3RBGA 2QQKH 4CVWA 4I1NB 4NKIL 1RUPH 1UYWH 2HJLB 4OIAA 4U6HB 3OXRB 2DTMH 3MRDA 1R5VB 3FFCA 4JRXA 3U6RB 2F5AH 3S35L 1AP2A 4I0PA 5C3TA 4U3HA 1IEAA 1H3PL 3PHSA 4Y16A 1AY1H 5IUSA 4WFGD 2D7NA 3GBNL 3DXAE 3OGCA 4X6DF 1BX2A 4MD0A 1XF4A 1U91B 5DS8A 1WTLA 2BHYA 2L7UA 1FYTE 1AD0B 1JGLL 1CICD 3C09B 3I2CL 3VFSA 1IC1A 5JQ6H 1B0GA 4XWOC 3BN9D 1N6VA 1N8ZB 2MWCA 1HHHB 1T80A 1TJIH 2W59A 4Y1AB 5BQ7A 3QIBA 3L5XH 1XF5B 1F3DH 5FCUL 3U0TA 5E2UL 4QRTA 3SGJA 3HZMA 1SEQH 4IDJH 4U1IB 4RGOL 3TBYA 3KXFE 2FRGP 4U2ZA 3OKEB 1VEOA 3X17A 1EO8H 1BHGA 4YIQB 3OAUH 1RK0A 3V6FA 1KXVC 4GG8B 3GEWB 4L9LA 5DJYA 5C08A 1X5JA 2P5WB 4X4XB 3IS1X 5J13B 1KC5L 3LKQB 5JW4Q 2O93L 2MHAA 3IRPX 5JHDB 4Y0GA 3ALXA 3RUGB 3ECBB 4K7PL 4NN6C 5CP3A 5DT1H 4G8FB 4OZIF 2GHWB 3GMOB 2HVJA 3H7BB 4XBPB 3JUZA 43C9A 1XT5A 2CGRH 3I50L 2R0ZL 4XWGL 3WCYA 2FEDD 3D0VB 1HHKB 2BHZA 2O5YL 4EDXA 4EOWH 2H9GB 4TUKL 1I7ZA 4KJYA 1KN4H 1D6VH 1AGBB 4P2RA 5LXGH 5F71A 2AJ3B 4Z8FL 4FFWC 4RBPK 1OGAD 3FQUA 3NH7H 2MQ3A 5DRNB 4K07A 1RJYA 2J6EA 1U8JA 1F3JA 1WZ1L 4KK8D 4OFDA 5E03A 4CW1A 1CD1B 1ZEAL 1MCEA 2E8YA 3MGOB 1IC7L 4ZPTA 5DI8A 1RHFA 3LMJL 4LVNC 4LEXH 1LO2L 2ICWJ 2VLLB 5ICYA 2ZCKL 2PYED 4X4ME 5ESQB 1CICB 3X3FH 5E56A 3QJFB 3BZEA 3VGFA 1HQ4A 1TVHB 2YRLA 1BFSA 4XPHL 4XVSL 2X9YA 1S7UB 5I1CH 5F7YC 2X10A 5CIPB 4PRBA 1CD9B 2EE9A 2ARJQ 3CFKA 2KUTA 8CGTA 1X7QB 2B5IC 2YSSB 1ZXQA 4J3TA 5EPMB 4CU6A 5LGHL 4XP5L 1MY7A 3O9WD 3LEVL 1Q9LB 3OJMB 3KVQA 4NQED 4PJXA 2VZ3A 4P23A 5B8CA 4XP6L 2XOTA 2L4OA 4ZXBA 3L3KB 1BM3L 1S5IL 4PJ7A 5C0IA 4JZJC 4CNIA 5IB1A 4YXHL 2Y6SD 1TZHA 4QWWC 3TBSA 4KJWD 5MP6L 5DFVD 2G9HA 3BRGC 2X05A 2R1WB 3MRBB 4E42A 2NY4D 4PLNC 4KZEL 1H5BC 5DJ8A 1U8NB 2HFEB 5TF0A 2YBRB 3ULVH 1JZ3A 1WBXA 1BVLA 3CU7A 4RA3A 4HC1H 4E0RB 1KEML 3MRHB 1CFTA 2Y1VA 1NCBH 1LP9A 4HH9B 5IB5B 1ZLWK 4MZ2A 3O2VL 3RIAK 4O2CA 4BKLA 4DUVA 2PW2A 1DTUA 3HUJA 1KIPB 4JDVA 5EO1B 5JW4R 4UU9B 2FSEB 3HR5A 1AIFB 1AXTL 3RGVC 4OCXH 3NFPA 3AXLA 4M03A 4NYLA 4XX1G 5GQBA 5KVMC 3U36B 2EDXA 1OGAB 3AS2A 3NCJL 3W9EB 3ELAT 2W91A 2XA8H 5FA4B 2Z8WC 5IW1B 4HPYL 2IADA 1I8MA 5DJCA 3LKRA 4FOMA 2VDPH 3M8OL 3E1F1 3STBA 3O11A 3LS5H 4UDUA 1CLOH 3SDDC 1R5WB 1MJJB 3RWEB 2JB6A 4JHAL 3P73B 5DJDA 4OD1L 4HWNA 3CUPB 3KPLB 5E70A 1I1FA 2EO1A 3C9NB 1SVCP 5IBUB 4N0FA 3HI1B 2PYEB 4Z7QF 4YK4C 1A5FL 1A7BA 1V3KA 1INEH 3W0WD 1J8HD 4U7KA 4KAQH 3LB6C 5JIHA 2OX5A 2C4FU 1XF1A 2RQ8A 4I9WE 2E7LC 5TH2B 4Q9BA 3T0EE 4XBEL 1TZIB 1EJOL 3O9WB 2FR4A 4M6NL 5IQ9A 3QWRA 3SE3C 5TFSL 4NRZA 1OSPL 4NQEB 4WUKH 2UWEF 1B0WA 1LEIB 3BISA 2FIKB 3W9DA 3FN3A 3L3HA 5ITBH 4ODXA 2RBLA 1II4E 1F90H 3BO8A 1CL7L 1F3DJ 2VJXA 3HCVA 3BKCH 5D6DA 5BMFH 2ADJA 5J3HD 3FT2B 3C08H 3ZE1F 1I7RB 2VE6B 3L6FB 1JGDB 5DJZA 3BQUD 3PWUB 5C2UB 3QNYA 3QXVA 3VXOB 3HAEB 1MF2H 4K8RD 3F12B 5F9JB 1TXKA 5DTFB 3S36L 3LN4B 1NGPH 5CP7B 1OGTA 1HILB 1KCSL 4YLQT 3IETB 3ABZA 2A74B 5B39G 5T3XH 4JRYA 3SDCA 3VGDA 2NXYD 4U4BA 1YEDB 1H3VA 4OGAC 1JNNL 1U95A 1ZE3C 4JE4B 4AEFA 4WI9A 4QOKE 5F6HJ 4NHUA 5D1XA 3DGGB 5DMYA 1JMZA 1UGNA 2BVUA 4U7SA 3P4MB 3T09A 4I3SL 2FB4L 4V1DE 4Y4HD 3FQWB 4R0LB 3V52H 2F5BL 3LVEA 3C5ZA 2DQJH 5GS2D 2DWDB 3X12A 5ILTH 5IM7B 5D93B 1A7PH 2FJGA 3O6FA 2ED8A 1EEZA 3S35X 4KKLD 4KJQC 4Y16C 5F97E 3S96B 1A1MA 3DLQR 1MPAH 3S35H 3P77B 4NP4L 4ZUSB 2KKQA 4NFDA 1UB5A 1TTUA 1E4XI 1G6RB 3RKDD 4LASL 3GBNH 4NQSB 2LVCA 3LKOA 1OP3H 3W0WB 2FJHA 3O3DA 1J8HB 4NQTA 5IT2L 5TE7L 4PJDE 4HGKC 5FYLH 5EH1A 3MUY1 3BE1L 2AK4A 2VL4A 4HDIA 4GW4A 4RFEB 2X09A 2NQCA 1JGLH 4HKBA 5DRZB 4JO3H 4ZAKD 4MDJA 1IL1A 2OBGA 3RI5F 1I7TA 3WDHA 1QRNE 4PY8I 2DI8A 3GIZH 3SGJC 3LEXA 1ZGLA 2X9WA 1IAOA 5FCUH 5L2JA 5F7DB 1WBZB 3OF6A 3EYUL 4MZ3A 2GCYA 3G6JA 4I3RL 3BQUB 3D69A 4EN3C 5IVOA 3QH3A 3PABB 4XNMB 1DANU 4NQVB 5D7IA 4DWHA 5F3HB 2JJSA 3TBWB 1XCTA 5EUOE 3WFCL 2NXYB 1KC5H 1Q94A 1JGVL 1C08A 3DXAD 4XB7A 4UQ3B 4K7PX 1FNEA 5DUBA 4KRPC 4I77L 4K7PH 4WV1B 1V7ML 4JQXC 3DV6B 2W0KA 3DX8A 2DQHL 2J8HA 1FYTD 1I3RB 4HJ0D 1GZPB 2MFNA 2BVPB 3OL2A 3I50H 2R0ZH 4XWGH 2VZ1A 4Y4HB 3OJDB 2O5YH 1JWSB 2EYSB 4TUKH 2IEPA 5K93A 2HJLA 4X9FA 1IAIM 4OV5A 4AK1A 3OXRA 4H88H 4W4OC 4N68A 1I1YB 3FKUS 1NGXB 3AMKA 4UV7L 4UILH 4NUJB 3L9RA 3U48A 1CLZH 1F8TL 1A9BB 3EGSB 2UUDH 3KXFD 2WWMC 1NUNB 1WZ1H 5C0GB 5E4EB 3WLBB 5CAYB 1LO0L 4G3YL 1ZEAH 1TPXB 4MWFA 2APVA 2AW2A 1IC7H 5FECB 2E6JA 4WW2C 1U9KA 35C8L 3HI6L 2FBOJ 3WFZA 1B3JA 2ZCKH 3O2DL 5BZWB 1J0JA 1IAII 1N8ZA 4XPHH 4XVSH 2AV7A 4PJGF 4ZS6C 1KIRA 2GTWB 2X4OB 4M7LT 6CGTA 1TQBB 5MENE 1S78C 1X5GA 5FK9A 5I74C 2CDGB 4P23C 5B8CC 1MH5A 2ITDA 4U1IA 2VKXA 3LEVH 3V4PL 3MJ8B 4X7SL 3B5GA 5DUML 2DWEA 1KCKA 3K4AA 3GSNL 4YIQA 1WFTA 4GUPB 5CZKA 2R9HC 4GG8A 1QBBA 4IOIA 2VDLL 4ZMAT 4QXTA 1E27B 2P5WA 2FZ3B 4X4XA 4DUXA 4LDLB 3CX5K 3LKQA 5CGYD 5LQBL 5DA4A 3L7FA 3DXAB 3U7AA 4KZEH 1OQXA 1RQ5A 1URLA 3REVA 3ECBA 1X9QA 4LPWA 5EDXA 3GMOA 3ZT7A 1KEMH 1FYTB 2VITA 1CT8B 5EO9B 3D0VA 5KS9F 2VR9A 3O2VH 1JUFB 4EVNB 4R96B 5JW4N 3T65B 2QSVA 1AXTH 4UBDC 3ZHLA 3NCJH 4PBXA 5DRNA 5HDQL 2CKBA 3KXFB 1CD1A 1DQMH 3M8OH 1BVZA 1UXSB 3BIKB 4I48B 3PL6C 1DZBA 4GKZA 5DSCB 3G9AB 1RUKL 4JHAH 4R8WH 1Z2KA 2VLLA 1KPVB 1XGPB 4GW1B 3K74B 5M95B 5I75B 5C71A 1PVHA 4X99B 3SPVB 3MROB 5ESQA 4CVUA 1REIA 1TVHA 1ZANL 1MFDL 1S7UA 1NFDF 3EZ8A 2VXVL 5FM8A 1X7QA 2YSSA 4FXGB 4XCNB 4ZPVB 5T3ZH 4NQXB 1X4ZA 4XI5C 1Q9LA 4M6NH 4U3XA 5K33A 1YEEH 5TFSH 3UTTA 2VUOA 5D6DC 1E4JA 3IDIA 4TULH 4ACPA 1SJXA 3P2TA 4QHKJ 1EBPA 5DHXB 1ZHNB 4HAFA 4WGWB 4C55A 5T1KD 3V0WH 1K9TA 3P11H 1CXFA 4RFNC 1YN6A 3GMNB 5IBUG 3MRBA 3HC0A 1AHWB 3M07A 1FFNB 4KV5F 5E8PA 2VQUA 3S36X 1FRGH 2X6MA 3BIAX 1IGTA 3OKLB 4GAGL 3M17A 2DQCL 4LK4A 3S36H 3BW9B 4GO6B 1YMME 5ESVB 3MRHA 3MFFB 3T77A 4O9HL 4OGYL 4Z7OE 3SCMD 3K1DA 2HG5A 1PAMA 4IRSA 3HRPA 4YWGL 2Q8AH 1KIPA 3L3DB 3TIEB 4KQ3L 4UU9A 2HFFA 3KS0H 3ILPA 4WFEE 1OGAA 4I9WD 2ZSVA 4BUHA 5FA4A 2HT3D 3T0ED 3QEQE 2G5BB 2HFGH 4I3SH 4PLKC 5BVPL 4QTHA 2F5BH 3ARFD 3CFCL 1SYVB 4ZFZA 3AS0A 3QQNA 4FQLL 1NJ9B 4IRZL 4OZHE 4PJCF 3KPQB 3HAEG 1UQSB 4YX2L 4DUWA 2F15A 5DMGD 2ZUWA 3C2AH 2ITCB 4OQTL 4NP4H 3HI1A 2FECI 2CMRL 1G7PA 1RJZB 5CBEB 4LASH 1TIUA 3OAZK 4YEEA 4J6RL 5C0CE 1OPGL 1IFHL 3VXTB 4ZUUA 1HI6B 2OI9B 4HUMB 5GS1B 4YHIA 3VWJD 4IJ3C 3L3OB 2X4TB 5I9QC 3P9WB 4YO0B 3DSFL 3TZVD 3DO3A 3W11C 4NDMB 4Y4KC 1YNTB 3T0XA 2CR6A 3IKCB 4U31A 4QOKD 3ARVA 4HXBH 4GKSA 4Z95L 2YKLL 2ZG2A 2COQA 1MUJB 1B90A 1PFCA 1RMFL 5CP3H 3U4BL 4L5FL 2IFFL 1SBSH 2X1XR 1RUML 4GRLB 4LGPB 1ED3B 5A40E 2NY2D 3WIFB 5T1MB 4GMSH 4V1DD 5IGXL 4RIRB 3IDGB 1UKSA 5T1KB 4JFQB 1KB9J 1S7WA 3QBTB 4FQCL 4MD4B 4OZFA 3EYUH 3TBTB 3LD8B 4JJ5B 5E5MB 4UQ2B 4I3RH 1ZGLP 5KANI 1T22B 5HTSA 3VXOA 3F8UB 4FNLH 3F12A 1J1PH 5DTFA 3LN4A 5B4MD 3RX5A 2WLZA 1BMGA 2I07B 1N4XL 3IETA 4I8DA 4LRIA 4FQIL 1YEDA 3VGAC 4PRDB 4XAKE 4WRLA 4GW5B 4LGRB 1EUTA 3BUTA 5I15L 3CLFL 1JGVH 1I8IB 2C3VA 3DGGA 4I77H 1M7IA 1V7MH 3NA9L 3P4MA 4NCC2 2DQHH 3SKNB 3MYJA 2GAZB 3PV7A 5E9DE 3T0EB 2KPNA 3WHE1 5HYQA 3HZVB 2DWDA 5IM7A 3ARFB 4QXGH 5J6HA 3CC5B 1QRND 1TQCB 1U8HB 2D7QA 3BWUC 4ZS7L 3L7EB 3S96A 4ZUWB 4AMKL 3P77A 4UV7H 1NC2A 3QHZL 5E6YA 4Q7DA 3PHOB 1JV5A 5FYKE 1F8TH 5FEBA 5E8DH 1G6RA 2VABB 1UG9A 4PTUA 1CWVA 1JJUA 1ND0A 1LO0H 1G7MB 3W0WA 4G3YH 1KEGH 1LO4L 5I8EA 3HMWL 3C09C 5IF0B 3ZTJG 2NCMA 1IAMA 5TQ0L 3HI6H 3K8MA 3DURB 1YY8B 1J9CT 5DRZA 5LGJB 3TZVB 4JQIL 3O2DH 5KSUB 4WI6A 4CRPA 5D96B 4X9GA 3OX8A 2DKSA 3MLVL 4GXUM 3EJYC 4QOKB 5EZIL 4PFEA 4Q9CA 2EIEA 5I19L 3VFVA 2NY2B 1I1AD 1WBZA 4HKJB 3RWCB 4V1DB 3BP4B 3BQUA 3V4PH 1KTLB 3PABA 4X7SH 2V7HB 4J12A 5J13C 3GSNH 3X3GL 5H35B 4KPHL 1AXSA 2C1PB 4DVBA 4CN4A 4NQCE 1YYMH 4PJXF 1ZS8A 3ZHDA 1U2HA 4UQ3A 2GJZB 5LQBH 3CFBB 4QEGA 1XH3B 4PJ7F 1FLRL 3BXNB 4WV1A 3LRGA 4J3UA 4Z7WE 1PGRB 4PJDB 1GZPA 2IH3A 2BVPA 3SGEI 4ERSL 3GM8A 3O8XC 3OJDA 1ZLSL 4RA0C 2EYSA 5KTEH 5FGCE 2ZUSA 2CIKB 5HYEA 1QRNB 2VN7A 4H8WC 1CGSH 2GY5A 4TSAL 3KS0J 5KSAD 5MEND 1NGXA 1LP9F 2RGSA 4NUJA 2WSKA 4NJAL 4EI6B 4WHCA 3GK8L 1EMTL 1DLHA 5E8NB 3ISWA 3HUJF 1DE4B 5C0GA 3WLBA 1W8OA 4ZYKB 4WVRA 3OKOB 3VH8B 5IQ7L 5INDB 1CICC 1RUKH 3IDYB 5DGRA 2QSTA 4PB9H 3WD5L 3BN9C 5EUOB 3FQRA 1PG7W 3G5ZB 1OD9A 2N1KA 4ZAKA 5DHVA 4RQQA 1ZANH 2VL5B 2X4OA 2GTWA 4LVHC 1RV6X 1E4KA 2IQ9H 4HJGB 2D03L 1LE5B 1EDQA 2NTFA 1KCLA 2X42A 3MJ8A 1LO3H 5A2JH 3S3JA 1VHPA 3FQNA 1YDPA 1XGTB 4YDKL 1XCQB 3TNNB 1K6QL 4YFDB 3DX7B 1JK8B 5CINL 3AFLA 2XRAL 1U8MB 3Q2CA 3RPKA 1FN4B 3IKKA 4BQ9A 3TIDA 1IGJB 3T2NL 3SQBA 1DLFL 4ZFGL 3GGWA 3D39E 2D0GA 5CCKL 4OFVA 5AZEL 2FEDC 4D9LL 4WTXA 2DQCH 4HJJH 1FYTA 3LZFL 4U1JA 1CT8A 4G6AD 5EO9A 4O9HH 4OGYH 4U1MA 3RY4A 2JJVA 1MI5A 1JPSL 2WW8A 2Z92B 5IFAH 1IJ9A 1MJ8L 4G8GE 1X5LA 2VDRL 1IAIH 1JUFA 4YWGH 4EVNA 4R96A 5EC1B 4KQ3H 4PJBA 2GUOB 43CAB 4FQXA 3VFMB 5CJXC 2P48B 5IOPB 1T89A 5KSAB 5MENB 4MAYD 4KK8C 3V5HB 4PJHA 3LKSB 1EFQA 2CKNA 2AI0L 4I18B 1FFOA 3MRPA 5BVPH 1P84J 3RWJB 4QGYA 4NGHL 3CFCH 3QCUH 4OIIL 1UXSA 3BIKA 4QO1A 4WWKA 4Q9RL 4FQLH 4B0MM 4U1SB 5GGVY 4GW1A 1KPVA 1YEGH 4YX2H 2E9WA 5HI3D 1KCVH 4X99A 3SPVA 3MROA 3UDWC 4OQTH 3GIVA 2CMRH 4AIZA 4M3JA 5SV4A 2HJKB 1RI8A 5DXWA 4FFVD 1JNLL 4J6RH 1OPGH 4X4YB 4ZUTA 1R3HB 3O9WC 3T3PF 1FZMB 1YMMD 4FXGA 1X3DA 5FYJE 1MREL 1JHTB 1CTNA 3DSFH 4N0YL 1GCFA 3KPOB 5D2LE 3BH8A 4Z95H 2Y6SC 4TPRH 2YKLH 4WFED 1BAFL 3U4BH 1RMFH 5DFVC 4L5FH 4ONHB 2IFFH 4Z5RA 2EKSB 1RUMH 5GRYA 4LPVA 1EEQA 1ZHNA 3G08B 3QEQD 3MA9L 4XB8A 3UZEA 1CGTA 3GMNA 1AHWA 4FQCH 2XXCB 4N9GB 5CEXA 3MC0A 5IFJA 1EHLL 1DFBL 1R3JA 1MCLA 4YBQD 3BW9A 5I1KL 1I1CA 5ESVA 4B50A 3EYQD 3MFFA 1KPUB 1IKFL 3NFSH 1IQWL 1N4XH 1SJEA 3G6JF 3V95A 3G5VB 1DUYB 4FQIH 1HDMB 1CFSB 2ZNWA 1ZTXL 5I15H 5D7IF 3CLFH 5C0CD 5BZDB 4UTBH 3L3DA 3TIEA 4Z7UE 4R0LC 4PGDB 4RWYL 3EO9L 1XMWA 1ZAGA 5KSBA 3E2HB 5D93C 3QG7L 3MRGB 2FGZA 4MAYB 1PY4A 3NA9H 5A1AA 1ZMYA 3ARXA 5DQ9B 2IC2A 3HMXL 1J10A 3Q6GL 1ZSDA 1SYVA 3BGMA 4WO4C 1MCNA 1NJ9A 2W0LA 3KPQA 4UT6L 1DBBH 4ZS7H 2QL1A 3WV0A 4NQDA 4JFPA 5HVWA 2NYYC 4P49A 5K9KA 4P5TD 2IBGA 2PETA 2ITCA 3DV4B 4AMKH 4FQHA 5FGRA 1I85A 2EIZB 3QHZH 2CD0A 2M8XA 1JZ8A 2C3GA 5SX5H 5CBEA 4LSQL 1W0VA 1DEEB 1FQ9C 3GB7B 1SBBA 3UPAA 4ZO7A 4PP1D 5GIRB 1HN1A 1HI6A 1LO4H 4K8RL 4X6BA 3HMWH 4Z7VE 1VACB 1YMMB 2VZOA 1UJ3B 5TQ0H 2N7BA 2X4TA 1QA9A 2PN5A 4YO0A 4XAKD 3O6KH 4NDMA 5CMAA 1CG9B 1HYRC 3VRIB 3IKCA 2X4SB 4GG6E 3DO7B 2SEBB 7CGTA 3MLVH 1FZKA 5BRZA 2L0DA 5EZIH 2WP3O 4HS6B 4X5WB 5J3HC 1KFAL 3TNMB 1ED3A 1LVEA 4JKPH 3S9DB 4KKBD 5E9DD 1LMKA 3IDGA 3QEQB 5T1KA 4JFQA 2XWJB 2KL6A 4MD4A 4HK3N 4YR6B 3TBTA 5DR5H 4K8RC 4JJ5A 5E5MA 4PGCB 4XAWL 5DYOB 1KXTB 3MUGB 1GOHA 1ORSB 4OZHB 4JR9L 3WUZA 2NXYC 4HMEA 4HWEL 3X3GH 1Q0YL 2BXZA 2I07A 4KPHH 2WBJD 1HKFA 4H8WH 3DYPA 4MJ6B 3SCMA 3UBXI 5FYKD 2XG4A 1ZLUK 3B9VA 4WV1C 2RFXB 5E94B 4X80L 1I8IA 4PJ9A 5C0CB 3PJSB 4KK6D 1F11A 4MXVF 4WHTB 4NKMA 4Y4HC 2I27N 1NDGB 1JF5A 2EDWA 3SKNA 3AU1B 5EUKA 1TTFA 2ERJB 2GAZA 4OZGE 1BGXH 5SV3A 2WQ8A 4ERSH 2CPCA 3HZVA 1B2WL 1ZVHA 5GHWH 4KKLC 1E4WL 2QR0A 3CC5A 2FX8H 5CIPH 2F8XC 1LNUB 2J12B 2C3XA 4TSAH 1WSST 3U7YL 5HHME 5EU6B 3KNBA 1YMHB 3RKDC 4P5TB 3VGEA 1TPXC 4Z77B 4NJAH 1MAKA 3GK8H 1EMTH 3MRRA 4UB0L 4JO1L 1K5NB 2ZOLB 1G7MA 1Q9OB 3E6HA 4L3CB 3ZDZE 5DGQA 3MRQA 4Q6IA 4XNZB 3CFIC 3V6ZA 3GM0A 3U9PL 4UDTB 1NEUA 1I1RA 5HYIA 5IHUL 5IQ7H 1S9WB 1Y6NR 2P43B 4IOFC 3VWJA 3WD5H 3SBWC 2F8OA 3DURA 4NQCD 5LGJA 3TZVA 2OMBA 8FABA 1G0DA 4YHML 1Q9KA 1TQBC 3QUYD 4Z6AT 1MSPA 4QOKA 3P30L 4H5SB 1JF1A 2NY1B 4W6XB 3KDMA 4U1NA 2D7TL 2FL5B 2D7OA 1E28A 5SWSE 3RWCA 4V1DA 2D03H 5E9DB 3PWLB 4TQEL 3HPLB 3BP4A 3H6JA 3CMOL 2QEJA 1JTPA 3JZ7A 3WFEL 4B41A 1KTLA 4KJPD 2V7HA 4MAUL 3ARGA 5DQDL 3ARDD 3VH8G 4PJ8A 1K6QH 2YZ1A 2VLJE 2C1PA 5CINH 2WBJB 1C12B 1WEJL 2XRAH 5HY9A 3WN5B 3EJJX 4MHHI 5AUMB 2CK0L 4AM0B 3EOBB 2GJZA 5GSVA 3T2NH 5FDWA 3CFBA 3HZKB 4HJ0C 1DLFH 3BXNA 2ZOKB 4LCCA 3IGAB 1A7RL 5CCKH 4PJDA 5AZEH 1BOGB 2K7QA 1NCWH 4OJFL 2EECA 1DQJB 3LZFH 4JO4L 5D7JD 5HPMB 5MEQB 1MJ8H 3L5JA 4QCIB 3FONA 2OR9L 2VDRH 1MCHA 1QRNA 1U42A 3CDFA 1M05A 1Z9SA 5E00B 4F7EA 3BUYB 1EERB 1TNNA 2E5EA 1CXLA 2VLKA 3ROOA 5MEPB 5E2TL 1PEZA 4NQUA 2AI0H 5E8NA 1DE4A 4RMWA 4ZYKA 1VESA 4G42A 5D7SL 4NGHH 5IROC 5KJRH 3OKOA 4OIIH 3SDAD 3STLA 1D5XB 5INDA 1N5YH 1A2YB 4ODHH 3X13A 3MODL 3BSZL 2KDGA 4NC1E 2VZTA 1INDL 2AEQL 1TFHA 4NQCB 1T1XB 1XGRA 5F6IB 3QUYB 1RUQL 1QBAA 5SWZE 3D39D 3HAEH 1JNLH 2VL5A 3H7LA 4MJIE 4OLVL 2IANA 4Z7WB 3FO0L 5FUCE 1QBML 2FEEI 1CDJA 4B7IA 5KBNC 2JJTA 1HH6B 3IDNB 2ICES 4NUGH 1I1AA 1LE5A 1Q9WB 4KY1L 3OXSA 4G8GD 1AJ7L 2JK5A 4YDVB 5GGQL 3MZTA 2H8PA 5FGCB 1FCGA 3PP3K 2BVQB 3PNWB 3ZSTA 2K3TA 1XCQA 2OCFD 4MCYB 3TNNA 3ARDB 2ESVE 1F4AA 5CGYC 1BAFH 3DX7A 2AS5M 4XGZB 1XAUA 4XMKL 3MA9H 1FN4A 3QAZB 4IMLB 5GS0D 2LV4A 1KPRB 1M4KA 1WVZA 1ERNA 1P4LB 1DFBH 1WJ3A 4FN0A 3VA2C 4PRNA 2VXQL 4M48L 2EDTA 4L4VA 1K4DA 5HDBE 3FO1A 5I18L 5EOTA 1IQWH 1HOCB 2W0FB 5D7JB 1BJ1J 4N8CH 3D0LA 3GJFA 3IU4H 4J3VA 4XC3H 4GQ9L 5EOCH 2W9DL 1ZTXH 4FFZL 43CAA 2EXWC 3JVGA 4NPYB 2BDNL 5AYQA 3VFMA 2X41A 4KDTA 3EIFA 1S5HA 1IGIL 4HIIB 2XKNB 5KSAA 1J88A 5FYJD 1BD2A 1G9NL 2V2WB 3IAPA 3E8UL 3QG7H 4PV9B 3CAFA 4HW6A 4I18A 3GI9L 5IMOB 2OTWA 2IBZY 3RWJA 3HMXH 1G9MH 4LOUD 5IG7B 1T03L 1AGCB 3SDAB 4FP8L 2F19L 4F7CB 1U2CA 5ACLA 2BRQA 4E41E 2J7LA 3ZYIA 1QSZA 5T3XE 3N1FC 3EZJB 5C1MB 2OI9C 5GS1C 1IBGL 3VFNB 3EKCA 4LSQH 5F7HA 1FV1B 4F37F 3D18A 3CGTA 3Q48A 1G9NC 3O3AA 3D39B 4JFOA 5EU5B 2MCPL 3UYRL 2BNQB 4X4YA 4K8RH 4P2YA 2YWYA 1MY5A 1EBAA 4UMGA 3GRWA 2I9LB 3T3MF 5LWYL 2Q6WB 5L9DL 1WAAE 3FQXB 5I1DB 4G8GB 4GRLC 3VXPB 1UWGL 2VKWA 1HE7A 3VFWA 2XWBB 3LD8C 1KFAH 3G08A 3RHWK 2ARJB 4QNPF 3F7RA 2VERN 3F5WA 3O4OB 2HRPL 2E7BA 5GS2H 1QZ1A 2Q76B 3V9FA 4F7TB 4XAWH 3JTSA 4XVJH 7FABH 3VFGL 3MR9B 1U92A 3PWNB 4JR9H 4BFGA 5FYLE 1YYLL 1KPUA 2Q20A 1Q0YH 2R2HB 4HWEH 1KBGL 4EUPB 1H8OA 1DUYA 4LHUA 4OCRL 3D85D 5HHQA 5BZDA 4X80H 2DJSA 1ITBB 4P4RA 1AR1D 4NRYB 2HT3C 3T0EC 1YPZE 3QCVL 3MOAH 3MRFA 3MRGA 4U1GB 3ARFC 1DBML 3OPZL 5EULV 3D3VE 3VFTB 1ZGLM 3LEYH 5DQ9A 2BVOB 3ESUF 4NN7B 2VH5L 1B2WH 1E4WH 2HYMA 2UY6A 2Z8SA 2PTTB 5D2LB 4P9ML 2A83A 1EHAA 5KN5B 1P6AB 2ICWB 1XGUB 1OD7A 3DV4A 3U7YH 4FQ2L 4X7EC 1CLYH 3CXDL 2FO1A 2EIZA 4NOFA 3CXHJ 4YDJB 1DEEA 4UB0H 3GB7A 3G9VA 3GSUB 4P48A 4JO1H 3IJHA 3RY6C 4PR5A 4UZGA 3VMNA 5CHNB 5C0RL 4JM2C 1BWWA 5IHUH 4L29B 5C6PB 1VACA 2IFGA 1OAUL 1NAMA 1UJ3A 1XR8B 1CDIA 2WIIB 3D25B 1HNFA 2DAVA 1OAXL 3KJ4C 3OKMB 1CG9A 4FHBD 4YHMH 3I02A 4YH6A 2FH6A 5IJKC 2SEBA 3LQZB 1PX4A 4Y5YC 5CD3B 4Z7UB 3WDIA 3HG1E 4X5WA 3RRQA 4YDLC 2KH2B 3DECA 4ZNCD 4M7JL 3OKNA 2D7TH 4OCLC 2CUIA 2XWJA 2AJUL 4KI5E 5CZXD 5FV1L 1I9IL 1TJGL 2FDBP 4LPXA 4EQ3A 2XY2A 4PGCA 3CMOH 4M1CD 5DYOA 5B4MC 3TPUA 2YPLE 2AEIT 2HAZA 4G7VL 4HCRA 1ORSA 1G7LB 3VXNB 1QFWM 5HHMD 4KK9D 4MJ6A 1P7KB 2DBLL 2WWKO 3AC0A 5DQJB 5ELIA 1A6VH 1JHKH 1H3TA 3RGHA 2C3WA 5TGBB 2WK2A 3QNZB 3VXME 2DQFB 3D85B 3LSOB 5EB9A 3C6LD 3PWPE 1NDGA 3F7QA 3GMQB 3B3IB 4Z7VB 4P4KA 4Y5VA 3AU1A 2GJ6E 4OJFH 5ACZA 3CSPA 3VGBA 4JO4H 2EYTB 1UACL 5E1HB 4GG6B 1FBIL 5F7KC 5CWSA 2A77L 1G84A 2HT4C 1NPUA 5DRWB 1QFWI 4TN9A 5EOCJ 1LNUA 4MS8D 5IB2A 2J1KA 4MNHB 1T21B 1T5XB 3QDJA 4L4JA 5TE4L 5SWSD 4X98A 3HE6D 1E6JL 1RIHL 4P59L 3UTZB 5E2TH 1X5KA 2WQRA 4HFWB 5DZNA 5C86A 3O6ML 3MREB 3BT2L 1K5NA 3IDYC 5BXFB 4PJBF 2ZOLA 1FSKB 3N1QC 2WM0A 1Q9OA 5ESAB 4BFEA 5D7SH 4BJLA 1KNOB 1CZ8L 4G6FD 3UTPE 4HEME 4UDTA 2BC4A 4PJHF 5C07A 1S9WA 1MRDH 1T2XA 3MODH 2VLJD 3BSZH 3L3GB 4RMRA 4A2MA 4LLDA 1MLCB 3BP7A 1INDH 3JTTA 3W5NA 2A6JB 3BFOA 2FYYB 3L5WA 3LRHA 1SY6H 4NNPL 2LTQB 1G7IB 4HKXB 3QQ3B 1RUQH 3MNWB 2IBBA 4RBPH 5JPNA 1AKJB 3CSBA 4RAUA 3BZ4B 3FO0H 3MGAA 4WEMB 1QBMH 5EZLB 3VGGA 1HHIB 5E9DA 4OZGB 3PWLA 4PY7B 3N06B 2A9NL 4XCFL 1U3ZA 2WINB 4Y5XB 5GGQH 2OL3H 5A43C 4MQTB 3RNKB 4DKEL 1G7QA 3HB3D 2DDQH 3SEPA 2DMCA 2ZSWB 2P5EA 1A0QH 1ZLVK 1S7XB 5HHMB 2YPKB 1FYHB 1MHEB 5DF0A 3GMPB 2WBJA 1C12A 1HXMB 4OFPA 3SE9H 3WN5A 4YAQA 5AUMA 3EOBA 4FRWA 1CDYA 4GKNB 4OAWB 4M1DL 3HRZB 1J1XH 1OHQA 4JN2A 2Q3AA 1BQUA 2GSIB 2ZOKA 3C6LB 1HZHH 3EYOA 4OCNC 1DQJA 2VXQH 4M48H 5T3ZE 5I18H 3JWOL 3QULB 3RZCD 5MEQA 3WFDH 4J1UA 4QCIA 3GSVB 1DL7L 1FL3A 4I0CC 5SWZD 4GQ9H 5E00A 2W9DH 2PXYD 4MJID 3UC0L 2HLFC 3OMZA 4I18C 1X5YA 2CJUH 1IGIH 2ICCA 4DAGL 4AENB 4PRHE 1G9NH 5SWSB 3GRWL 2VAAA 3HE6B 4F57H 4Q0XH 1HH9A 1BIIB 1MHCB 1R3IH 4KDWA 4ZSOE 3PGCB 2DQIL 4M8QB 4OCYL 1TMCB 3VFUB 5KSBF 1D5XA 4CN1A 1A2YA 3JXAA 2VXSH 4G6FB 2AABH 2ESVD 4FP8H 2LE9A 5LAXB 1OCWL 4QRRE 4BK5A 1X6NA 1H8SA 2VLJB 2IQAB 5IB3A 1LDSA 3OB0K 4NQCA 1RZFL 1ZLWH 1Z9OA 3NCCB 4YHPB 1DQDL 1IBGH 2Z0BA 3QUYA 5HGAB 4EI5D 2NX5E 4WHYG 3ET9F 2ED9A 3QO0A 2MCPH 1DQQA 3W81A 1ZT1A 2HA1A 3DNKA 4U05A 4LLVB 3LPFA 5F8QC 3IDNA 5J06A 3VFRB 1EHNA 1MCSA 1Q9WA 4MNGE 3FHQA 1JPFB 2Q87A 5LWYH 3PV6A 4KMQA 4DCQB 2BVQA 2J8UE 4Y2DD 1OM3H 4IMKC 3ARDA 2BERA 3GSWB 2WZPD 3PQYE 4HWZB 1NFKA 5JXEC 5C8JB 4NRXB 4AIOA 2HRPH 3B6SB 4XXCA 1Q1JH 4RX4A 1OSZB 1KPRA 2C5DC 3NCFB 3DSNA 1TVDA 3NGBB 4BSWB 4G6AC 3VFGH 3Q5TA 3UAJC 1T7XA 4U1HA 3TESA 4E41D 3T2PA 3KPMB 1YYLH 3QQ9C 5GGVL 5FXCH 5T3XD 5E24E 1KBGH 5K59E 5D71H 1HOCA 4X9IA 5D7JA 4NO0D 3ZE0E 2QQQA 4C83B 4F2MA 3EYVB 4HQQL 4GAFB 1QO3B 3RZCB 2C1OB 1LILA 3E2HC 4UNVA 1VGKB 5AEAA 3S88L 4OCRH 5I8KL 1NKRA 2NW3A 4MAYC 5SWZB 2EH8L 2ICEB 4MJIB 2PXYB 4K3DL 3QCVH 5L88L 2DMKA 3UZVB 2V2WA 1I9RL 4PV9A 3KHOA 1DBMH 4QHLB 5I17B 4YHNB 4RAVB 3FRPA 1NAKH 5IMOA 4S1RL 4RFOH 4DW2L 1W72A 2X70B 5IG7A 3WE6A 2JB5L 5HXMA 4LCUA 2Z91B 4P9MH 5HI3C 4X8JB 2FWOB 3TYGL 4F7CA 4XWOD 3JWNC 1A6PA 5IVZA 2DICA 2ESVB 2J3SA 1VFOA 1RY7B 1BIHA 3QEGL 2ZJSH 3H8NA 4FFVC 3C60C 1OW0A 5D7KE 4EUPG 3MBXL 4R26H 3VFNA 2X1WL 3ARTA 2X4UB 1FV1A 2NY0B 4YPGA 1IVLA 3OGOE 3VXSE 3SE4C 4EI5B 1UJ3C 1UZ6E 3QHFL 5EU5A 4PJAA 5FYLD 5C0RH 3U46B 1OAUH 5CJBA 5M94B 5EIIB 2I9LA 4NJ9L 3LPGA 5I76B 3FQXA 5I1DA 1BBDH 4G8GA 5FA3A 3VXPA 4X6CE 4R90L 1UWXK 4Y2DB 3WS6C 3KR3L 2H1PL 4LNRB 3RJDA 2AXFB 4GRMB 2JTDA 4N9OB 2XWBA 3B5TA 4M7JH 4PJFE 2F54E 2AJUH 2DKMA 1I9IH 1TJGH 4OI8A 4U6VL 4YBQC 1NQBA 3EW3B 4NZUL 5K9OB 5JW4M 3MR9A 4G7VH 5LVEA 1ETZB 4KRMB 4NBYB 3PWNA 5GISL 1K8DA 5LGKA 2MKLC 1Y0LA 4QXWA 5CKGA 4N1EA 4E41B 5IEKB 4EUPA 1N5AA 5DLMH 2DBLH 5CBAA 4NO0B 3WS3B 1ZKAA 4M4RA 4ZFFB 4M4PA 5DEFB 1XF3B 3VE0B 1FVEA 4RSVA 4K7PY 2ERJC 3SKOB 5SX4H 1N6UA 4KGLA 3MLSH 1PG7L 5ICXA 5K9QG 5GZNC 2PW1B 1UACH 4OLXL 1TCRB 5D2LA 3O3EA 4P5TC 1J0YA 4O51B 3I6GB 4PJDF 3BKML 3DX6A 2A77H 3HG1D 4C4KT 5C0DB 5J0BA 5KN5A 1OLLA 2MJWA 1NLDL 1T1YB 2ICWA 1S7QB 3X11A 1FDLL 2A6DB 1KENH 2X7LB 1UVQA 1E6OH 1H3WM 4M5ZH 1JZ6A 5TE4H 4KI5D 4M7LL 1YN7B 4YDJA 4WHDA 1F58L 1JF6A 3IRZA 4NM4L 5JDJA 2QJDA 3B8YA 2YPLD 3BKYL 3BT2H 3MXVL 1WBYB 3QXUA 1CZ8H 2DLTA 4MQ7B 1TENA 4G9DA 4L4TA 3FO2B 5C0EA 1RIVL 1XR8A 4XMPL 2WIIA 3D25A 4DJMA 1K4CB 5FYKL 3M45A 2NY1C 4LKXA 4YHLH 2OR7A 3U4AA 1HEZA 3MJ9A 4UNUA 1KN2H 3VXMD 5FM4A 3LQZA 4KMLB 2OJZH 1MCCA 2D9QB 4NNPH 3P0VL 3PWPD 4KKBC 4CDGC 1YPZB 2AJZB 2YC1B 2GJ6D 3D3VB 2W9EH 4HHAA 4OGZA 2YA0A 3IJSB 3KPPA 2PKDA 2A9NH 3LQAL 4S2SB 4XCFH 2YD2A 1IARB 4XCYB 4JO2H 3QA3B 3U7WL 5KVGL 3GZKA 1UWEL 3WN5C 1IGYB 3SE8H 3VXNA 1MIEL 3BH9B 4PJEE 2VDOH 3Q0HA 4HULB 3UYOD 1QP1A 5EIVA 3V5DB 5DQJA 1HHGA 1U3YA 2PR4H 4JGMA 2A6IA 2G5RA 5TGBA 5DFWH 2BMKA 3D85A 4EIZC 4M1DH 1DBJH 3UTPD 2H6PA 5F70A 3I75B 3M1BB 4U6YB 4NKDB 3GMQA 4PGJA 4Z7VA 1KG0B 3LQAC 2HVKA 1ADQA 4JY6B 3VD9A 1IMHC 2Z9TA 5D70L 2BFVL 2DQEL 4D0DA 4NZJA 3T8XB 1MRCH 5T33H 1T3FB 1WCBB 4LVNB 2EE6A 4GG6A 2VDNL 1CK0L 5F1NB 3A67L 1DL7H 4HS8H 1T04B 4DKFL 3DI3B 2ORBL 3UC0H 4MNHA 2VRAA 4GS7B 3VRLE 5DJXA 1T2QL 1FC2D 3LPWA 4QYOB 1N3NA 4DAGH 5C7XL 3SDXE 2KQMA 3UTZA 3PIQB 5F88A 3MREA 5ISZA 1PBYA 2VXTL 5BXFA 4QRQA 5ESAA 3CLEL 2IF7A 2YPLB 4OCYH 4XZUA 1KNOA 4CADB 3LAFA 3THML 1MHPL 4KVNL 3RQ3A 5FUZL 1OCWH 1KCRL 3NZ8B 5CSZB 5F6IC 1I8KA 2BHUA 3E0GA 2EH7H 2XT1B 4PP2A 5HVFB 2P1YA 2A6JA 4OM0L 2NZ9D 1RZFH 5EO0B 2FYYA 1T0PB 4JZJB 3T4YB 1DQDH 1KJ2H 1G7IA 3OHXB 3MRCB 3QQ3A 3VXMB 4LF3B 1IEBB 3O6LH 4LLWB 3DRTA 3PWPB 1C5DB 3BZ4A 5EZLA 5T3ZD 1LHZA 3S34L 3EDKA 3QO1B 2DQGH 2GJ6B 4KJPC 4OZGA 4PY7A 3TN0B 5FKPA 2JIXD 2NPLX 1B0RB 4ELKB 3ARDC 5JQHC 4Y5XA 5F1OB 2H3NB 1QG3A 3RNKA 1T7YA 4FABL 3O3BB 1AO7A 2NY7L 3RKPA 1S7XA 4PRHD 3U9UA 1MHEA 4LVEA 2X1PA 1HXMA 4YHOH 3V5KB 2X89D 1MFCL 1VENA 3PWVB 1FVCB 4GKNA 4OAWA 3HRZA 1JN6B 2GSIA 5E1AB 3MCG1 5D7JC 4QRRD 3FFDA 4J4PD 5CJ5A 5CGMA 3JV0A 4X6DE 2ZUVA 5GGVH 2XPGA 3U82B 3QULA 1W0WA 4HQQH 3GSVA 2NX5D 3S88H 4XPGL 5I8KH 1MCOL 4LSVL 1YECL 3BP5A 4OGXL 2EH8H 1F97A 4BH7B 3R0MA 4Z18A 4Y19E 4P5MB 4MDIB 3QUXD 4K3DH 4OFIA 1YEJL 1NANI 4APQA 5SWSA 3IDJB 3HE6A 3SDAC 1UT9A 4F58H 4OSUL 1QOKA 4S1RH 5BJTB 1F13A 5DD1H 4DW2H 4DZ8B 4HIJA 4JKLA 4YQXL 3BWAA 4HBCH 3BPNB 5GGSY 3EFFB 1OW0C 4AH2B 5LAXA 1EEYA 1MFNA 3VA6A 4OM1L 2VLJA 1EAPB 2IQAA 3PQYD 4R7NB 2BRRL 2LAGB 5EBWB 3HNVL 4YHPA 5CJQL 4OCWL 2Z8RA 1BQLH 4X83A 3I3EA 3MBXH 2PTUA 5C09E 5GS0L 3R8BB 1IKNC 3P4NA 2YZ8A 5DJ0B 3K3QA 1RHHA 3VFRA 1M6OB 1A4KB 2L7JA 2VDMH 1YQ2A 2IALA 1JPFA 2JKXA 4LSTL 2NNAA 2JIXB 4OZIE 4NJ9H 3T08A 2KZWA 4ODWB 4DCQA 4MJ2A 1RZKL 4R90H 3CCHA 3WDJA 3KR3H 2H1PH 4P3WA 4WW1A 4NNXB 1AE6L 4XP1L 5FYJL 1GGCL 2ADFH 2Q86B 3PUCA 4PRHB 4HWZA 5L2KE 5JPMA 5C8JA 5GS0C 4CU7A 3AS3A 3IVKB 2BSED 3IDXL 4NRXA 4ZNEE 4ZSOB 1RPQA 4Z7NF 4UNTA 4U6VH 3OAZH 3F7YA 2LQRA 1T5WB 4NZUH 5DK0B 4BSWA 4NO5B 3RWDA 4JDZA 1UKQA 3H0TB 4HC1A 4QRRB 5GISH 3QFJE 1CF8L 1SMOA 1OB1B 3LH2H 4CBPA 5D7KD 1GPOL 1RZKC 1I75A 3UPCA 3WEXB 3VU2A 3EAKA 3KAAA 3IYLW 4DN3L 1UADC 3RZCA 1MCRA 4PRIA 4ETYA 4U1GC 3VXSD 5SWZA 2NX5B 4D8PA 3AM8A 1JVKA 2PXYA 4MJIA 1PG7X 3QUXB 3INUL 4LOUC 4RAVA 2CQVA 1PG7H 4MNGB 2DLIA 4JAMA 4GH7B 3QNXB 2PO6A 2FX7L 2X70A 2J8UB 4GKOA 3P4LA 1W8NA 4OLXH 5GGUB 3QDME 2FGWH 3BKMH 2ESVA 4LPUA 4IRJB 1WGOA 3UXFA 1F4XL 2VLRA 1FDLH 2JJUA 2YWZA 2F54D 3PQYB 4YBLB 4ZS6D 3TA3D 4M7LH 2P8LA 1S78D 3TPKA 2FHBA 1YNLH 4NM4H 3ULUC 1YA5A 4NIKB 4EI5A 2GFBA 5DRXA 2R0WL 3MXVH 4IBLT 5GRJL 1T0MB 3MUHL 4ZG1A 4OZ4B 3U46A 3S7GA 1RIVH 1MVUA 4WI4A 1NMCC 5I76A 5FYKH 5T1LA 3VWKD 3BHBB 4HS3B 1X5AA 4LNRA 2LABA 3P0VH 3ETBF 2VQ1B 1K85A 1T20A 1A6WL 1H8NA 1LDPL 2EDFA 1A9EA 2CDEB 3C5SA 1S9XA 3QI9C 3V6OE 1R3LA 1B4RA 3GSOB 3LQAH 3LN5A 4WU5B 1RUPL 3S8WA 3U7WH 4G6KH 1ETZA 3EO1B 5KVGH 3WSQL 1GGIH 1DN0A 2ATPA 5C0JA 1UWEH 2W65B 1MIEH 1FIEA 2OXGA 3LHPL 4ODSL 3DUHA 1KOAA 1AR1C 4TUOA 3FB5A 3CFJB 5C0BA 2GJJA 5IW6A 4RISL 5A16B 4NKOA 3MLRH 4NFBA 3SKOA 4I3GA 5EBMB 3VXSB 4Q2ZB 1WC7B 1QNZH 1DSFL 5ENWA 2VSCA 4Z7QE 4UOW0 3PL6D 3WUWA 2ZCLL 3WJLC 5D70H 2BFVH 1T1WB 4LAQL 3ZKXC 1TCRA 4NWTL 4X6CB 2OJEB 2VDNH 3I6GA 2P42B 3A67H 2OZ4L 2P49B 2WLYA 5TDOA 1U3HD 2DM7A 1T1YA 3QP3A 1S7QA 4DKFH 4HKZA 4M61A 4Y88A 2YUXA 1R3KB 4P3DB 1T2QH 2BCKB 4PJFB 2ZUQB 3CX2A 2F54B 1CGXA 5C7XH 2FJFB 3S3SA 1RK1B 4IDJL 2GSGA 5E6ZA 3TA3B 1CFQA 2XQYK 4YBHA 3UTSE 5L8JB 4HV8B 1TZGL 4FQJH 3WXWH 3HPJB 4ZFOB 2VXTH 4CVXB 1WBYA 4XI5D 1CFNA 1JTOA 2F8VA 4RGMB 5FCSH 5ITFA 3OAUL 3ZE1E 4MQ7A 1MHPH 4KVNH 4YZFE 1KCRH 1QEWB 1J0HA 4RNRB 5JMOC 2MQCA 3DIFA 3N50A 3KLAB 4OM0H 3VWKB 5F93C 5I8OL 2YA2A 2XZAH 1H3XA 4OLWL 5DT1L 5DVNA 5I1IL 4G5ZL 3QDHA 5TQ2L 4NT6B 4PJIA 4RRPG 4N0UE 3S34H 4M1CC 5EU7E 3QEUB 5IMKB 4WI2A 5F1IB 1Q0XL 4EOWL 3P9LA 1D6VL 5I8CB 3OKKA 4XBGB 5LCVH 3QA3A 4WHYH 4M93B 1QFPA 4FABH 3BEWA 5ERWA 4OD2B 2NY7H 2YUZA 4YUEL 3P0YL 1V3MA 1ZT4B 2FCBA 2WUBH 2AV1B 4UAOB 4XC1H 3C6LC 4HSQA 3G5YB 4LBEB 4MSWA 1MFCH 1JE6A 3JV4A 1QFOA 3BRDA 4PLKD 3NN8A 4U6YA 1NC4A 4NKDA 4LRNL 3KLSA 4UIKH 5CEYB 4PYHA 1KG0A 2IJ0C 4JY6A 3FL7A 3RI5K 3FMGH 2HJFB 3PL6B 1JYXA 3MJ6A 4LLUB 1WCBA 4MS8C 5KG9B 5F1NA 2APTA 4WDIA 1NBZA 5DEGB 3RVUD 3HG1A 4ONOA 4XPGH 1MCOH 4LSVH 1YECH 4UT9H 4OGXH 4RRPA 2D31B 1U3HB 4QYOA 4P2CG 1YEJH 5B3JE 1KT2B 3OR7B 5LKNA 2MTPA 1CGYA 1KLUB 3D6GA 3NMEA 1SQ2N 5I1AB 4OSUH 3N85H 1NGQL 4O02L 3P9MA 3QXDB 2YPLA 3GI8L 4CADA 1CBVH 3W11D 3WNLA 4YQXH 2VB5A 1D5ZA 4Y4KD 2P8PB 1M1SA 4PJEB 4UUJB 5CSZA 3NZ8A 4MNQE 4OM1H 1VADB 2BRRH 1A6ZA 3IFOB 3MBED 3AAZB 2FHFA 5DJAA 2ZKHH 4JZJA 5CJQH 3OKYA 4OCWH 1LQSR 1GRWA 5GS0H 1U8QB 3SKJL 4YNYB 4RFNB 2EYRB 2W60B 4ISVA 4JFFD 5TDNB 5SWQA 1C5DA 4W70A 5DVKA 2C7UB 2CH8A 1NCBL 3U30B 2H26B 2O26U 1B0RA 4ELKA 2YPVH 1W0YT 3DGCR 2KBGA 4LSTH 2YXFA 1SMAA 5FM5O 2H3NA 3CD4A 3FOLB 1U8IA 5D2NE 1RZKH 1FL6B 1CDCA 4Y19D 1DVFC 1G7JB 1AE6H 1HSBB 4XP1H 1GGCH 3Q5OA 5GZOC 5EZJA 3TFKC 3V5KA 5EU4A 3SDXB 2ED7A 5JUEL 3NGBC 4NO2B 3PWVA 5HGDB 3RGVA 5HGBB 2J4WH 5E4IA 4QRPA 2ADIB 1T0NA 3VMOA 4LFHD 1JN6A 1FGNL 1X5HA 2EE2A 4NCC1 4HT1H 4NC1C 2X4NB 1G1YA 2Y4SA 3OG4B 4Q9QH 3RZCC 4ZD3H 4ZDHB 1AH1A 1CF8H 3SDDA 2BSSB 3FCTB 1CR9L 3PWJB 5FUCC 2AJXH 5C09D 5F44A 5JIKA 3UCRA 1ES0A 5D5ME 4KAQL 4KHXL 4P5MA 4MDIA 4JFEA 3ULUH 3GJEB 3IJYB 1R5IB 4OCMC 4PJGE 3CZFA 3G04B 4NBZB 5BJTA 3TBVB 2FX7H 5H2BA 5DA0B 2G2RA 2PF6A 4G8EA 4AH2A 1MCJA 2F53A 3ZE2E 3KYNB 3SE3A 5ITBL 3MGTB 4JPIA 1EAPA 2P47B 2NY0C 4D3CL 5L2KD 1CXIA 5FHAH 2R15A 3RTQB 2OP4H 5EBWA 1S7TB 3B4NA 4HMCA 2LVEA 5D2LF 3MBEB 4JKWA 1S9YB 1NDMB 1S7RB 4AIXA 1C5BL 1T1ZB 3JSSA 4KWUA 5AZ2L 2ZG1A 1JZ2A 5JDSB 2R0WH 3L3IB 4Z0XB 2E7MA 2OQJB 4KKCC 5DJ0A 5GRJH 3QFJD 2HLAB 3H42L 4NZDA 4S10A 1HQRA 1A4KA 4X6DB 4Y2DC 3IAQA 4BUGA 4GBXD 2ARWA 2IPKA 4ODWA 3RWIA 1VKXA 1O0VA 5E8EB 1EVTC 3K8LA 3VFOB 3A6BL 5JHDD 1OTTD 1IAKA 1ZT7A 4Y19B 3SGDI 1A6WH 1T7WA 4PRHA 3SGKC 2YR3A 1NANH 1EEUA 1Z5LB 3IVKA 2CLRA 3QUMB 2X89A 1UXWA 25C8L 2JCCA 1MFEL 5GSRB 2OTPA 4X4ZA 3QDMD 3WFBL 1T5WA 3O8XD 4G9FA 2NZIA 5FGSA 1D9KD 3JV6B 3WSQH 1A7NL 4QRRA 1RZ7L 1MPAL 4XTRD 1OB1A 1EIBA 1QPPA 3LHPH 3ARWA 4ODSH 5JNYA 4GXVL 1CDUA 3QIUC 1I7UB 5FKAA 4DZBB 1FE8H 4RISH 5C09B 2P24A 1AGEB 4WU7A 1DSFH 3QXAA 4OF8A 5FYLL 1KTKE 2GY7B 3UROR 4YE4L 1G1CA 2ZCLH 4MNGA 3HC3L 4JO3L 4K9EC 2BSRA 4HK0B 4OZIB 1LD9A 2GT9A 3NIFF 4LAQH 3RNQB 2J8UA 4YGVB 5F9OL 3ZDYE 2X4PA 4NWTH 4ORGB 4Z7VF 2NY6C 3GIZL 2ENYA 1AC0A 3MRNB 2OZ4H 5HHPB 5GGSA 4LDEB 3OBAA 3LKNA 2B1HH 5L2KB 3MUJA 1SJHB 3BMWA 4GG6F 4M62L 5CGTA 1ZLUH 4PJ5A 5IEHB 3DVNB 1JNJA 1TZGH 4RZCB 5T5FL 1NBVL 3ROLB 1LE9A 1CYGA 3A6CL 1T0MA 4OZ4A 2NY5C 3QFJB 1A7QL 4EN3A 3VXQA 2D3VA 1UM4L 4KV5E 1ZWIB 4GRWE 4D9QE 5F3BB 5FO9B 4LKCB 1JFQL 3GHBL 2YA1A 4GBXB 3ZKMC 4CVZB 3IB4A 4Z0BL 3TLRA 5I8OH 4HS3A 4HIHA 1AQKH 4PREB 2VQ1A 4OLWH 5I1IH 4G5ZH 5FDYA 5TQ2H 3EJZC 5TF1L 1H3GA 2CDEA 3V0AC 4MJ5B 5IK3A 1H0DA 1JNHB 5HVHB 5IP4A 4WEUD 1Q0XH 1QQDA 4JQXA 3MRJA 4WU5A 4CGTA 1WZMA 4AEHL 1K2DB 3NIDF 3QDMB 3OWEA 4H88L 3O8XB 5IMLB 4OZGF 1D9KB 4K71B 1Z0MA 4UILL 5IWLC 4YUEH 3UMTA 3V2AR 1CLZL 1FL5B 3P0YH 2VNCA 2VISA 4W4OA 3UTSD 4HUXB 5A16A 1JL8A 4CMMA 1FNSL 1RZIA 5EBMA 3VXSA 2V2TB 1WC7A 3TH3T 5GRVL 5CEZH 3L95A 1F3RB 3W39A 4LRNH 4RAHA 4GLRI 1FZOB 3HA0A 4CUCA 5GPRA 2PCPA 2WBWB 3MLTB 2DIAA 2FD6H 1M7DB 4O2EB 3ZKSD 4GS7C 3RP1A 4WW2A 4X6CA 2JJWA 2G75A 3QQ4B 4QHMB 4KI5C 4OKDA 3ME0A 1KIUA 3FRUB 1HXYA 2APFA 1HKLL 4P3DA 4N5UA 2BCKA 4PJFA 4KROD 4A2LA 4TNVF 1RK1A 4Q58C 1KLGB 1NLBH 1RFDL 4LVHB 3BIBX 4MA3B 4ZFOA 5IVXA 4R97B 1BFOA 1JCKA 1NGQH 4O02H 3GI8H 2VWEE 1FORL 4L8SC 4F7PA 1V3LA 4HF5L 3CU1A 3GBML 3NCEB 3PGDB 4D0BB 1A1OA 5IHZB 1S8DA 5JO5A 2QKIB 1QR1B 1CDBA 4RNRA 2B8OT 3IAGC 5D7LA 5F1SA 3J7HA 3O2DA 4U1LA 4YXKH 3TVMC 2Z31D 3MO1A 3QWOA 3ZL4H 1D5IH 4BSVB 3MV9E 3TN0C 1ZHLA 1BBJB 4NT6A 3SKJH 1P1ZB 1DBAL 3ESVF 5E6ID 4X7DC 4B7LA 1GAFL 4W81A 2EDHA 1MWAB 5ID0B 4YFLF 2DYPD 1HHJA 4U33A 3GSNA 4OD2A 3UJTL 3EBAA 1FG2B 3BGFB 4MLIA 3GUTB 5J9PB 1A1NA 1IQDB 1RIUL 1NCTA 3G5YA 3DVGB 4JPKH 4LBEA 3RWGB 3VRJA 5JUEH 3UTSB 3I85A 1DQML 4TUJB 3QIWD 3U2SA 1QSEE 1LO5B 2YS4A 4XHJD 5DD5L 1FGNH 1NKOA 2NTSP 5EFIB 3RVVD 4R8WL 1M7XA 3TCLA 4MNQD 4WTZG 4LSSH 4WO4D 5D1ZD 3ULSB 1MQKL 1T7ZA 3PL6A 4QRSB 2R69H 4LLUA 12E8H 4NO3B 1QYGH 2NYYD 3CVHH 2Q7YB 3ULVF 3WKMH 5KG9A 3I84A 1CR9H 5DDHA 1XGQA 5DEGA 2QQLH 3FB7B 3G6AA 5H8DA 2Z8VC 4XCEB 4KHXH 2XICA 5T3ZL 5AAWA 3MLWH 4N0UB 2VIRA 1C7TA 4A6YB 1KT2A 3OR7A 4KROB 1KLUA 2BZDA 3BPNC 4JJHA 4LCIH 4LQ1A 1CGWA 3VI4E 1YEEL 3QXDA 4JFYB 3QUKA 4TULL 1U58B 2IPTL 5ADOL 3DROB 2P8PA 3B9AA 3K2UH 4PJEA 4UUJA 1WICA 3FO9A 1B9ZA 2NZ9C 2XTJE 3R0NA 4D3CH 1SEBA 3V0WL 1ZA3B 3BVNA 3IFOA 5F9AC 3P11L 3VJ6B 2YD4A 3B9KD 3K0WA 3OKDA 4E5XA 3FTGA 1VFAB 1FRGL 5DWUL 1C5BH 1L6ZA 2Z31B 3ALPA 4P3CH 1U8QA 5FUOH 5AZ2H 4YNYA 2MQ0A 1H9VA 4WTZA 4PJXE 4L8DB 4HLZG 3VD5A 2E3VA 2QADD 3H42H 5GGRB 5E6IB 3HS0A 4LHJB 2H26A 3HFMH 2Z4QA 5GRWA 3VDBA 5C92A 2Q8AL 1IGFL 2FLRT 1J87A 1FPTH 4FFYL 4S0TD 4BQ8A 4DOHE 4OF3A 3AY4A 3FOLA 2A6KB 3H2WA 3A6BH 2A2QT 1FL6A 1FAIL 2DYPB 4KI1A 1G7JA 5HDBF 3QFDA 1T66C 1FZJB 3MACH 2N7AA 3ARBD 4EKXA 1HSBA 3BDYL 2HFGL 1MNUH 5HGDA 3BP6B 5HGBA 4EEEA 4F7MB 1VFBB 25C8H 1MFEH 3QIWB 4J4PC 5J12B 4UV4H 2Y36L 1KSRA 3WFBH 4K9EH 2X4NA 1QVOB 4HGWB 1A7NH 2WANA 4ZDHA 4MNQB 1RZ7H 1HSAB 3C2AL 3IFPB 4FA8A 2BSSA 4WO4B 5D1ZB 1VSCA 1OTUC 1CD8A 4NHCL 1EGJH 4GXVH 5ID1B 3QUXC 5F7NC 1EZVX 2X4RA 5DD6A 5TDPB 1J7VR 1KB5B 3UEZA 4JY4B 3GJEA 5B39A 4LLMA 1JPTL 4BFIA 4YE4H 3G04A 3HC3H 5KVEL 2XA3A 2NY5H 3TBVA 4IOFD 4IRJC 4HXBL 4X6EB 5F9OH 3BDXA 5D2NB 4I2XE 4YBLC 4U1KB 4LFHG 5B3NA 1SBSL 3TO4D 4NZRL 4Y4KA 3GSRB 1OOAA 3MGTA 3CPLA 1S3KH 5IESL 3Q6FA 4GMSL 1FFPA 4TRPL 4JFHE 1RVFL 1BVKB 2AJVL 5FF6B 4OQTA 4M62H 3UJIH 5F7WC 1S9YA 5C9JA 1S7RA 4IS6A 3B9KB 5T5FH 1K3ZA 1NBVH 4FNLL 5JDSA 3A6CH 1J1PL 3L3IA 4Z0XA 2OQJA 2GK0B 2VDQL 4JFFA 3RL1B 4OCSL 1A7QH 4GFTB 4PLOB 5E08L 1U8LB 2QADB 2EKJA 5HDOA 1D5BB 1UM4H 5C70A 3F58H 3TWCL 1U0QA 5E8EA 1JFQH 3GHBH 4Q74A 1G0XA 3VFOA 4Z0BH 2XY1A 5EORL 1KLFA 5D5MB 4D0CA 3HLAB 1N0LA 4JHWH 1P2CA 1KCUL 4M7KL 5E2JA 5TF1H 2AJYH 3ARBB 4LCWE 4F80A 1Z5LA 4PJGB 4MQXD 1N64L 5GSRA 4F9LA 4AQ1B 4QXGL 4JRYE 1B6UA 2HT2D 2BK8A 2C26A 4AEHH 4PJIF 4U6HA 3BI9X 3U0PB 1R5VA 1OAKH 3KYMB 3U6RA 3NZHL 3C5JB 4HIEB 4GAYB 1N26A 1IT9L 5EIQA 5E8DL 2OSLB 5DHYB 4FZEL 4Q6YA 4ZFOL 5AYUL 1GOFA 3GMRB 1QLRB 4X6FB 1KEGL 4JFDE 4XPAL 1FNSH 1U91A 1KIQB 2E6PA 2OTUB 4JZOB 2YRZA 5ETUB 3FOMB 3STZB 1TJHL 4D9QD 1N0XL 1AD0A 1FNGB 4P2OC 4M6ML 5GGTL 1NL0L 3MZGB 1IZKA 3PDOB 2VDKH 2QSQA 4LLQB 2G60L 3RNQA 4J8RB 2XZZA 4F33B 1HHHA 2ZUQC 4WTWA 3MRNA 4L1HA 1RZ8B 4XMLL 4Y1AA 1RZGB 1BZ7B 5DJ2B 1HWGB 2CO6B 3TA3C 5HHPA 4GXUN 1XF5A 4NSKB 3TO4B 5DVOA 4YDIH 3S37L 5L2KA 3WO3B 1J12A 1HKLH 3FQTB 4M5YH 1SJHA 5FYKU 5M7QA 4RGMC 5IEHA 3DVNA 3CIQA 1RFDH 1NCCL 4FZ8H 4ZNEA 2XQBH 1VCAA 3OKEA 1UB6B 3MYZA 3TH4T 1FORH 3T1WA 4HF5H 1MHHB 5E8OB 3GBMH 4POZD 3QFJA 4KI5F 3PE9A 3VWKC 5FO9A 3KYAA 4LKCA 1YYML 1E4XL 3K80A 3K81A 1CU4L 4K55A 2AQ2A 5JHDA 3G6JE 3RUGA 1N2RB 4G8FA 1YQVH 2IPUG 3H7BA 3T04D 4X5XB 1DBAH 1K8IB 4L8BB 4XBPA 3BPOB 4MJ5A 4M93C 2AXGB 1INQB 4I0PD 1HHKA 1GAFH 2H9GA 5KTEL 2HN7B 3K2MC 1AGBA 4AG4L 1U8KB 5IV2B 2AJ3A 3TT1L 1CGSL 3O8XA 4UAOC 5IMLA 5KANG 3UJTH 3BMVA 1QLEL 2EXWD 3MA7B 1JZ7A 1RIUH 2VMFA 4HUXA 4KXZI 4YC2B 2E9IA 1JRHI 3FHAA 3MGOA 3DI2B 2NLJB 5DD5H 4UIMB 1N7MH 1RURH 4WUUE 2VZVA 4PB9L 5D72L 3GHEL 1A14H 4JANB 3NBNA 3DUUB 4EQ2A 4GRWB 1MQKH 4PG9B 5CSGA 1A3QA 3MLTA 2N56A 1FFQA 1CICA 5F89B 3EOAB 3QJFA 5JIIA 1F6FB 1U3HC 2ZWLT 4C56E 3NCBB 5J1AB 3MV9D 1RZJL 3QQ4A 5CIPA 4QHMA 2NR6D 1UEYA 4JPWL 4ELME 2W9LA 1ZLVH 2IQ9L 3QXWA 2YMXH 3V6OA 5EPMA 3E3QE 3D1MC 4OT1L 1I4FB 1KLGA 4NZTL 3MLYL 4JCMA 1I3GL 2BOCB 3F6LA 1LO3L 5K9JL 3RWFB 1S9VB 3V4UH 3WMSA 1F5WA 1OWRM 4FXKB 3NACL 2QSCL 2Y5EA 3VDCA 1T7VA 2IPTH 1ZHBB 1OF2B 1WWBX 2M1KA 2OM5A 5ADOH 3L3KA 4GRLD 1MCPL 5IHZA 3RPIB 3EHBC 2QKIA 2MSPA 5CLTA 5EWIH 3NAAL 4AYFA 1RZJC 3UBXB 3VG0H 1NGYB 2R1WA 4HUVB 1QSED 2V5YA 4KTDH 1U8NA 2O5XL 1D5MB 1H15B 2Y9RT 1FLTX 2HFEA 4BSVA 2YBRA 5DWUH 5GRZA 3U30C 1BBJA 3HZYB 4HJJL 1MELA 5E7BA 4E0RA 3ZT6A 1I9JH 3TC9A 1N59B 4W4NA 4GLRH 3AY4C 5D1QD 4HH9A 4UINH 4WNQB 4QHNB 1OAZL 5IFAL 2MMXA 4I0PB 2H41A 5IB5A 1IEAB 4ENEC 1IAIL 1IGFH 1MWAA 4FFYH 4DK3A 1OWWA 2OL3B 5EO1A 1J0IA 4K94C 4R4FH 3RVTD 2FSEA 1AIFA 9CGTA 2O5ZH 3OGCB 1FAIH 1BX2B 5HI5D 3UPRB 1FJ1B 4MD0B 3U36A 3W9EA 1GL4B 2VYRE 5J9PA 1IQDA 5IW1A 3OB0H 3BDYH 5CJXA 3UTSA 4QT5B 2EXYD 3QCUL 1LO5A 3KG5A 4PRPE 3VFSB 3UJJL 1B0GB 4KUCD 1R5WA 5I6XB 1MJJA 2Y36H 3RWEA 5EFIA 3QCTH 3P73A 2HTKC 4ZO6A 2XTJD 1YEGL 3CUPA 3KPLA 4OUUB 5BQ7B 1MRFH 2JCCF 1KCVL 2QV2A 2XZQL 3C9NA 3KLDA 2XG5A 5HI4D 5JW5B 2V17L 2PYEA 3RVUC 3QT2A 2Q3ZA 2EDQA 1Y6MR 4QRTB 2EDBA 3HZMB 4NHCH 1NMBL 3FB7A 3UDWA 3TBYB 3MV9B 4XCEA 1T83C 1OVZA 4ZXBD 5TH2A 4XVUC 1JPTH 1TZIA 3N1MC 4JM2D 4L9LB 5DJYB 3O9WA 1CVSC 2ZUYA 4AY0A 5KVEH 4Z76B 2HKHL 3DX9B 1JHLH 4NQEA 2OYPA 4BZ2L 3RTQC 1LEIA 4TPRL 3DMMD 2FIKA 3DRQB 2MHAB 3MBEC 4X0KB 4NZRH 4JHZA 4YFLI 3D2UD 3ORJA 5EU6E 5IESH 1ZA3A 4TRPH 1V8HA 3QUML 2HVJB 1RVFH 2J8UF 2AJVH 3FT2A 4MB3A 1I7RA 2VE6A 3L6FA 1A47A 1JGDA 3PWUA 1QSEB 2HH0L 1JRHL 1VFAA 1HYSD 4KJYB 3HAEA 5F9JA 3UTTE 5L8LB 2VDQH 4L8DA 3ZDXE 5CP7A 5FYJU 1HILA 4JM4L 3NFSL 4OCSH 4ETQB 2A74A 5E08H 5D1QB 1P5VA 3TWCH 4L9DA 2VOTA 3WXVL 4LEOB 1RJYB 4UTBL 5IKCB 2B1AL 4CW1B 5EORH 4MMXC 5K59F 1SM3L 4F9LC 1X4YA 3ZE0F 1KCUH 4M7KH 1A3LH 1MFAH 3MCLL 3DPBA 1P4BL 3FQWA 2XACC 4R0LA 4XVTH 5CZVL 2VXUL 2ZP0T 1R0AL 2PYFB 1N64H 3DARA 4JB9L 5ICYB 2E7CA 3QUZD 5E0QA 2AJSH 1HINH 1KJVB 3O45B 1HQ4B 3IDUA 1DBBL 3UX9B 2IAMD 1L0QA 3OQ3B 3HI5H 4MNQA 3IFPA 4PRBB 2XTJB 2HT4D 4WO4A 4JFHD 4S1SL 3NZHH 4ZUSA 3CFKB 3CJJA 4RMTA 1IT9H 4YPJA 5ID1A 4FZEH 3QR2A 4NQSA 4KHTL 5AYUH 4K3HA 1UWXH 3QWRD 2YN5A 3WNMA 1J8HA 4XPAH 1KB5A 3EFDH 4PJXB 1FNFA 4JY4A 3MUZ1 5DC0A 5B38B 3LY6A 1TJHH 4ZXBB 1N0XH 3K8KA 4PJ7B 4RFEA 3O6KL 3BYTA 4M6MH 5GGTH 3RX7A 3ZLQC 1NL0H 1A4JB 4JM2B 4H1LB 1TZHB 4RGNE 3HMXA 1UZ6F 2EDYA 4DOHB 4GAJL 2G60H 1EUUA 1MCBA 4E42B 3S37X 3KJ4B 3GSRA 3DMMB 4XMLH 3Q1SL 4JKPL 3KPSE 4LCWD 3S37H 5DD3H 3D2UB 3N0PB 4Y5YB 1BVKA 5F7DA 4WW2F 5C0AE 4LP4A 1X5IA 4X6CF 5DR5L 2GTZB 1BQHB 2YK1H 4JRYD 4X7CC 3SDCD 4YDLB 1NCCH 4XNMA 1J5OL 3SN6N 2GK0A 4NQVA 1YC8A 4PJFF 4BKLB 3RL1A 5D1XD 5F3HA 3ARED 3WLWC 3TBWA 4GBXC 3C8KB 3WNPA 4H8WL 3WBDA 4KVCL 1AXIB 4NYLB 2DLEA 3C6SB 4BM7A 5IVXF 2FECL 1OTTC 1E4XH 2IADB 1CTOA 5DJCB 1CU4H 1VFUA 3OR6B 4JFDD 4AEIL 5HVHC 5D5MA 2Y07H 4LMQI 3O11B 3B2UD 4UDUB 3RIFF 3DV6A 1Z9MA 1UC6A 1I3RA 2BSTB 2JB6B 3ARBA 3CFEB 1WV7T 2CXKA 5DJDB 5CLWA 1BGXL 5J1SC 4Y4HA 5GHWL 3W5MA 4O5LH 1UCBH 1JWSA 2XNAB 1D9KC 4N0FB 4K71C 2FX8L 3QUZB 3HNSH 4XTRC 4AG4H 4I2XB 3RFZC 4KRNA 2LU4A 5KVDL 3U0PA 1ORQB 3TT1H 5J4MA 2HMID 1I1YA 2IAMB 3RAJL 3KYMA 4WGVB 3TV3L 3V8CA 4F37K 4MXWL 1MCWW 2HLFD 1A9BA 1QLEH 2P4AB 3EGSA 2OSLA 2P44B 1QLRA 4DFHA 4FQPA 3RL2B 3SHSA 5GRXG 2FR4B 5IQ9B 1KIQA 1YUHB 2CLVB 1MCDA 3BAEL 4NRZB 5EA0L 5FECA 5ETUA 4C57C 3STZA 5JW3L 5D72H 2CLZB 3GHEH 1NBYB 3PDOA 3VG9C 4ODXB 5IJVB 5LJYH 5HVGB 5BZWA 2ADJB 3OF6D 4HLJA 1KJMB 4F33A 3CDCA 1MCQA 3SBWA 5I1LB 5HPOA 4J7RA 5DJZB 3V6OC 4KMTH 1RZ8A 1RZJH 1RZGA 1BZ7A 2UYLB 3T3ME 3NTCL 4LIQH 4JPWH 4JFZH 3TO4A 3QNYB 4F9PC 4R97C 3FQTA 3CVIL 5IMMB 4LCWB 2CDGA 4OT1H 3AROA 4NZTH 3MLYH 2EEAA 1I3GH 2E6QA 1WCQA 4QXUH 1PX3A 5K9JH 4JRYB 1MWAL 3SDCB 4OQ1A 4POUB 5JZ7D 5DMJB 3NACH 1AGFB 2QSCH 5L7XL 1MHHA 5E8OA 1MEXL 2IG2L 4GUPA 5J89A 5D1XB 3AREB 4JREB 1MCPH 1E27A 2FZ3A 4K94H 2UVFA 3NAAH 3G5XB 1MQ8A 1D6EB 2WBKA 4WI5A 3SKUD 5DJ6B 3RDTD 3WNKA 4GJTB 1VB9A 3DXAA 3C5ZB 2O5XH 5JXED 4JFDB 4PJEF 3X12B 3BYYA 1N2RA 4EXPX 4IIQC 5HGGS 2BNQE 4WUUD 1NCWL 1K8IA 1EEZB 4EIGB 1INQA 4YHZH 3UAJD 1OAZH 1IC5H 1JGEB 4C56D 2VZSA 4JG1L 4XPTH 3QQ9D 3BGFC 4JN1L 5IV2A 3T65A 5FB8B 4HLZH 1Q72L 2HRLA 2VUYA 3O3DB 4A6YL 3KPNB 3MRIB 1DDHB 3TH2T 4K3EH 3KXFA 3UBXG 5KJRL 4HKBB 4ODVL 1NGZB 4I48A 3NIGE 4MDJB 3UJJH 2BVTA 5KAQG 4HD9A 1N5YL 3LQMA 4ODHL 5DSCA 1P4IH 1CS6A 4JANA 2E8ZA 1XGPA 5L6YH 3DUUA 5IROA 3MLPA 2HTLD 1ZGLB 2FLBT 4PG9A 2XZQH 1IAOB 4DFIA 5F89A 3EOAA 4QHUB 2V17H 5L2JB 4F15B 1FIGH 5E7FA 3C60D 1NMBH 2GCYB 3G6JB 4GT7A 3B83A 4KROC 5EU7C 3D69B 3ZKND 4PUBL 1XGYH 4PGBB 4XCNA 4ZPVA 5ICZB 2DRUA 4NUGL 2VC2L 4NQXA 1I4FA 2BOCA 1S9VA 2EC9T 2WV3A 3C8HA 3R1GL 2DL2A 2HKHH 1C08B 4BZ2H 1VDGA 1ZHBA 1OF2A 2V9RA 3QSKB 4DK6A 3RPIA 4G43B 1PSKH 2Z31C 3HE7D 3QUMH 1NGYA 3RDTB 1FFNA 4PRPD 4HWBL 1SY6A 3U79A 3IDMB 1KJ2B 2HH0H 5E6IC 1JRHH 3OKLA 3HZYA 1F4HA 4OV5B 4OLYH 4WUUB 2HKFL 1N59A 2AVGA 3ULUE 3RJQB 2AQ1A 4JM4H 4WNQA 3MLZL 1J1OL 4QHNA 4X4MA 4J3WA 4N8CL 3L9RB 3IU4L 4OF5A 4TSBL 4XC3L 2OL3A 5EOCL 1WT5C 4WI3A 4C56B 4UOW1 3WXVH 2AXJA 2B1AH 1KB5L 3NVQA 4M02A 3UPRA 4ELMB 1FJ1A 1GZQB 4MWFB 1SM3H 3WIHA 3A6OA 2YD8A 3QIWC 1L7IH 1NFIB 5J12C 2G5BA 3MCLH 4XHJC 1P4BH 1FH5H 4XT1C 4QT5A 2VXUH 4HUKB 5CZVH 1R0AH 1G9ML 3RVVC 4JB9H 1FO0H 4V2BA 1MI5E 4MHHG 5D1ZC 1RSFA 5GZND 1GC1L 2DLGA 1UQSA 2AV7B 5EU6D 2YUVA 4POYA 4OUUA 4PJBE 4PY8J 5JW5A 3VD4A 1KIRB 5J57B 4S1SH 2VSDA 5FK9B 1J8KA 4OLEA 3O41B 1AI1L 4PJHE 1RJZA 5EU3B 1MH5B 2ITDB 4KHTH 3MV9A 3VXTA 3C60B 1DCLA 2R4SL 5MI0B 3UTTD 5GS1A 2DWEB 5DUPH 1G9MC 4JY5L 5FO7B 3L3OA 5D2NC 2GKIA 4IOIB 1GC1C 4QXTB 3ZHKA 4KRLB 4HUWB 1YNTA 4Z76A 1C16B 3DX9A 2D4FA 3SJVE 2OR8A 5TE6L 4GAJH 4HUUB 5HHVL 2NY1D 3OTTA 3DRQA 1MUJA 3L7FB 5HDLA 1NMAL 4X0KA 4PBVC 2P7TB 4GRLA 1NUGA 4U0RB 3REVB 3AUVA 3Q1SH 3IF1B 4HFUL 1J05B 3B9KC 5T1MA 3WIFA 4LARH 3BKJL 4RIRA 5EG6C 4X7TB 1IEHA 3HE7B 5DMKB 3QISA 2VITB 1QSEA 4UQ2A 2D0FA 1T22A 4PRPB 1EO7A 4WEBH 2QADC 4IRSD 4XVJL 5F9DC 7FABL 1J5OH 1V5JA 1WWCA 1XIWC 2R23B 1IM9D 5C6TL 2EIBA 5B38G 4ETQA 3DWTA 2YD1A 1BJ1H 4KVCH 2X40A 5D1QA 4E9LA 1O7SA 1CL7I 4PRDA 3HKFA 5IR1B 4GW5A 1CI5A 1PQZB 4LEOA 4H1LG 5IKCA 3ARBC 4AEIH 3AB0B 2CKBB 1ZVSB 3FZUD 4LLAA 4HZAA 3MOAL 5FOBB 4GKZB 2VQTA 1SVZA 3LEYL 1EXUB 3T0EA 4OI9A 5ALCL 2CUMA 2PYFA 4RGND 1ZK9A 3UO1H 3RUGF 3ARFA 1BQHG 2RB8A 1KJVA 3O45A 1U8HA 4XNQB 3L7EA 1I8LC 4ZUWA 3FT4B 5KVDH 3QRFM 4DVRH 3KPSD 3RAJH 4UT7L 3TV3H 1CLYL 5C0AD 5BV7B 5KSBE 4MXWH 3PHOA 1ACYL 2VABA 4ZO9A 1SYSB 4R4ND 3MV7E 3BAEH 3P0GB 1Z3GL 5JTWA 5EA0H 2A73B 3UTTB 5B38A 5IF0A 3IDIB 3TGXA 3BOVA 3LS4L 5JW3H 3RY6A 2DQDL 4NQDE 2EICA 4DKDC 1YY8A 1A4JA 4JM2A 4H1LA 1U8PB 1MVFA 3TO4C 4JQVC 2CRYA 5KSUA 5TPWL 2CK2A 1YN6B 5FIEA 3HC0B 2OXHA 3IFNL 3VW3L 3KYOB 3DMMA 4C59B 1RJCA 5E8PB 3RA7H 3NTCH 1IGTB 5IJKA 3NPSB 3M17B 3D2UA 4Y5YA 4HKJA 3CVIH 5JOEA 2GTZA 1BQHA 3T77B 1UZ8B 4DQOL 2HG5B 3MFGB 1MWAH 4QTIL 4IRSB 3REWB 5CEZE 1ZV5A 2ZUTA 5L7XH 4LDOB 1MEXH 1ITCA 2IG2H 4DGIL 3C8KA 4U6XB 5H35A 2HFFB 4PBWD 5BRZE 3ILPB 1IM9B 3C6SA 3S6CA 4M00A 1A6VL 1C1EL 1JHKL 2D9CA 2ZSVB 2JLLA 2H32H 3OR6A 3P40A 3BPOC 4QTHB 1XH3A 5DMIL 1YEKL 5JIPA 4ZFZB 4MQXC 4LPCA 4N0RA 1CD0A 1Y18B 2BSTA 3CFEA 1BWMA 2HT2C 1NC2D 3RWHB 2XNAA 4RGNB 2X9XA 3UP1A 4JG1H 3QUZA 1G7PB 2CIKA 4I2XA 1F4YH 4U2YA 4JN1H 1ORQA 3F7VB 2IAMA 2DJUA 4N5ED 4YC2C 1Q72H 2ILLA 4ZUUB 3KPSB 5AWNL 2GYSA 4A6YH 1WLHA 4EI6A 4ZOCA 5C0AB 4YHIB 1NSNL 3KHQA 2DM3A 3RL2A 1A8JH 1YUHA 2CLVA 2YUWA 1MJ7L 4ODVH 3VH8A 4KGJA 5JMRA 1MRDL 5IHBA 4GKSB 2C4FT 4MA8L 2CLZA 1NBYA 1AQDB 5EUOA 1UJTA 2QHLA 2EZ0D 4K2UL 3G5ZA 5IJVA 1KJMA 1SY6L 5I1LA 1S7WB 4OZFB 2RJMA 1KF9B 5IW3A 2UYLA 4G8IB 2BNQD 4YZFF 2NY4B 3NPZB 4PUBH 4HJGA 5IMMA 4LCWA 1WWWX 5B21A 5BS0E 1NH6A 2VC2H 2APBA 4MXQD 3SGEH 1AD9B 1X5ZA 4L1DA 2OL3L 4POZC 1B4JH 1XGTA 3R1GH 1A6UH 3T4AB 1AGFA 2DDQL 1A0QL 2C3VB 1VGEL 3AREA 1JK8A 3WIHL 1U8MA 4K23H 1MFBL 3SE9L 3G5XA 1D6EA 4K3JL 2HWZL 1M7IB 3IFLH 1OARH 5DJ6A 2CRIA 2B4CL 3MYJB 3DETD 1IGJA 4N0CD 5HYJE 1J1XL 5HYQB 4HWBH 4JFDA 2XYCA 3ILQD 1HZHL 5J6HB 4I0PC 5DFTA 4NKIH 3GBLA 5FOJA 1PLGL 2HKFH 2DN7A 3MLZH 1J1OH 2Z92A 1GSMA 1NC2B 3WFDL 1JGEA 1H3PH 2DOCA 1JV5B 4TSBH 3MRMB 5EC1A 4M7ZC 5FB8A 4PTUB 2GUOA 1KB5H 1ND0B 2CJUL 4LLYB 4DGVL 5IOPA 2BY2A 2AQ3A 5MENA 5EOQL 2B4CC 4L8CB 3KPNA 2I5YL 3MRIA 5I8EB 3V5HA 3LKSA 1DDHA 4LSPL 2VWEC 4F57L 2DMBA 5I6XC 4Q0XL 1R3IL 1NGZA 3V79C 3I2CH 3QIBC 3AMLA 4R2GD 2VXSL 2AABL 1GC1H 4U1SA 5B3JF 3OX8B 1GXEA 3UYPA 1BLNB 3ARYA 4GOSA 1EJ6A 1MCKA 1QSVA 3VFVB 4QHUA 2NR6C 2VLKE 4CN6A 4LCYB 1AI1H 4JGJA 5E2UH 2HJKA 3O3UN 1JGUL 4MQSB 3NABL 4RGOH 4R3SB 2AAVA 2R4SH 4L9LC 1R3HA 4PGBA 1FZMA 4DN4L 3ULUD 3E6FB 3TT3L 5ICZA 4PIRF 4BH8B 1JHTA 5F96L 4JY5H 1U93B 3QWQB 1AXSB 3KPOA 4DVBB 2J6EL 1OM3L 3D9AL 1ZS8B 5TE6H 1