1IC7H

Crystal structure of hyhel-10 fv mutant(hd32a99a)-hen lysozyme complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSAYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWAGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for entropic contribution of salt bridge formation to a protein antigen-antibody interaction: the case of hen lysozyme-HyHEL-10 Fv complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding/hydrolase
molecule keywords LYSOZYME BINDING IG KAPPA CHAIN
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ic7H00
2VLJA 2DQEL 1R5WB 4CW1A 5EOCL 1BFTA 2GTWA 4OCXH 1INDL 1CDHA 3L95B 5JW3H 2HLAB 4RISH 5BO1H 1TDQA 3BUYA 4PR5A 3LKPB 3GK8H 4W6XB 5D96B 1NMAL 4MNQE 4KRNA 2FJHB 3HZKB 1A64A 3HE7D 1CZ8H 4BK5A 3ZSSA 4P23A 2QV2A 5LGJB 5EORH 3V9FA 5AD0A 5LG1A 1WUNT 3B9KD 1MJUH 4J4PC 3ZDYE 4PRPB 2XICA 2EKJA 1J0IA 1MI5A 2OTPA 2APWA 2OP4H 2VDMH 3G04A 5I19H 2X5PA 4Q6IB 2IH1B 5I1HL 3C87A 3QP3A 5I73B 3H42H 3LV3B 4PGBB 4NNXA 2DQGH 3TZVB 2BX5A 5SV3A 1NGQH 5CLTA 4Q58C 5CZXC 3JV6B 3AS2A 5E7BA 1XGTA 1S5IH 3ULVE 1HSAA 4FQPA 1F6AA 4K7PH 1H8NA 4CMMA 3HNTL 2XZQH 3IDJB 5C86A 1GVIA 2E7CA 3ARGC 1JHLL 1P2CB 4NQCA 4X5WA 4XTRD 4PJGA 3W0WB 1CXKA 3FRUB 4UTBL 1NKOA 4YR6A 3G6JE 5I1IL 3HG1D 1U93B 2P8PB 3R0NA 1UZ8B 2HT2C 4IMKC 1R3KB 4GBXB 5T33H 5BV7B 4WFHE 1QFHA 3EW3B 5DR5H 3WBDA 1YMMD 1OGAA 3IXTA 4JFYA 1SJXA 4KQ3H 5KSBE 2EC9U 3VXMB 5JXAL 1WWWX 5F7EL 4QXTA 4NZDA 4ZUUA 3VFTA 2NY1B 5DZNA 4JM2C 3OX8B 3RPKA 3FONA 2RCSL 4JQIL 2DIJA 5E1AA 4C4KT 3OKKB 4JDVA 1B6UA 4LVNB 1DSFH 3OJVC 4DCQA 4HXBL 2B1HL 2Z35A 5HGHB 4ZFGL 5C08E 2P43B 4C57C 5C0IB 3V8CA 1G6VK 4L29A 1Q72H 4S1DC 5IB1A 2EDQA 3X3GH 4O4YL 5EPMA 4A6YH 4A2MA 1A7OH 5JXED 4LPVA 4F15B 3E1F1 1UZ6E 4W81A 2YWZA 3V5HB 5D8JH 1JL8A 1ZK9A 4QHLA 5EC1B 2P46B 5D1QB 3QH3A 4QOKB 3ARYA 3O6KH 1J8KA 1CXLA 1XGUA 1P84J 2KH2B 1RUKH 5IFAL 4JKMA 1FNAA 1HDMB 1RZJH 3HB3C 4G6KL 5C0AB 4GG6F 3IU3B 3S5LB 4WUUD 1QLFB 2GW5A 5D72L 1VADA 3STZA 2OZ4A 1VESA 1A22B 4MD4B 3BWUC 4ZOBA 5D2NA 3TBVB 4JO3H 4WY7H 3O4LE 2C1PB 3VWKB 5IUSA 3G6JF 4EI5D 1OAUL 2W92A 1AHWA 2R4SL 4LP5A 2NXZC 2DQDL 4S2SA 5D1ZD 3MV9E 5KVEL 1OAXL 5F1KC 1M7XA 4DZBB 5E8DH 1N2RB 2PYEA 3VXUA 2GSGA 1KTKE 5LGKA 4U0RB 3GSWA 3TV3L 4ACPA 2DTSA 4JFFE 4G8FB 3HLAB 4RCAA 4X9GA 1N6UA 3P4OB 1MJ8L 4G5ZH 4XAKE 2M8XA 4LLVB 1OGAE 5E08L 1FL5B 5GGSB 3KG5A 3MLPA 4WEBH 1T66D 4RAVB 5E70A 2EYSB 5F7EH 1YEGH 5F71A 1T2QL 5GRWA 1ZLVH 4PJBE 3CX2A 1KIQA 3V4UL 1J1OH 2CDGA 4NRYA 5I2IB 4DAGL 1N7ML 4D0DA 2APFA 4U1KA 2ZG3A 1MF2L 2WBJC 1KJVB 4XH2B 4LCWA 4MHHI 3H3PL 1LVEA 4L8BB 1NGZB 3X3GL 1RUMH 5DMGC 5EZIL 5FO8A 3UP1A 4PPTA 3S96A 4OAWB 2B0SL 1UEYA 3NCFB 4U1JB 3KLDA 4JFOA 4WO4D 5IT2H 1MFNA 4MNQB 4Y5VC 1TVDA 5MHSE 3BDYL 5DD3H 4WFGE 5JPMA 1NBVH 5E2JA 4ELKB 2QSQA 5DGQA 5T5NF 2EYSA 3VJ6A 1BVLB 3VFNA 3MBEC 4QXUH 5CP3A 5LQBH 3PHQA 1P5UA 1NANI 1OB1B 4U6YA 3FZUC 4EUPA 2VNCA 1HKLH 4XP1H 4M5YH 4Y4FC 5ENWA 1KFAH 3WXWH 2BNQD 4JM4H 1G9ML 4DW2L 2ARJB 3UPRA 1I8KA 4I3SL 1U8KB 1S5HB 5DJ8A 1GOGA 3OKKA 5E8NB 5JIPA 3U7WH 1W72A 5E6IA 1N2RA 2PYEB 3VXUB 2FHBA 3PWPD 5DJDB 1GZQA 3UBXB 3RWHA 3WCYA 4ZSOE 5JO5A 3HI5H 4XP9L 5IVOA 2BSRA 2VZVA 4U1NA 3VWJA 2P5EB 3QUKA 1EGJH 2B20A 4JJ5B 1SYVB 2XKNB 1BF2A 2VH5H 4C4KO 4OD2A 2HLFC 1SBSL 1FVCB 3CZFA 3V52H 4XC1H 4L8SB 2DIBA 2PUQT 3LQAH 3RVWD 3MRNB 1OAKL 2FBJL 3D85B 4MQXD 4U1MB 2LU3A 3PDDA 4PJDB 2V2WA 1JWMB 4XAWH 4R3SA 3REWA 5I30L 1MI5E 5MERB 1UWEL 4KK5D 3BWAB 2VMFA 4IOFC 1A3LH 1YYLL 1E4KC 2BCKB 5JLZA 6FABL 1GIGL 4P2OB 3MRIB 3SJVE 3MGAA 4JG1H 4QRPD 3AB0C 3CVIH 4FQLL 2H41A 4YDVB 4N0UB 3WFEH 4WI6A 1H3WM 5HYEA 4QTIL 3AU1A 2QBWA 4RDQF 5IF0B 3PP4L 1GZPA 1S7UB 4JG0L 3B8SA 4QHMA 5IGXL 1E27A 2ZUVA 1HN1A 5D7LD 3IDGB 1F45A 3NCYS 4N0UE 2CSPA 4ODUB 3DUUA 4NM8H 3PG2A 5J3HD 4N0CC 3LKSB 2IALA 1NCWL 1RZFL 3GNMH 4CMHB 4D2NA 4NUJB 4Y19B 1T22B 3WFHB 2AV1B 4OFPA 3BX7C 4XX1G 2BVUA 4UV4H 3I6KB 1A7PL 3BQUB 1A6ZB 3I9GH 4DQOL 3L9RA 1UJ3A 1NGYB 4JANB 1FL6A 4OFKA 3SCMD 4ETYA 3V6ZB 4PRNA 1IKNA 7CGTA 3IVKB 3MRIA 1FLRL 4B7IA 1J8HD 3KJ4B 1S7RB 1HOCA 1IC5L 1CVSC 2WMPA 3D25A 5BQ7A 3F7YB 5FO7B 2V9QA 3GSRB 4KKBD 2KUTA 2X1PA 1KXQE 3HZMB 1FVEB 3EO9H 4PRAB 3MO1A 4RBPH 1DQMH 2V5YA 5ID0A 5DVNA 1ETZB 4YBQD 5BJTA 2QR0A 2VL5B 4JJ5A 2X4TB 3KR3H 2BERA 5DQDH 5FECB 4XXDB 2YKLL 1EX0A 1INEL 2AJYH 4XNUH 4NNXB 3TZVA 3PGCA 5BVJB 3CMOL 4I77L 4M7KH 1U8OB 2GK0A 1IGTA 3U4EB 3M45A 4UIMB 3VD5A 2D7PA 1DVFD 2UZIL 4M5YL 3DNKA 4NKDA 5HVWA 3WXWL 1D6EA 1NANH 2VDOL 3ET9F 4P59L 1ORQB 3RZCB 4YNYA 4BQCA 1IGIH 3OR6A 1WC7A 1JK8A 4LHUD 5GRXG 1DQDL 5JOPD 1RUQH 2DQGL 1F11B 4X99B 4QF1B 4WCYH 2H32B 4NJAH 4EUPG 3TPKA 1W2KT 4NQDB 4BZ1H 2R23B 3TBSB 5ICXA 1AR1D 3F7VB 1EFQA 1IEAA 1MHPH 1ZA6B 2VLMD 3JWOC 2ZUXA 5CEYB 3BEVA 2FD6H 4P2QE 5GZOC 1YN6B 4YLQT 5LJYH 3L3OB 4KTEL 5GISL 2R2BB 3JV5A 5JOEA 1NCTA 5AG9A 4P23C 1D5IH 2RFXB 3C5SA 3C9NB 4UU9A 3NH7L 1HH9A 4XNMA 4C58B 4Y89A 3V4UH 1UH2A 3O6LL 4K07A 1EEYA 2Z8SA 5D6CB 2AJ3A 1KB9J 2P8MA 4IRZH 3DURA 1DBJL 4D0DB 1KG0B 3WO4B 1FJ1A 4WI3A 3QQ4B 4HBCH 5DA0B 3TIEA 4GQ9H 1HE7A 4OB5H 4XI5C 3KPRB 5L2KD 2CK0H 4NRZB 5TPWL 1NLDL 2GYSA 4TSAL 1H3PH 3EO9L 3VXSE 1HK6A 2V2TA 1SJEA 4JPKH 5IESH 3MRDB 1RU9H 2A38A 1JP5A 5L0QC 3SQBA 4GBXC 2AEQL 1QZ1A 2IBBA 1G7JA 1OTTC 2ATKB 3BQUC 3FHQA 3IS1X 5EZOL 2X6MA 1CGTA 4EI6A 3ZT5A 4M62L 3D2UD 3GKWL 5L2KB 1C08A 2BHUA 3CLFL 3QXAB 4WHYG 5LCVH 4ZSOA 4P48A 3B2VL 4R2GB 1Z3GL 2P8LA 2H32A 1CDIA 5IHLB 3GSVA 5ACZA 5IVZB 1ACZA 4CU7A 2ERJB 3MRJA 1G0DA 5K59F 4JB9L 4P5MA 1JWUB 3BW9A 1KXVC 1S7TA 4ODVH 2AV7B 4G42B 2Y23A 1B0RA 2A2QT 4X4YB 1NGPH 4GG6A 1VENA 2FLRT 2VXVH 1X5IA 3MV8D 1G6RB 2UYLB 3OZ9L 3W9DA 1FZKB 4RWHA 4YIQB 1LE9A 4N9OB 1NJ9B 3PNWA 1F3RB 1U42A 4ZTPH 2VDQH 3R0MA 5HY9A 3TN0D 1EFXD 2B1AH 3T8XA 4FTVE 4F58H 2IADB 2VLRB 5H35B 4YHLH 2QKIB 1R5IA 5A16A 5IB5A 3RX7A 3RZCD 4P3WA 4JFEE 3WO4C 3SGEH 4KJQC 1ZLWH 5I1IH 4LCUB 3H42L 4NN5C 1A4KB 4OIIL 4XCNB 4R8WL 3ARFD 4XNXL 4PV9A 5D7JD 5CZKA 1FG9C 3S5LG 3T4YB 5D2NE 3VXRB 4PFEA 1DVFB 2BC4B 3EO0B 2G2RA 4U2ZA 3BPNC 3N1MC 3ZTNL 1I8MB 2NTFA 2YEZA 4YWGL 4KI5C 1RHFA 2OL3L 5HHQB 2P24B 1K6QL 3RWJA 3PIQA 2X70B 1H0DA 4I13B 4MNHB 4LQFL 4PJBA 1JNLL 5DTFB 3VGDA 2XZCH 3VXME 3HR6A 5J12B 5IV2A 1KB5H 5DRZA 5J1AB 4DKDC 3SDDB 3PGFH 2VAAA 4ELMF 1QTYT 2IQ9L 5KANI 3VFMA 4F9LA 1DLHB 3LRHA 4G8IB 3QG7L 4YH6A 3VI4E 3C5ZC 3SOBL 3V5KB 4N8VA 4JREC 3SKUD 5TE4L 3O0RL 4E42A 1MY7A 1U3HD 3CXHK 3JSSA 1J10A 3B83A 2DF3A 4LRNL 3G6JB 3BJ91 3WNNA 1JHKH 4CJ0A 3RWEA 5C0AE 4G8EB 4BM7A 1GZPB 4WEMB 3WN5B 3D0VA 5L9DL 3GMNA 4HJ0C 3IJHA 3EAKA 4H25A 4AK1A 1A2YA 1J87A 5C0BE 5EWIL 2Q7YB 5EU7E 3TVMD 1GGYA 1TZGH 1PG7H 4L8CA 1MRFH 3H9SB 1G9NC 4OF5A 1AR1C 5D1QC 4OLYL 3ULUL 1Q94A 4XP5H 4J3TA 1FN4A 4UQ3A 1I4FB 5E94B 1EEQA 1M05A 5IROC 3DSFH 1EK3A 2HVKB 4YAQA 1PSKL 1AH1A 3CZFB 3NN8B 4RFOL 3V7AE 4Z7VB 5HGGS 1DDHA 3CLFH 4NPYB 1T0MB 3VCLB 2A6KB 3MA7B 5K9QI 1MJJB 3BZEB 4HUVB 2VH5L 3NACH 3VFSB 2IAMD 3CSYB 4HS3A 2H8PA 2YS4A 1DBKH 5JHDA 4YUEH 3RGVC 3U30B 4KXZI 1JGLH 3QNYA 4YHMH 1NLBH 4PRDA 3EGSB 1S7XB 2D7QA 4PP2A 3QWOA 1WCQA 1NMAH 2D31B 1Z9MA 5IB3B 1GOFA 2Y7QA 1MQKH 4JM2D 3PGDA 5ABDE 4GMSL 4DKFH 1GIGH 5H94A 4I9WE 1YEGL 5ITFB 1CS6A 2P5ED 5FA4B 1PX3A 1KB5L 3CFEB 3F58L 3QXVA 3WFCL 3TPUA 3DURB 1TNNA 4OFDA 3J7HA 3LS4L 3VGGA 1RK1B 1FDLL 5TH2B 4GKSA 1S9WB 3O8XB 4DTGL 1C7TA 7FABH 3FB7B 4L3CA 5EUOF 1RZGA 1FNHA 2W0PA 4URTB 5MENA 1BD2D 5EUOB 1IVLA 1FFNB 4MXQC 2AEPL 4U6XB 2EH7H 1W8NA 4GQ9L 3P40A 5EZIH 4XVSL 4PRHE 3EOYG 3I2CH 4XNXH 1O7SA 3ZKNC 1MAML 4MXVF 4KQ4H 5MEQA 1CWVA 3BO8B 4H0GA 4MMZC 1BD2B 4LSVL 3TBYA 3WLBA 3VRIB 3KXFD 4KGLA 2EDLA 2WIIA 2F8VA 5FOBB 3QI9D 4Y1AA 3QFJD 3SDYH 4K8RC 1MRCH 2QSTA 3T0VA 5FM5O 3VWJD 3T77B 2EYRA 3IFLH 2ESVA 2XKUA 3K7UA 5A43C 4LLQA 5JUEH 3H9ZA 1DEDA 4IRSB 2PF6A 4UAOC 5IEHB 3S88L 1AO7A 3L7FA 1IGYB 4N0YL 5C3TA 4R4BB 1MVUA 1HNFA 2JCCA 5BMFL 1F4XH 1T3FB 4YPJA 4NRXA 5B8CA 2X4PB 3U2SA 4ETQA 3HC4L 3UJIH 5BS0D 4PJFF 3RAJH 2NYYC 1IJ9A 3D69B 4MXWH 1S3KL 2XOTA 3WSQL 4X7TB 4X6DA 3AREA 3MRCB 2IAMB 2E8YA 3BEWA 5D7KD 2ILLA 5CD3A 1NCCL 3QUZB 2ADGA 5I9QC 3U1SL 4GBXA 1CFBA 4HIXL 2Q8BH 5I1LB 3UBXG 3LRSB 3B4NA 3SDXA 4HLJA 4JZOA 2XPGA 1P2CA 3JWDH 4M1DL 4NQCB 4X5WB 3FQNA 1YN6A 2XV6B 3DYPA 4JLRB 5EDXA 2V5RA 1UCBH 2MKLC 4MQSB 3CPLA 4ODWA 1NCDH 3ZMRA 5T3XD 3QCVL 4KROB 5C07E 3G5XA 3BT2L 3GMPA 2FD6L 1QFPA 1LP9E 3PWVB 2XTJC 4NHUB 1AY1L 3RRQA 5IGXH 3VWKD 4PJHE 5GIRB 2NY0C 3IS0X 3LIZH 3SJVD 1L7IL 1QSZA 1MREH 3ILQC 4MB5A 3DXAE 3PHSA 1DR9A 2IANE 2DKSA 3DVGA 3FQWB 3OAYH 4BELD 5C07A 3ARUA 4LU5L 3STLA 2R2CA 5HDOA 1QVOA 4LVHC 5EO9A 2DMBA 4PJ9D 4LSSL 5A2IH 3TBWB 5IM7A 3TT3H 1JF6A 5EC2B 1YJDL 5FECA 2E6PA 2AJUH 3VFRB 2R15A 2HKHH 3KYNB 5F96L 2CIIA 3LKPA 1QSFD 1IL1A 5DJ6A 2CMRL 5SX5H 1MHPL 3EOBB 3N85L 4XT1C 3MODH 3MYJA 1A14H 3JUYA 1UVQB 4JDTH 3QQ9D 1OHQA 5F3HA 3P0VL 1JV5B 3QEGL 4OZ4B 4PD4K 1N5AB 2P48B 1JNJA 1A6TA 2I9LB 1MLCB 4MCZB 5DURB 5JR1L 3EYQC 1NBYB 3LH2L 2EZ0C 2B5IB 3FB6B 4LKCB 4IRJB 4HXBH 1FH5L 5JZ7C 1I8LC 4M7LL 4Y5YB 1KTLB 4UTBH 5KSAA 3I75A 4XB7A 4L1HA 4M48H 3EYFB 5T1KB 1H15B 5FYKL 5CBAB 3BSZH 2VWEE 3ARBA 5BVPH 3Q3GA 4H5SA 5DQJB 4LSPL 4ONOA 4MHHG 4NZRH 1AXSA 1KF9B 2VDKH 4ONGH 2DIAA 4JHBA 4HPYL 4MZ2A 1VFUA 2NY4B 3NCJH 2AABH 5CJBA 3BGMB 3DUSA 3VXTA 4F9PC 1EJOH 1FG2A 3F12A 2JCCB 2VXVL 3WD5H 2XFXA 4HT1H 3ZKMC 1BGXL 4U1GC 3SDXE 2W0LA 3GSUA 3QUZC 1WLHA 1FYHB 4WFFE 2Y72A 1C5DB 2R56L 4X9BA 5HYFA 3DYMA 3OF6A 5EIIB 4CVWA 4QCIB 2HT4D 3QUXA 2A6JA 3PXHA 3VE0A 5AWNH 3QUXB 2J4WH 2OBGA 1YPZA 4R90L 3RGHA 4C59B 2BDNH 1CQYA 1Q9KA 2A9MH 2QEJA 4LCCB 1G7QA 2IBZY 4MA7H 3L5JA 2HTLC 3UYRH 2GTWB 1BBJA 4ORGB 5BV7C 3MRDA 5DZOA 1Y0LA 2EKSB 4Z0BH 2JB6B 5C9JA 4P3DB 3TA3C 4G5ZL 3BKMH 4OTXH 3CFJA 4K23L 3BMWA 1BJ1H 3QA3A 1OAQH 4IS6B 3KPRA 2Y07L 2UVEA 3RGVA 4MAUL 4KVNL 5E8EA 1I8IA 3U0TB 4F37K 4WEBL 4NZUH 2FZ3B 5D4QA 1QFWI 1PZUB 3ARDA 1CE1L 3O11A 3QDHA 4PJCF 3V4VL 5GGVY 5FXCH 5FUOL 1U8KA 2VZOA 1IEBA 2OL3A 3S9DB 4M8VA 4XPAH 1KJ2A 35C8L 4X0KA 4DAGH 3O3BA 5KVEH 1AQKL 1FORL 1UWGH 3O0RH 3MCLH 4ZXBA 3ZYOA 1WK0A 4KK9C 5GGTL 1QP1A 3MZTA 5EOQH 4LRIA 3RNQA 5EZOH 1P1ZB 1U8NB 1JGDA 2JCCE 4CVZB 1IGMH 1CQKA 4NBZB 4GRMA 4M6OH 4NO3B 2W0FA 4NO5A 1CLOL 2FO4B 4NZRL 1NH6A 2CRIA 3MFFA 5FF6A 3F5WB 1J5OH 1MJJA 2YN5A 5C2BL 4P2RE 4OKVB 4XHJD 4NQDD 1TVBA 1NFIA 2YA1A 3DUSB 4UNUA 2CLZA 2YC1B 1EHNA 3GSXB 4I8DA 4U7KA 5KG9B 3UZVB 1U95B 5CKAA 3VU2A 3HZVB 2A73A 1WBYB 1XR8A 5CBAA 4OF8A 3SGDH 2OK0L 2E5EA 2XN9D 5T3ZL 1MCOL 3V5HA 1HILB 3QHFH 4F9LC 1FZJA 5I1EL 5DLMH 1CIUA 3GFUA 2BNUA 2IQAA 4G3YL 4ODTH 4Y2DD 4U7MA 4M7LH 3TCLA 3B5GA 1KTRL 4WI5A 3RIAK 3TJHD 5FM4A 1CE6A 4BSWB 3PGCB 5BVJA 5CILL 1NBYA 4G9FD 2XXMB 2EC9T 2R0ZL 3U7AA 1Y6NR 2VR4A 1BHGA 3BXNA 4ONHB 4U3XA 3S34L 1JPFB 2YD2A 4HJGB 4I48A 4ZG1A 4KRMB 1E6JL 2QSVA 3QO1B 4U49A 3D39E 3WFDL 4F37F 4I3GA 1NFDE 5D2LB 1AQDA 1JYXA 1AXSB 4KU1A 4F2MB 3RPIB 2PW2B 1MCWM 1UYWL 5BRZD 4WJ5A 1FNGA 1WFNA 5FYKD 1PG7W 1D5BB 3LCYA 3IVKA 4XP1L 1AKJD 3DROB 5CIPA 3QUYD 4LVOC 3HNTH 1DQQB 4KK5C 3MRGB 1FDLH 3U4EA 1AI1L 5L6YL 2Q76B 3RP1A 2EEDA 3SBWC 4FQ1L 1MNUL 1SY6H 3NZHL 1FCCA 5KZCD 3MOQA 2R4RH 3MV7D 3NACL 5ID1B 4ELMB 2WUCH 1S78C 4QRPA 5J12C 4LSSH 2QQNH 4NQCD 1U92B 3EYVA 4G8GB 4JE4B 4JPWH 4FQXB 2ZSVA 2BRRH 2DWDA 3GMNB 4G80A 2CIIB 4FQCL 3SE9L 2WBJA 4XNZC 5J3HC 1NCWH 5HTSA 1H3GA 5IBUG 1JPSH 3GHEH 4F7PA 4IM8A 3D39A 3QWRA 2AXGA 3GNML 1KJMA 2CIKA 4HS8L 1C12A 1IC1A 4XMLH 3QUZD 3T0EC 4Y5VA 4R4FL 3WUWB 3GBML 1NL0L 1WQVT 3QPQD 3BPCB 3UTPE 3QI9C 4XVTH 1N59B 4P2OD 5C8JB 1FGVL 3DX8A 3LH2H 2XWJA 2VR9A 4DK3A 1IBGL 4O51A 4ZAKC 3TP4A 1ZHKA 3MBEA 3HNSH 5F21B 3QJFB 4QYOA 1FCGA 3SDCB 4KZEH 4GKZA 3FONB 2XWBA 4JFDE 4WU5B 4HX1B 4LLMB 3T0EE 1JHKL 3EYSH 5DSCA 4DOHB 4Y8DC 1SYSA 3MV7E 4O4YH 1NFIB 4B53A 1P7HL 1NFDA 3GJFH 3MNZA 3X3FH 4XCCL 2RR3A 4IJ3B 1E6JH 4TPRL 4AEIH 5DUMH 4JKLA 2QQKH 3D18A 2E7BA 4JM2F 1WBXB 2EDXA 4GXUM 3WE6A 3LKRB 4ALAH 1TCMA 4GQPH 2DQEH 2YD5A 3QDMD 2W65B 2JELH 4NO0A 5KN5A 4DFIA 3QHTC 4HC1L 3EO1A 4RGNE 3CX5J 5EN2B 4EN3A 5I8OH 1IM9A 4XRCA 4EDWL 3MRLB 4Q9BA 4JFEA 3E6HA 3BKCH 2Y7QB 2CRMA 3K1DA 2B1HH 2ATPB 4OLZL 1MFAL 4X9HA 3H7BB 3ARBC 5FAAA 4NRZA 3VD9A 1R5VB 3PWUB 4QHNA 4BH7B 4X5XA 4UOJA 4JZJB 1PVHA 1YDPA 4D0CB 3QJHB 3RFZC 1EHAA 4ZFOB 1A02N 1WTLA 4R7NA 5L88L 3AREC 4E41B 5SWQB 3W11C 3O6FD 1S8DB 2DQUL 3Q0HA 1I9IL 4B41A 4M1GH 3CFJB 1IGFL 4OZIE 1MQKL 4PG9A 32C2A 2Q6WA 1AP2A 4M1CC 4TSCH 4CU8A 5B38G 2VWEC 1KYOK 2CJUL 1FE8L 3THMH 1XF2B 4N68A 4IOIB 4Z7UB 3K80A 4Z7OF 2CLVB 3NZ8B 1CE1H 1CICA 2F53E 4JREB 2HP4A 3GJEB 2L7JA 1N0LA 6CGTA 2AQ3A 3F7QA 3RNQB 4X7EC 3MLRH 4S1QL 4EEEA 4U7SA 1Y18A 5HYQB 2F54E 3VRIA 5E8DL 2FEEL 4R26L 3G08A 3DVIA 4MA1C 1UXWA 1LO2L 4G80B 4PUBH 5GS2H 1IKNC 4Y16C 4YHOL 2IMNA 1JGEB 3JTSB 2B7DT 2XG4A 4Q6YA 1AGFB 1MREL 1VGKA 4NJ9L 4H5SB 3GSWB 4RX4D 5HHMB 3QA3B 4GUPB 3ZHLA 3H9SD 5E5UB 1QR1A 4TULH 2OZ4H 4L4TB 3VXSA 1QO3A 2DDQH 2XT1B 1MCEA 1K4CB 4PYGA 1CGSH 3K4ZA 3MRRA 2MHAA 5EBWA 2BMKA 4LCCC 5FDWB 4GRWF 1WIUA 1RK0B 3OGCA 4PJFE 1FNLA 1QEWA 3MRLA 3SDAB 3UPAA 4XNQA 3EDFA 3UTOA 2X42A 1JZ8A 3DXAA 5ID0B 2G5RA 3GBLA 1LILA 1RV6X 3EO1B 4O2EA 3C5SB 2R2HB 1E0OB 3HNSL 1I1AC 4NNPH 5AAWA 1AKJB 3DETC 1KLUA 2XXCB 2G60L 3DTXA 1U3HB 4A6YA 1FO0A 5J6HB 5GRYA 5T5FL 3T65B 3IF1A 3LKRA 1NDMA 1IL1B 1MCLA 3QIUA 5D2LE 5CMAB 5L88H 4QXGH 2BZDA 5D8JL 4JHAH 1YEIH 4BFIB 5CD5D 2XACC 2XNAB 2AGJH 1DTUA 5C0DB 4I0PC 4WW2B 5C0IA 1IGJA 1RZIA 4G6KH 2YXMA 2BNRE 5HGHA 5KSVA 2UVFA 5JA9A 5HYJE 4WFEE 1DL7L 1FNEB 5D7JB 3GRWA 5GSRA 4M1DH 1YMMA 3B43A 2VDKL 4ONGL 4PJ8D 5ISZE 3MCKB 3B2UC 2HJLA 4YHLL 2F54A 2J88L 4HEPG 4WI8A 4M93B 4H25B 5F7FA 4M02A 1J0ZA 5HJ3B 4X6DE 1JF1A 5FHAH 4FXKA 1UXWB 2X4TA 4MJIB 2DQFB 3S36H 3KPQB 5CP7A 3KPOB 2MQCA 3QDJA 2NYYD 5CMAA 4R8WH 5CUSH 2BVOB 3GO1H 1MELA 4XVUD 1CGXA 5SV4A 4GMSH 3DX7B 1AFVH 2J6EH 3SPVB 3QUXC 4OZIA 4LLDA 2Y6SD 1KC5H 2J3SA 5CIPH 1RY7B 1FE8H 1T0NA 3OGCB 2FX8L 4NUGH 1QSED 4D3CH 3PWLB 3IJYA 5JMRA 1GGTA 1HHGA 2ESVE 1FVCA 1LD9A 5EU6D 2OP4L 1DQQA 1RK0A 7FABL 4P2CG 1FZJB 1X4YA 3SBWA 1SJEB 3W9DB 4HKBB 4YDLC 2COQA 4PV8A 3LKQA 3ILPB 4R2GD 2A73B 3HPLA 4ONFL 2PTTA 4JRXB 2W60B 2Z8VC 3U9PH 1YN7B 4JG0H 1WIOA 3UTTB 4K94C 2D4FA 3DOSA 3D3VB 5E8OA 1F90L 3UTSD 3HRPA 2A9NL 5HPMA 4GMTL 1WAAF 3WEXA 1JNHB 1VACB 2HJFB 3OKMB 1RZ7L 4QHKI 2H3NA 5F7HA 2UZYB 1E28A 4ZSOB 3CFKB 3TM6A 4XZUB 4F7TB 4LSRL 4YDIH 5FUZL 2AKRA 1ZT1B 2X4RA 2ZSWA 3OHXA 5AZEL 4ZXBC 3VW3L 3KYOA 3IDXH 4M7LT 1KLUB 4P57B 1F4WL 2EDNA 1KGCD 4PRID 4F57H 4DGVH 5DUBA 3LD8B 2Q8AL 5DMIL 4ZNEE 4PJCB 1ONQB 5I71B 3LHPL 5C92A 2AQ1A 1QBAA 2MJWA 5IW6B 3GUTA 4MXWL 1IM9D 1T1YB 4JRXE 4XTRC 2E7MA 4GAGL 4HWBL 4Z0BL 4UV7H 1DBKL 1INDH 3M17A 5D72H 1FYTE 4WW1B 2DQCL 1NLBL 4RISL 4FABH 3S7GA 1C7SA 4HZAA 4NNYB 5JNYB 1OTUD 2CXGA 4YZFE 4O2CB 2F74B 5F88A 4ZFOA 1I1AA 1GAFH 4XWGH 4ZTOH 3CFEA 3G5ZA 5F89B 3LB6D 3PXJA 1WZLA 2XTLA 3H7LA 4RGMB 1A6UH 4KAQL 3V52L 5DJ8B 2CIKB 5SWSA 3ARDD 1VHPA 1XGPA 1FAIH 1EO7A 3O3BB 3VA2C 4X7DC 4AEHL 4DK6A 1OPGH 1YNLH 2KDGA 3VXOA 3IJSA 1DJSA 1FL5A 3CXDH 5GGSA 5FYJL 1YYLH 3IDIB 5DFWH 1Q9WA 1R3HA 4S1QH 4P59H 1LE5B 2V2TB 5IKCB 1MHEB 1VB9A 2E7LC 1T5WB 4UILL 5HHXL 2DJUA 4ONFH 3HLAA 4Y1AB 3SO3B 1WBZA 3MGOA 4JGMA 5SWZA 4E0RA 4JO2L 4MXQD 1TCRB 4NQSA 4Z9KB 3V95A 2Z31C 3HPLB 1MAMH 2F53A 5HJ3A 3ZKXB 1JFQH 1QSFB 3RUGB 4EBQH 3I50L 1A9BB 1FNFA 3V8OA 3VCLA 4TUOA 5E9DA 5K9KA 4RZCB 4YDKH 3ZDZF 3B6SB 3MROA 2HT4C 3WFZA 3ALXA 2NLJA 3I6LD 3LDBB 3LKNB 3H3PH 4KJYA 4MB4A 4IJ3C 5GS0L 1TQCC 4FXGA 2Z93A 3EDDA 5I75C 4PGEA 4X9IA 2P1YA 1MHHA 2V7NB 2PW1A 2VL5A 4I18A 3GIZH 1IM3A 5IROA 4HUUA 3OKMA 4L9LA 5HDQL 3RAJL 3UTSB 1VA9A 3BN9D 4YHKH 1XR9B 5TFSL 3UTTD 3AS0A 5CHNA 1BQUA 3SCMB 4KTDH 1CE6B 4GRLD 4LSVH 1EXUA 1XGQB 1ZTXH 2AXFB 3ZHDA 3KLAB 4HFUL 3VGFA 2PR4L 4MS8C 3DHMA 2QQLL 2XPGB 3V5KA 2VC2L 3INUL 3MUGB 3BFOA 4FMKA 3L3DA 4WIQA 4I1NB 4XCFH 3B6SA 3MROB 3DRQB 4YDLB 1QSEA 1EH9A 1NDGB 5KSUB 4ZAKA 1QSEB 3D39D 1OY3B 5M7QA 3Q6FB 3MRGA 1FFOB 1JYVA 5I71C 5J9PA 3LEXB 4WUKL 5E2TH 3MLXH 3UAJC 2XKNA 1EBAA 2F58L 2JJWA 5CEZD 1CDUA 4GG6E 3U6RB 1GGCL 2ZCHL 1QLFA 3S36X 4UILH 4TVPH 4K3EH 4Y8AA 3LEYH 5DYOB 4RMQA 3QIUC 5FM5M 1RZJL 3TCXA 4OM0L 3ALWA 3NIDF 3QO0A 2WWMD 1S5HA 1YEEH 5BS0B 3CUPB 4DGYH 2ID5A 1WZKA 2ZSVB 4UINH 1UB6B 4FQCH 4EN3C 5I8CB 5FYJE 2Q8BL 1YEHH 2NY3C 4PJ8B 4RRPA 4Q2ZA 1KN4L 3VDAA 5L6YH 3S4SA 3K2MC 4YHZL 1KCRH 4JY5H 1GSMA 4KDWA 2H26B 5DEZA 2PTUA 4Y4HB 3BUTA 2VITB 1KBGH 5FV2A 2WLZA 1FFPB 3I3EA 4LNRB 4YBHA 3RVWC 3WLBB 4YHOH 3QULB 3O6LH 3PWPB 3QI9B 1CD9B 5TE7H 3EYOB 3MRJB 3AM8A 2DI7A 2BRQA 5IK3B 5F44A 3MRBB 2WV3A 5CSBA 2P5EA 4IEFB 1DVFA 2BC4A 2OR9H 1PLGH 4GAJH 3QQ9C 4OZGB 3VDCA 2Y25A 1UEMA 5CZVH 3MOBH 2OYPA 1RK1A 3P0YL 4S11A 3LAFA 2NY2B 1J12A 4NRXB 4RWYL 1CDJA 4HXAL 5JW4M 4NHCL 1M71A 2OL3B 4OFYD 1LO2H 4EN3B 2EIDA 4PG2C 2R1XA 2XFXB 3O11B 3WN5C 4FN0A 1UQSB 4P2QA 3MA9H 4L4TE 3FN3A 3P73A 3RWIA 5DEGA 2P5WA 4RGMC 5HHNB 5IBLC 3BPLB 1VDGA 4LSUH 4N1CA 5KS9A 4ODHH 1W0WB 5LCVL 1U0QA 5JPMB 4WHCA 1CTNA 4PJXA 3RVVD 1R3LB 2R0WH 3T0DA 4JRXA 4OLXL 2BP3A 1I1YA 2LU7A 5IBTL 4P4KC 3RKDD 3STBA 2C3HA 2BY2A 4F7CA 3CC5A 1IAOA 4XP6H 4E5XA 1MOEA 2MQ3A 5BO1L 3K81A 1TJHH 4LCWB 1MVUB 3MJ7A 4PS4L 5B21A 5T3ZD 1A7QL 1BBJB 4ORGA 5FF6B 4GKSB 3ZE0F 4X6BA 2AEWA 4P4RB 3BDXA 1EEZA 1FFPA 1I1RA 2ADJB 4EUPB 2LTQC 3IETA 1KENH 1T1WB 2D9CA 5BVPL 2BVYA 1ZT1A 2X4RB 1UVQA 3L3GA 3HTLX 1REIA 4MA8H 5CEYA 5DD1H 5HHOD 3SEPA 3TVMB 1BD2A 1T6WA 4K23H 5MP6L 2VABA 3WKMH 2E3VA 3PP3H 4U3CA 4KC3B 2FIKB 2DL9A 5DQDL 4E41D 5FHBH 1KJ3H 4BYHA 5GXBB 1YC8A 5F1SA 4O58H 4JFXA 2OI9B 2EIZA 4FQQB 5EZLA 3W9EA 3MBXL 4KMLB 2N1KA 1VERA 2NY2D 2W60A 3CZJA 4KKBC 1ORQA 1F2XK 1N5YL 5C3LD 2DM7A 3BZEA 1YN7A 1I75A 5AWNL 2WBKA 3RU8H 3TEUA 1YEHL 3TNNA 3ARFC 3CVHA 5FO9B 4AQ1B 5DHXB 3OX8A 5HVGB 2VLLB 2BFVH 1T2JA 4Q0XL 4WTZA 2LE9A 4LSTL 3FO1B 3X13B 4KI5D 5E8PB 2YPKA 2OSLB 3BP4A 1IGML 4J12A 1U3YA 2OLDA 3TT1L 2R2BA 2FL5A 3ROOB 4R2GC 1QSVA 4QCIA 3VXRD 1LO0L 3OKEA 4JDZB 3T65A 4L4VB 3QPXH 5ETUB 3O45B 2ZNXA 3ARFB 2F5AL 5FUCC 2XQBL 3OKLA 2R23A 5GISH 1CFQA 1WZ1H 1DANT 4TVPD 1RUKL 4GLRI 5TDPB 5IFAH 1RJYA 4LLYA 1I7UA 4OUUB 1F4YL 5HHPB 2DDQL 3FT2A 3T2OA 1KCSL 2C3GA 4OQTL 4LOUD 2NX5E 3G6AB 4HV8A 1DDHB 4NFBA 3C6LD 3AMLA 1YYML 1A7QH 1F13A 5JW4R 25C8H 2VC2H 1EFXB 1G9MC 5HVHB 5F9JB 2HLFD 2NNAB 1UJ3B 1Q72L 3UTQB 1YMMB 3WDJA 4OD3H 1N59A 1UFUA 2AI0H 5C0CB 4KK8C 4WW2A 3KPNA 1TZIB 5DHYB 1H3PL 5KSVB 3DV4A 4IOFD 4G43B 3WFDH 3D39B 2JCCF 4LSUL 4PRBB 2CKBB 5F72S 4FQXD 4ALAL 1MJ8H 1IC4L 1U8HA 4X8JB 4R4BA 4PJIE 5BJTB 3QDJE 3O8XC 4OLVL 1KN2L 2LAAA 1PYWB 3MO1B 4PTUB 3GMQB 3OAUL 4OLEA 1BWMA 5DJZB 1BZ9A 4OUOA 3B8YA 1QYGH 1XH3B 2ITDA 3OJDA 5KSBF 4OZFB 1S9VA 3VD7A 5KS9F 1I85C 2X4UB 2LV4A 1LNUA 4PP1C 4HIIA 3ARDC 1KJ2B 3BPLC 5JIIA 1JI1A 3OTTA 1BEYH 3HC3H 1NDGA 2JJTA 3TT3L 5DRNB 5HI3D 1QOKA 1AE6H 4NJAL 4QY8A 5EOTA 4DTGH 1S9YA 2FX7L 4M5ZL 4AY0A 3H0TB 3TO4A 5HSFA 1A0QL 1BFOA 1KJ2H 3IT8D 4XP4H 5INCA 3LKSA 3M17B 3QDGD 1NBVL 3HE7B 3VFPA 4K8RL 4JZJC 4KI1A 1GPOL 1FZOB 4YDKL 1QSFE 4PGJA 4HWNA 4M8QB 1CU4H 5FGCB 3OXRB 1HXMA 1NL0H 1AO7B 1BQHB 1BQLL 2HFGL 5EA0H 1IC7H 5E5MB 2ARJA 4JFQB 3K8MA 4WU7A 1BPVA 3L5XH 3L6FA 2E27L 2XN9B 3CCHA 1FH5H 4Y1AD 1S7SA 3GMMB 1WV7T 3HZKA 4ZUVA 4P2OA 3QIWA 1V05A 1F6FB 1Y6KR 2ZSWB 3BRDA 3SCMC 4KKAD 1IEAB 3H2WA 3TF7C 5MENE 1OQOA 1MIEL 4D9QD 1ZSDA 3KDMA 3OPZL 4FFYL 4NJ9H 4CW1B 2VSDA 3MV9B 1FNSH 2ICEA 4HFUH 1A14L 3UJIL 2F9BT 1RUAL 4UT7H 5CJXC 4YAQB 5K33A 1VGEL 2IPTH 2G75A 4GXVL 1ZA3A 4NQEA 2W0FB 3TPUB 4YGVA 4PGDB 3QB7C 4XVTL 5ERWB 1IFHH 3H9SA 3DARA 1OSZA 1MCBA 4XC3H 1W72B 1KIQB 1IAKB 2AJVH 3I75B 4YHIA 5E6IB 5I18H 2PXYD 1T3FA 2E6QA 3KXFA 4POUB 5IW1A 1LEKB 4HULB 3P30H 3ARWA 4GAYB 4MCZA 3FN0L 3WN5A 4TVPL 1M71B 4PP2B 1SQ2N 3CFDB 2FJFB 1YNKH 4PJ5D 3QDGB 1CXFA 3NPSC 4PRDB 3PWJA 4HH9A 2AGJL 2DQUH 5ICXB 3ZDXF 5HYIA 1HHIA 4J3SA 1A0QH 4FQHA 4LIQH 4TUKL 1U3HC 2VQTA 3MNZB 3P77A 2W9LA 2A6IA 4U0RC 1T83C 2BY1A 4MXVE 1U8LB 2WWMC 2VKXA 4WU5A 1KELH 1MCPL 4I5BA 3U36A 1FVDA 5I1DA 1T1ZB 1CF8L 1ZT4B 1KTLA 3I6GB 3U7YH 5KSAB 2FECI 3P2TA 3FQUA 4F7EB 5MENB 4XMPH 4JGUA 4TVSa 1FN4B 4ZPVB 4XNMB 3BIBX 4H8WL 4JKKA 5GZND 3SDCC 2I24N 4KPHL 1JJUA 2DJSA 3O8XA 2Y1VA 5FYJH 4PY7A 3I6KA 5HDBE 3MJGX 5JDJA 5DDHA 4AENA 2HG5B 3BPCA 4HPOL 3OL2A 3U82B 2PW2A 3BQUD 1QQDB 1D5XB 1VFBA 2A6JB 4LHQB 3VE0B 3KYOB 3HC3L 2C4FU 5EIIA 4OQ1A 4Y19D 2AKRB 4MQTB 3OQ3B 1ZEAH 1PLGL 5C0DA 2NTSP 3O6ML 5DZLA 3DRTA 4W4OA 1JPST 4CN6A 2XRAL 5I8EB 3TO2A 1YEDB 2NY4D 1QLRA 3Q2CA 4MJ5A 3ZTNH 5IR1A 4IIQB 1CLCA 4ZYKB 3EZJB 3O2DL 5L8JB 3BP6B 5ID1A 5H37G 5ICZA 4HZLB 4QRPB 4PLJC 4OBRA 3BVNA 2IH3B 3KHOA 5MERA 3VFMB 4Z5RB 4RMSA 5JXEC 4DZBA 2Q87A 1FSKB 5DURD 1JZ4A 4GW1A 1HINH 3FOMB 2MOVA 1BFVL 1GH7A 1S7VB 3OJMB 1DQLL 4K8RD 2X4OB 1VPOH 3UYPA 2ADGB 2KKQA 2P24A 4PV9B 1PJ9A 1KNOB 3UO1H 3VXRA 1C8PA 4L8CB 2LU4A 4KHXL 4WNQB 3UROR 4K3DL 2DQHH 1NQBA 1MEXH 5TQ0H 2MTPA 3F7PC 3OKDA 3DPBA 1S7WB 1D5MB 3OKEB 4K3EL 1TLKA 4KFZC 1WGOA 5T1MB 2A6DB 4HJGA 4OV6F 2DL2A 1HQ4A 2JK5B 2PYED 3VXUD 2V9RA 3KPPB 2OXHA 3KYMA 5FA3B 2HA1A 5IM7B 5CGMA 2O93L 3SGKC 1IFHL 3G6JA 5LWYH 1ZLWK 1DZBA 4LMQI 3GSNL 4KK6C 5DUPH 5JLZB 3HZVA 2BDNL 1U95A 1QBLH 5DWUH 4I3RH 2CO6B 3M8OL 4HUMB 3IFNL 5JHLL 4B7LA 2G5BA 2DKUA 3KS0J 3QIBC 4FRWA 2CLZB 1I7RB 5ANMB 4F33B 3O6MH 1GGIL 4ZTOL 1NLDH 2NTFB 2YEZB 4JHZA 4NKIL 4WTWA 3VXMA 2ZJSH 1FV1A 2P5WD 4KJQD 3GI8H 3MNVB 1A6VH 5GRJL 4LDLB 5HHMD 5ITBL 5DUBB 1OAXH 4Y16A 4TTDC 3N9GL 1YQVL 1QKZH 3HKFA 5ELIA 4U1LA 5FA4A 2R0LH 1QG3A 2WBJD 3P77B 5EU3B 3ESVF 4LSQH 1L0XA 1UC6A 5F7DA 1E4WH 1G7JB 4JFQA 2FGWH 3L5HA 2HFEB 4NQVA 1LQSR 3T2NL 3CH8A 3ZE1F 5E99L 3NIFF 1HXYB 5DHVH 1K85A 1RULH 1AP2B 4KKLC 3WJJC 2CLRB 3S36L 1IAIM 1T7VA 3ELAT 2WP3T 1WISA 5E7FA 1F2QA 1S7QB 4U6XA 3VFWA 3FFCB 1X5LA 1LMKA 3QG6B 4Y5XB 3MXWH 1KIPA 5HGBB 4OF3A 5EB9A 3BGAA 2BRRL 3UJTL 3IRZA 1R3LA 4PJAB 3BDYH 1CN4A 1V3LA 2NQCA 4LPTA 3SKOB 1GXEA 2DQJL 4PJAF 4U1JA 4KQ3L 1N7MH 1OM3L 4FS0A 1G7IA 1PQZB 4TRPL 2P5WB 4OFIA 1B4RA 4Y5YA 4EN3D 2YPLA 2PCPB 4QRQA 1ZHBB 5ITFA 2GCYB 3O6FB 1U8OA 5KTEL 4YXKL 1Y0LB 3IYLW 5MHSD 3GUTB 3OKNA 3J8F7 4K94H 4HW6A 1RUML 1D6VL 4UAOB 2CXKA 4R4NC 3MQIA 4S1SH 4Y4KA 1JV5A 4I0CC 4O2FA 1MFAH 1Q9LA 3WDIA 5ISZB 3DX7A 1C12B 2DQTL 1QR4A 2VLJE 4DN4L 4MZ3A 5E2WH 3A6BH 2R0KH 5EC1A 4UV7L 1RMFL 1V3KA 1V7NH 1QHPA 3BO8A 4QOKE 1NAMB 2B4CL 1YNKL 3D0VB 3OG4B 4JVUA 5DD1L 4MQXC 3DV6B 2DQCH 3I85A 1JGVL 1GGIH 1IMHC 2GJJA 5ACMA 3MOAL 5IP4A 1OVZA 4XX1E 4AL8L 3QFJA 5TQ2L 3O8XD 5EZJA 3ZKXC 3G5YA 3HZYA 4X7SL 3O9WA 3L9RB 3BP7B 5CEXA 1YY9C 4I3SH 2VISA 1DLHA 4MA7L 4PJCE 4CN1A 3ZKND 4ZTPL 4XBEH 1IAIL 3G6DH 1JRHH 3S35H 2R4SH 4XP9H 3BPOB 4HWEL 1CK0L 5EOCJ 1H3VA 5M95B 4K3JH 2MCPL 3ULVL 2YRLA 4OZHB 3LEYL 3O3AA 3MUY1 4Y5XA 4GXUN 2WUBH 2EDBA 3T4YA 4PUBL 4O9HH 2VN4A 3ALPA 4C54A 1X5AA 3O45A 1KLGB 4NC2B 4GT7A 4QHUA 2W59A 3GBNH 3E2HC 4L4VA 3MACH 1BQSA 3MXWL 1HXYA 1P4IH 1DLFH 1HHKA 3MUHL 1B2WH 3KJ6L 3WV0A 5DD0L 3LQZB 4PTTA 2X09A 3K0WA 1LEGB 3X14A 5FV1L 1YEKH 1OGTB 1JNLH 2VAAB 4ZDHA 1XH3A 4FXKB 4RSVA 1JF5A 1U3JA 3I3BA 4LLUA 4RA0C 3IFOB 5BRZA 2OCFD 4Y2OA 3RWDB 1ZANL 2F19L 3SO5A 3QEQE 3L5WA 1Z0NA 3EOAB 1Z2KA 5IMMA 4LDEB 4NFCA 5JOFA 5KZCB 2DQIH 3D69A 3GIZL 3NTCH 3TO4C 3UBXA 1QRND 2EDEA 2WSKA 2FHFA 1MAKA 4DJMA 2IBGA 2Q7YA 3G04B 1B4JL 1Q1JH 1W0VA 2NR6C 1A1OB 4M00A 4XXDA 1JHTB 5KSAD 2B4CC 3GM0A 4LEOA 5H8DA 1YY8B 3QBTB 2DLFL 4MWFB 1YEDA 4CJ1A 3G08B 3TVMA 3C6LA 3HRZB 4J4PD 4H20H 3VMOA 1MCHA 5I66B 3F62A 4I2XE 1U93A 5I1JH 1F42A 1FBIH 4OGAD 2GITA 3EJYC 4PRPD 4CVZA 3NFPA 1IRAY 4HK0B 3BWAA 5GGRB 4HC1H 5I8KL 3O3EA 1LE9B 2UWEB 1RJYB 4LLYB 2BVTA 2H32H 1A47A 2YD6A 1BBDH 2V2WB 4FHBD 2E7HA 4UUJB 5DRWA 2YD3A 2ADFH 9CGTA 1YC7A 1A9EA 4PJIF 5IVXF 5J13B 1UGNA 4JM4L 4G6FB 4LKXA 3RJDA 3FO0H 4ELME 1SVCP 1F6AB 2EYTB 3ECBB 5CIPB 5IBTH 4Z95H 3O3AB 1GL4B 4HIEA 2KZ1B 3ZT6A 1F5WA 1TVBB 5KS9E 1FNGB 5CJXA 3IXTB 3TJHC 4WCYL 3RWHB 5JHLH 1NSNH 2IH1A 4BH8A 4XMKH 5ACLA 5ALCH 1UT9A 1B0GA 1DLFL 1R3JA 2X4QB 2XYCA 5CJ8A 2YPLE 5TQ2H 4AZ8A 4ZFFA 1T89C 2CDEB 1N64H 4OGYH 5DI8B 5BXFA 4KDTC 4IMKA 2W1NA 4Z8FH 2DBLL 4OGXH 2RB8A 3L7FB 1KCRL 1UACH 3BH8A 3RIFK 2QSCL 1UADC 5ICZB 4JY6A 1ORSA 4RAVA 2UWEE 1NCAL 1VCAA 2DLGA 3HFML 3LMJH 5HY9B 4XBEL 4RIRA 4YX2H 5IMOB 2H2PD 3RVXD 4LLQB 2ED7A 3K4DA 1NMBH 4H88L 3KVQA 2FZ3A 2J88H 3CVIL 4FQLH 4LASL 4MD0B 2ARWA 3MR9A 4HDIA 5BS0E 3CU7A 2WIIB 5B39G 3ZYIA 2ZPKH 3GSUB 3RJQB 4QTHA 1KPUA 2VERN 3VGAB 4F15C 1P7KB 3AFLA 4L4JA 1OTTD 4L8BA 3EDEA 4OAWA 5FUOH 5L8KB 2ICEB 4PGCB 4RQQA 5EO1B 3O6FA 5D2NB 3PWNB 3VXRE 3QCUH 1A6PA 4LHUA 4X5XB 1PQZA 3REVA 4GO6B 1JGDB 1T4KB 4NT6A 4Z7QF 3WIIH 4D9LH 4EJ1C 5A3ID 2AXGB 5I17A 3GZKA 4WU7B 4MSWA 2J2ZA 5ENWB 3E2HB 4BK4A 2R1WA 1TJIH 4RNRB 5D5ME 3W39A 2DYPD 2JJSC 1I3VA 2NZ9D 4NNPL 4X99A 2YK1L 5FYLE 2GI7A 2YA0A 2HTLD 5CSGA 5C0BA 3VFOB 1VFMA 1T6VN 2R0WL 5IB2B 3CFDA 4L29B 2H8PB 5D1XD 2AP2A 1C16B 1T7ZA 4JRXD 5GGTA 2YSSB 1NSNL 2EXYC 3TA3D 4D0BB 3U1SH 3BPOC 5JDSA 2FBOJ 5F7LB 1YEFH 4OZHE 5FM8A 3QHFL 2PXYA 1SEQH 3MRKB 1QLEH 5EU6B 3S6CA 1A6UL 2KQNA 1INQA 2AI0L 1U58A 1AHWB 2EH8H 5KJRH 4I3RL 1ZA3B 3BKJL 1BBDL 3STZB 1HYSC 4U1KB 4WGWB 5C0CD 4X6FA 2E9WA 2YA2A 1K8IA 1A4KA 2FRGP 1NGXB 4JFPB 3R1GL 1EA9C 4NDMB 3N85H 1MWAB 2H9GB 4N0RA 4MJID 3QO1A 3W2DL 1A2YB 1NAKL 3QHZL 5A16B 3NOIA 1H8SA 3FRUA 5IJVA 5EPMB 1G1CA 4NWTH 2JKXA 2D2OA 1K5NB 3JUZA 3MRHB 1A6WH 4Z7WB 2HFFA 2HJLB 1MWAH 4ZPTA 2DQDH 3STLB 4U05A 5L7XH 4APQA 1T7XA 2Y5TB 4L4VD 1EUTA 5DQJA 3KYKH 3EKCA 4XWOD 2QSCH 4FFVD 4HK3N 4GS7B 1RAMA 4AIZB 1NCAH 2CDFA 1E6OH 3OKDB 4KKCC 3MGTA 4QRRE 5AUMA 1EEUA 1MRDH 2HKHL 4Z7OE 3EDJA 3P0GB 3Q1SH 2I25N 4KMQA 3QIBA 4I2XB 4KV5E 4MYWB 4RFEB 4HBCL 2AEIT 4K8RH 4GG8A 4KRPC 4P5TC 4HBQA 4JO2H 2X4OA 1J86A 1WZ1L 4JKPL 5GS1C 4X9FA 4M6MH 1Z5LB 4HC1A 1UZ8A 5L2KE 1T2QH 5J13C 3CLEH 4DUVA 3UO1L 4XMLL 4ZO9A 2PYFB 2JJVA 1GC1C 2RHEA 2DQHL 3L7EA 1NPUA 5IHZA 1D5ZB 3GM8A 1J0JA 1TZGL 4HKZB 3QG7H 3RKPA 4U3HA 3SDAD 2E9JA 1I9RH 2V7HA 1S9VB 4LSTH 3KPMB 2ED8A 1M6OB 3QNXB 5EORL 3IDJA 4JGJA 5FGBC 4ZO8A 4X5LA 3AUVA 1MQ8A 3O2WL 3DX6B 2HJKB 4ZUTB 1EBPA 4PJGE 2DTMH 2AABL 3P4MA 1T22A 3WFHA 4RFEA 2ZUYA 1IC4H 4Z7WE 1JWUA 3BW9B 1X3DA 3HA0A 4GLRH 4YHKL 1Q0XL 4G42A 4TRPH 4LHUG 1P5VA 4PLKD 4WHYH 1BLNB 1S78D 4NHUA 2J8UA 5FO8B 5HGAA 1QACA 2AAVA 2VXUL 3LZFL 1I3RA 1HKLL 1QBMH 1UB5A 3HUJE 5F9OL 5D7SL 1T03L 3T3MF 3AU1B 5IF0A 1U58B 4L3EA 4XWGL 4FQ2L 1IQWL 1NGWB 5F7NC 3RX5A 5C09A 3VFGH 5HXMA 2PO6D 3FN0H 3EYUH 2FDBP 2ESVB 5AEAA 3BUYB 4U1HB 5IWLC 3MJ9H 1P9MC 2OMNA 5LGHL 3T0ED 1EDQA 2HRPH 4HFWA 2W07A 4UOW0 5DD5H 2YD1A 4Z77B 1WIPA 4LAQL 3MJ7B 5I1AB 3UTTE 5C2BH 1B2WL 3KJ6H 2NY3B 4PJ8C 4P9HL 5C0RL 5T3XE 3DETD 5I0DA 5CSZA 4GAYA 5SWQA 4TQEH 2DLEA 2CJUH 1G7HB 4XH2A 2Z8RA 3KXFB 1G0XA 2H2SD 3BI9X 5DJDA 3LKQB 2GIYA 3TJEL 4NN6B 4QHNB 1O7VA 4A2LA 2BNQB 2EDHA 2CDEA 2XA3A 4LEXH 3SKOA 3QUMB 4J3XA 4YGVB 2EXWC 4YXLL 1M05B 3PABB 4M7ZB 4Q74A 5JORB 1KBGL 4D8PA 1G7QB 4WW2F 2QR0B 4HLZH 5C6TH 4UBDD 1HHJA 3FQXB 3LS5L 1TTUA 4P23B 1J05A 4OKDA 1RHHB 4OFVA 3EOBA 4WO4A 4FA8A 3DJ9A 2P7TB 2XWTA 4MD0A 3RHWK 4WO4B 3D2UA 1GPOH 1ADQL 1F11A 4O02H 2R0KL 1S7RA 4JM2B 3X12B 2FX8H 4NUGL 4MNQA 3GJFK 2B4CH 5ISZA 3IDXL 1NGWA 3RZCA 4M43L 2P4AB 3NA9H 3ROLB 4QT5A 4I0KA 2GSIA 3B9VA 1D6VH 3ARZA 5AAMA 4HS6A 4P5TA 1HINL 3PHOA 4F3FA 2XWJB 2DM2A 1MFBL 1JNHA 3JWNC 1I3RB 2R9HD 4AIXA 3GJFA 5D7JC 5I16B 1XEDA 5IOPA 4TSBL 3UBXI 1T20B 3KNBA 1F90H 4LGRB 5KJRL 4E9LA 4D9RE 5IIEB 2XTJD 1EJ6A 4XHQA 3S3JA 1FC1A 1OP3K 2MCPH 3U0PB 5CSZB 2NY0D 4Y4FD 1NFKA 3QNZA 3IGAA 3QZWB 1ZGLM 3W0WE 1A3RH 4OLXH 2W9DL 4NM4H 1EO5A 3PL6D 1KPRA 4MQ7B 4N5ED 1BECA 4KTYA 2O61A 3GSRA 1BOYA 5TF1H 4JVWA 3ULSB 5FGCE 4CADA 3WUZA 2HN7B 3X14B 2WWKT 4PJ9C 3SDAA 2GITB 3T3PF 4PJEE 5BZDB 2LFGA 1AI1H 4U1MA 3WS3A 3VFVA 1QBLL 3RWGA 3QUYB 5J6GA 1M4KA 1PYWA 4OD2B 3VG9C 2F5BL 2AXJA 1HI6A 1K9TA 1P6FA 1X7QA 2BNRA 1BVZA 4WUUB 1ZS8A 4OIIH 3JV6A 2PKDA 4HGKC 4MA8L 4ZS6C 3BQUA 1TETH 1LK2A 5E95B 1S7VA 3SDDD 4KI5E 2DRUA 5D1QD 1HDMA 1KCVL 4KJWD 3P4NA 4O5LH 4FTVD 5BV7H 5KOMC 5D2LA 3U2SB 2L0DA 5IWLA 2KZWA 4P9HH 5C0RH 1VFAB 2XQBH 1OW0A 5C0GB 5IEKA 5DRWB 4ENEC 1X5HA 4KTEH 1PBYA 4IHOA 1ZVYA 4KQ4L 5JZ7D 4G8EA 5L2JB 1RIUL 4R97B 4KRPB 1S7UA 1AIFA 5JR1H 3DVFA 4KPHH 2FGWL 4X6EB 4EDWH 3WIFA 5GGRY 1M6OA 3QNXA 3GJEA 3UYOD 4KUZH 1NBQA 3RX8A 1CL7L 3HNVL 4W68A 2WANA 1YY8A 1I9RL 2EDRA 4HAGA 4MX7A 4RMRA 3LN4B 4Z76A 4NKOB 1PKOA 3ZTJG 4M4RA 3OR7B 1XCQA 2VLRD 3LV3A 3REWB 1ULVA 2FH8A 3F6IA 1QA9A 5FYKU 4YHYB 3HI1A 5AYUL 2AK1L 5KVMC 5IMLB 4R0LB 5ALBH 4L8SA 2ZUTA 1AGDA 2D03L 4EBQL 4PBVC 2I07A 3BYYA 1LDSA 4AM0A 2XA8H 3EOAA 1I9JL 2F5AH 1MEXL 5E8PA 5INDA 1A3RL 3C5ZB 1A21A 4HCRA 1FGNL 2VDPL 3G9AB 1CCZA 4PJEF 5IBLD 3BH9A 2VL4A 3WKNA 4PRPA 3C6SB 1JPGA 5DJYB 4Z7NF 1HNGA 5CCKL 2EXYD 1IGCH 4RBPK 5BZDA 3WNPA 2W38A 5CJOH 3WIIL 3ZYZA 2X4SB 3BKCL 3N1PC 1BQHG 2EE6A 3A0OA 5F9OH 3AVEA 2J4WL 2Z92A 3CH1B 3GSNH 2C3VB 5DUPL 4V1DA 4APQB 1IM9B 4XRCB 3TYGH 4KRLB 1MAJA 4R9HA 1F6LL 5E2WL 2AXFA 1NCNA 3QG6A 4LFHD 3TFKC 4IRSA 5IEHA 4ZYKA 2JJSA 1P84K 4LLAA 3M8OH 4FFWD 1FL3B 4YX2L 1X9QA 5CWSB 5I1AA 4PRIB 3UDWC 1YEJL 3QXWA 4JFFB 4HUUB 5KVDL 3MLZL 5TQ0L 2X7LB 2C3XA 1IGFH 3ARPA 4H88H 1OSPH 4BFBD 5I73C 1J0YA 3I3DA 1I9IH 5FIEA 4DOHE 1SEQL 2NY5C 1KN2H 1X5XA 3Q6GH 1N6QL 2IPUG 3TIEB 1P4LB 2ADJA 1OAYL 4W4NA 3I02B 5HPOA 3BIAX 3GSVB 5ACZB 2I60L 3UTZA 5EO1A 4QEGA 3B9KB 4WV1B 2HFGH 1XGRA 1Z9OA 3LMJL 3D3VD 5B4MC 4NBYB 3BKYL 3QUXD 2N4IA 4H1LA 3KPRD 4RQQB 4WFGD 3B9KC 3BKML 4OTXL 1SM3H 4JN1H 5ANME 3NAAH 1EVUA 43CAA 3V0WL 5JDSB 4KKCD 1XCQB 4GAFB 1JN6A 1EZVX 3W81A 2QTEA 3PGDB 2O5XH 4LSDA 4IOSD 3ILQD 2F8XC 4MDIA 2VDLH 4MDIB 5GS1B 5J11B 5FB8B 2Z0BA 4P5TD 3L1OH 5E00B 1OM3H 1NBZB 1T04A 4DKEL 1JHLH 5ITBH 3VXOB 2DQJH 1OOAA 5JUEL 1PD6A 3MCLL 2L4OA 3QCUL 3UXFA 5C0EA 3FB8B 4LCWE 1P7QA 4D94A 5HBBA 5SWSB 2VN7A 2ED9A 3PDOB 3VFPB 1KG0A 4UMGA 1R3JB 2X4QA 5T1KA 3NA9L 1WZMA 2MKWA 5I18L 1RJLB 4P3CH 1NCBH 2NY6D 4MNHA 4UNTA 3LB6C 2HVJA 4LRNH 4ZUUB 4LKCA 4MCYB 5GGVL 1NFDF 1TJIL 3UEZA 1DBBH 2Q3ZA 2HMID 4W6WB 4Y19A 4B50A 1AC6A 4JO1L 5IK3A 3KPSD 1B9ZA 3MOBL 2IALB 4JHAL 4JFDB 1MPAL 2ZG2A 4ODSL 2D0GA 4OLWH 4LKXB 1LO5A 3SDDC 1XGYL 1JTPA 1Z0MA 1E4XI 4FOMA 5DJ6B 3IRPX 4JFFA 4PREB 3S35X 4NKMA 4XNUL 4M7JH 4G6JH 1L6ZA 4YXKH 3RWEB 1WT5A 1S7SB 1KJMB 4M7ZC 2D0FA 4RFOH 1OL0A 1OF2A 3KS0H 4MD5A 3V7MA 4YQXH 1W8OA 3TO2B 3Q5YA 5D7JA 2Y9RT 5T3XL 1KEML 1ZGLB 3O4OC 1JHTA 4TUJA 3D85A 3WNMA 4OB5L 5I16A 5DC4B 5IOPB 5F9WB 1JIBA 3VWJC 2ZCLL 4FMFA 3WYRA 5C07D 3MRFB 4K3GA 4YFLF 4JPWL 2CQVA 2PTTB 5E2VH 1I7TA 2FATH 3LKOB 3A67H 2YUVA 3NCMA 2Y36H 3KLHC 4XP4L 2AK4E 4YDVA 1RFDH 4UIKL 5FKPB 3BN9C 3T2QA 4EI5C 4V1DE 1JRHL 2BOCB 3H6JA 3LRSA 3L5XL 1YNTB 5DD5L 1LK3L 1JYWA 4IRZL 1MCSA 2DQIL 1KT2A 1HYSD 3ZL4L 1UG9A 3TNMB 3AS1A 4P2YA 3UTSA 2VDRH 4I48B 4LCYA 1ADQH 5I8EA 1DUZA 4U1SB 3BGFC 1TJGL 3VG0H 1T0PB 2Y06H 3RI5K 4MCYA 1B4JH 1Q0YH 3QXTA 3E3QC 4LIQE 3IDNB 4ODSH 5FYJD 2N7BA 4X6DF 1QQDA 3CVHB 4Y0GA 5FO9A 3WIHA 3ULVC 3C8DA 1K2DB 3OZ9H 4ZOCA 4OGAC 4GW4B 4X98B 4IRSD 4QRUA 1QFUL 4PJGF 1AD9B 1JTTA 5D93C 3B9EA 4M93C 2BXZA 3MFGB 4XGZB 3L3OA 3DV6A 4MNGE 5AD0B 3QFJB 3O9WC 2D4DA 4ODTL 4PLNC 3T77A 3FT2B 4XNYL 3VFNB 3OMZA 3RY5A 3NZ8A 4PTTB 3MJ9L 4WO4C 3ZT7A 4YE4L 3K4AA 1JZ2A 2VLKD 1BM3H 1LE5A 5GS0D 1AGEA 1A7BA 2QQQA 1U8JB 1CT8A 2VXUH 1EEZB 3WL9B 4EXPX 2F8OA 4KK8D 5T1LB 3MRMA 1GAFL 4Y5XC 3HE6D 2Z4QB 4WWKC 5IW1B 1U8MA 1ND0B 1RIVH 3ARGD 3EYUL 4OD3L 4LVNC 1OAYH 3G5ZB 5F89A 4XBGA 5ESAA 4MNQD 5F6IB 4HWUA 4XBGB 3RGVD 4IRJA 5IJKC 4K55A 3X11A 4QWWD 3RVXC 3BDBA 4H26B 3CXDL 1G84A 4I4WA 4FQHB 1G7MB 3QZWG 4P5KA 2X41A 1OT2A 3IB4A 4P0DA 5E0QA 3LPWA 1BOGB 4MAUH 3VD3A 3QQ3A 5I74B 1HSBA 1VKXB 3IFNH 4XC1L 1DFBH 3VMPA 5DMJB 3VJ6B 2X44D 1J18A 3QUYC 4U1IA 2HFEA 2Y06L 4GSDH 1P53A 5HGDB 3OR7A 5CEZL 1WWAX 3EHBD 4X4XB 3UZQA 4HIJA 2DBLH 3L3GB 4OGXL 3CFCL 5E56A 1IT9L 4OZFA 5DT1L 3Q5OA 4LU5H 2YPVH 1CICD 3MMEB 3ULUH 4GRWB 4G8GD 4X98A 4XVJH 3SQOL 2PO6C 2OTUA 1ZHKB 3B9KA 5HHOE 1MIEH 3WO3B 4DCQB 4XPTL 3LS5H 1M7DA 3MNWB 2IMMA 2AV1A 1EV2E 1G6RH 2YMXH 2FYYB 4ZQKA 5C0NC 1DE4A 3O3DB 3MV7B 2BNQA 2D7TH 5KVFH 5E99H 4Z7VF 1MCNA 2OM5A 2D3VA 2J8HA 1IQDA 5T5NG 5D1ZB 3TWCL 1I1YB 1A7RL 4NC1E 1FGNH 2VDPH 4AEFA 3CLEL 4YE4H 1ZT7B 5KANG 2RBLA 1C5CL 4RMWA 1B88A 4XCEA 3K3QA 2OTWA 5GJSL 3H7BA 3RWDA 1BREA 4OIBA 5IW3A 2D7NA 2XN9A 3CCHB 5BRZB 1XGYH 3T4AA 3TA3A 1XIWD 4ZFGH 1RSFA 2J5LC 5E24E 5D1ZC 2HN7A 3VGEA 2GT9B 1WEJH 5IHZB 4GKOA 5I8OL 1MHCA 1G7PB 1ADQA 4TYUA 1WAAE 2XY2A 1DEEA 5TE6H 5KN5B 2O61B 1TVHA 4NDMA 3FKUS 3SY0B 3HRZA 4FZEH 4G9FB 2FIRT 4UDUA 4KUCD 1XCTB 1H0DB 2ZKHL 4Y4FA 3S8WA 1C1EL 1H3TA 4Z7QE 1HCVA 3IDYB 1EAPA 3DV4B 4G9FE 5DSCB 2DBJA 2IFFH 2R29L 5C7XL 5D5MF 5E6IC 4DGYL 3NH7H 1OWRM 3C2AL 3HMWH 1AGCB 1MCOH 3ES6A 3O3UN 2NY1D 3HE7C 3P4MB 5IB5B 1RZKC 4J7RA 3VXMD 2VITA 1JPFA 3OBAA 2OTUB 3ARBD 4UOW1 2ITCB 3L3HA 3F8UB 4PD4J 2WQRA 3MMEA 2Q86B 2WUCL 4N0UA 2HRPL 1JNNL 3JWOH 5C09E 2NY5L 3SKJL 4PJEB 4IRSC 3RQ3A 3TCLB 4XPHH 4QRRB 4GW5B 4YZFF 1FSKC 3MV8B 1LEGA 1T1XB 4QRSB 1JI2A 3R06A 1CK0H 1WCBA 3H3BC 2IPUK 3HUJA 3O6FC 3IXAB 4LEOB 4NBXB 2WZPD 2FEEI 3QEUA 3GO1L 3ETBF 5F3BA 2CKBA 2D7TL 3GMLA 5DMYA 5KVFL 3ULVF 3V79C 2O5ZH 4JQXA 5DO2C 3SJVA 4G7VL 1JPSL 4OCRL 1N6QH 3HCVA 3QRFM 2AEPH 4RGNC 3DTXB 5B38B 3KNBB 1CFSB 4HS8H 5IJKA 5AYUH 5DDHB 1S5IL 5HDLA 3U0WL 3MACL 3MBED 4JFYB 4EXKA 5GS0C 3NBNA 4JJHA 3HI6L 2ENYA 3SDYL 4HUWA 3K1KC 3NIDE 4FNLH 1CFNB 5BCAA 1T1ZA 5BZWA 5DVMA 3NGBC 1U2CA 2EE3A 5EIVA 1T80A 1H9VA 5JIHA 1FBIL 3DI3B 3ULUD 3NAAL 1QBBA 3S3SA 5JOPE 3W5MA 1KPUB 4K7PX 4N90E 4XCCH 4PJXB 5C09D 3TYFA 5EU5A 5J1SC 5HD8D 1LWRA 2XKSA 5TPWH 2ATKA 4AQOA 1T5WA 3QIWD 2D31A 2CKNA 3CD4A 4PLJD 3TYGL 3MRHA 1KLGA 5JHDE 3HC4H 4ZS6D 1EGJL 1NCDL 2HMIC 2DD8L 4L9LB 1S3KH 2P5EE 3WXVH 4UDTA 3C60A 3QSKB 3BRGC 5IIEA 2N7AA 2FX9H 5CLWA 3E6FB 43CAB 1OSZB 1DSFL 4NPYA 2Q8AH 1K8IB 5J8OA 4G3YH 1UZ6F 2AXHA 3HAEA 1EO8L 2B39A 4PBXA 5JNYA 3TBYB 3FMGL 2CUMA 4WV1A 5ERWA 1N6VA 5TDNB 3TBVA 4F7MB 4FQIH 1IARB 1FQ9C 4NCC1 3VRLF 3CFIC 4TUOB 3TZVC 1P4LA 4N90D 1PZ5B 3VXSD 3MV9A 3HCVB 2I27N 2C3WA 1ACYL 4APQC 5T1KD 3QI9A 2APTA 2VQ1A 4PB0L 4G7YL 2A0LD 4IRJD 3OB8A 1Z9LA 3QEQA 4X6CE 3TH2T 5IFHL 3QUML 4NO3A 4U6HA 1FG2B 3F12B 5CWSA 5DJ2B 5I74C 5D7SH 1T03H 4Z7WF 1CF8H 3U7YL 3VDBA 5CFHA 1WITA 2OJEB 3OV6A 5L8LB 3L3HB 4JFHD 1RZJC 3HE6A 4MDJA 1EVTC 1VFOA 4PJAE 1GC1L 3MRPB 2IANB 1U2HA 3BKYH 2FWOA 4OLZH 3V6OE 5BOPA 1TPXB 4OD1H 1ORSB 2H3NB 2P49B 2YN3A 4IMLA 4PB9L 3IDMB 4LF3B 5A2LH 2M2DA 1D5ZA 2YBRB 1QSEE 2FJGB 1OLLA 4M48L 4ZUWA 3O4OB 3QDAA 4PIRF 1ZKAA 4BQBA 4PJ5E 3BH9B 4NWUL 5JHDB 4ZFFB 4UBDC 3DLQR 4J6RL 1NC4D 4CDHA 1ZANH 3PIQB 2ORBH 2DLTA 4NYLA 4PJ9B 4R96A 4WI4A 3LOWA 3FHAA 1FV1B 3GSNA 1OGAD 4HPYH 5SWZE 3WHE1 1RZ8A 4HHAB 3FRPA 12E8H 4LASH 1NFDB 2CMRH 3DHJA 3ZLQC 3TBTA 4P3DA 4TULL 1AGBA 3GHEL 5C0FB 1CFTB 3QUYA 2ZCKH 5J6GB 3S5LA 5CKGA 3MXVH 5EOCH 5C0AA 1QRNA 5E94A 3KPSA 3I9GL 4QKXB 1C5CH 3SJVB 4QNPE 1YZZA 1NUNB 4YXHH 4HCRH 1LP9F 1J8HB 1LNUB 5EUOE 5E9DD 2IH3A 5GRZA 4P2RA 1A4JA 2EE9A 3UMTA 4KROD 5IHUH 4Q2ZB 4XHJC 3V6ZA 3ARED 4JQVC 3C08H 2A77L 4LARL 5E2TL 4K9EL 2B0SH 2LABA 1IAMA 5AYQA 2C7UB 3DRTB 3MRBA 5EWIH 5DFTA 5I0ZA 1ITBB 4LLWA 1TZIA 5DHYA 3INUH 3RNKA 3TLRA 1KNOA 5EIQA 2VUYA 4CAGA 4P9HC 1G0YR 4J8RB 4NQEE 1QUNA 2CUHA 4XMKL 4NWTL 5KBNC 2WK2A 2FATL 1F3JA 3VFUB 4S1RL 5J89A 4RFNC 5I30H 5TGBA 2PTVA 1A6WL 1UWEH 3BZ4A 4Q9CA 4PJ8A 1H3XA 5B3JF 4PBWD 4R90H 2FJHA 1AQKH 1OWWA 1YMHB 2DQTH 5IVXA 1IZJA 3LPGA 2X4UA 4FZ8H 3FB8A 3CFBB 3ZE2F 3A6BL 3D85D 1HHKB 4G6MH 3WFEL 1RJCA 2JF1A 2VYRE 4FXLA 4NWUH 3DO7B 4JO4L 3SKJH 1ERNA 4J3WA 4JFPA 1OTUC 2ORBL 15C8L 2B5IC 1KCVH 1R3HB 4WV1C 1HHJB 4ERSH 4MJ2A 4JCMA 3HC0B 5FCUL 12E8L 1JBJA 1FYTA 5I1GL 1XGTB 2J12B 5J7CC 3W2DH 4GKNA 4U1NB 3VWJB 3SE8L 5F9WC 3L3IB 1DBML 3PNWB 5CZVL 2BK8A 2QADC 5D96C 2ICWJ 3IAGC 5FGSA 2NZIA 4ZUWB 4C56A 5D6CA 4WWID 3BP5B 1SEBB 4G6AC 3LN9A 5DFVD 5JW4N 1BJMA 5F9JA 3O2VH 5D7IB 2H6PA 3IKCA 3FL7A 5EOQL 2FSEB 1CT8B 4RFNB 5IB2A 2PN5A 1OARL 4YC2C 2CUIA 4J6RH 1OGTA 5IVXE 3RI5F 5D7IE 4P46B 2RAMA 2NXYB 3DYOA 1Y18B 2V7NA 5HVHC 4DKEH 4GRMB 2XZAH 4EUPH 5MEQB 1T5XA 4TUKH 1V3MA 1K4DB 1NUGA 2NW2A 5CP3H 4NQDE 1A1NB 4JZOB 3REVB 2O26U 3K8LA 4EQ3A 5FUCE 1QFUH 4PY7B 1TMCB 5TDOB 2ZOKB 1BF8A 2FX9L 5E5MA 2VR5A 4S1RH 4KUZL 3TESA 2YPLB 1XIWC 1OAUH 2NR6D 4YHYC 4LVOB 4JFED 2NX5B 1RVFH 4FQ1H 3U0TA 3KLSA 2GJ6B 4WWKB 4HIHA 4TTDD 1QR1B 2V2XA 4OFYA 3WHXA 1V7MH 5C0EB 5GGUA 3U46B 1ND0A 4FABL 1OTSC 3B5TA 1L9NA 3MLZH 3G5YB 3HZYB 4Q97A 1KIPB 5IB3A 4FQQA 15C8H 5C08D 1TQBB 1TENA 2NY2C 3HHRB 5SX4I 3FFDA 5I1KL 2EDFA 3SE9H 3GHBH 4JRYE 3DO7A 3C60C 2DB8A 4LSRH 5FUZH 4RIRB 3P4OA 1HH9B 2VABB 3ARGA 3O2DH 4JN2B 1IGCL 2HYMA 2GUOA 5IQ7H 4RGOH 3GMRA 2KQMA 4F57L 3TJEH 3HS0A 1X4XA 5EU3A 2CR6A 4P2RD 2A6KA 1L4IA 4Y4KB 1HEZB 5D93B 1WBXA 5DMGD 4IOIA 1CL7I 2V6HA 2ZOLB 3IFPB 5IQ9A 1CDBA 3QIUD 4P46A 1N26A 4G6ML 2IPKB 2SEBB 1BZ7A 5C0AD 1M1SA 3RL1A 4JRWA 5A1AA 3D87B 2UWEF 4QOKD 1MH5B 3BN3B 2ADIB 3QULA 3KPNB 5IW6A 5ANMA 4ODUA 4F33A 4EVNA 2VDLL 2MPAL 1N64L 1T21A 4PJAA 3EYOA 1UM6H 4QOKA 4HD9A 4D0CA 4V2CB 5CS7A 3S4SG 4QHLB 3ILPA 1W0WA 3GSOB 3KWWB 3NCYP 4JKPH 4Z76B 1OF2B 1OQXA 1HI6B 5D1XA 4XP5L 1XT5A 1IGTB 1BIHA 3HE6C 1G1YA 4XAKD 5IMOA 1TQBC 4KVCH 1I3UA 2A1WH 3FB6A 5F70A 5H2BB 1KCUL 1X6LA 2X4NA 1U3ZA 1RIHL 4PJFA 1LP9A 5C0CE 1UB6A 3OB0H 4BFIA 3T09A 3KPPA 2VZTA 3NIGE 2DICA 2WIMA 4DEPB 3NABL 2HAZA 1A1OA 1VFAA 4FQXC 1X5KA 3U7WL 1DQJA 1PKQE 1JPGB 5DJYA 2R1YA 3AC0A 2DJ4A 2E9BA 4NO2A 5F9DC 3P0VH 4MVBD 4JEGB 3BZDA 3TN0B 3PV6B 5GGQH 2R2HA 4L8DA 1FAKT 1MCWW 4JB9H 2FB4H 4PV8B 4NGHL 4GBXD 5FKAB 1EPFA 1SYSB 2ICWA 2VO5A 1JVKA 25C8L 4ZUSA 1FPTH 3HG1B 3NFNB 5EU7C 4IDJH 1L0YA 4KY1L 1WTGT 3FMGH 4HMCA 4QYOB 2FBJH 3OAYK 4LLUB 4AIZA 1A9EB 5FYKH 4XCYB 1I8LA 1MJUL 2FNBA 4PP1D 3MGTB 3W0WD 1ZGLA 3UPRB 5J4MA 3WUWG 2QJDA 4HZLA 4ZD3H 5E03A 1HHHB 1J1XL 3C5JB 5CHNB 4JQVA 3L3JB 3JVGA 2F5BH 2Z31D 2ZUSA 2DD8H 1SJHB 2MQ0A 4I0PD 3T08A 3TZVD 2R1WB 1NC2B 1ZWIA 4MAYC 5JW5B 4YHML 3BAEH 3D2UB 1AO7E 2VIRA 4CUCA 1F97A 3GI9H 1B0RB 1MWAA 1ZHNB 2H9GA 4X4YA 4EVNB 2XZQL 4KJYB 4ORZC 5GJTH 3RDTC 4FXGB 4Z8FL 5FGRA 1MCRA 3HG1E 1CLYH 4HG4K 5GSRB 2JLLA 4OCWH 2HT3C 1UJ3C 5DEFB 1D9KD 1PFCA 4FP8H 4F3FB 4XAWL 4KMTL 4RGOL 3DECA 4WFHD 1FRGL 2CK2A 4DQOH 2ZOLA 1OPGL 1URLA 1YNLL 3QCTL 1IGJB 3HI6H 4ZPVA 4XPHL 2IQ9H 3QXAA 5KSUA 5LGJA 4J3OC 4XPGH 3P9LA 1L6XA 1YA5A 1L0QA 1HH6A 3HS0B 3PDOA 3AREB 1HQRB 3ULSA 1ZSDB 3KDMB 2Y07H 2BVQA 2VLKA 4WJ5B 4LGSB 4OSUH 4G7VH 3PP4H 3LVEA 4WEUD 4AYFA 4M6NL 1UXSB 3DIFB 1M7IA 4ZO6A 4NO0D 1QNZH 1HHIB 4UTAH 4WHTA 5L9DH 1KLFA 1FNSL 2ZUQC 2CLRA 3WS6A 4Z7NE 2YD4A 3TO4D 1AXIB 3TYFB 4ZFOL 4LAJH 4V1DB 2BHYA 5HYQA 1MCQA 2KL6A 3T0EA 2GTZA 1UKTA 4X8XA 5E4EC 3X11B 2G9HB 5CILH 2DAVA 5GS2D 1UA6L 2IF7A 4EDXA 1EUUA 1T4KA 3RWCB 5E8EB 4AENB 5E6ZA 2F74A 2BHZA 3FAWA 2I5YL 4LHUB 3LQMA 1YQ2A 4DUWA 4H0HB 2LVEA 2NXZB 3LPFA 1I1AB 4XNYH 3ZDXE 4PG9B 3V6BR 4YGAB 4BFGA 1WT5C 2VDNL 3U4BL 2YHGA 1AD0B 1UWXK 4GFTB 5JXAH 4F80A 4BUGA 1IGIL 1AGDB 1AD0A 1TJGH 4FFVC 1OP9A 3X12A 3S3PA 5IVZA 43C9A 5FK9B 2PETA 1ZTXL 5TDNA 2ICES 4GH7B 4RWYH 4LIQL 3HUJB 4XC3L 3GIVA 4NCDA 3V6FA 4JZNB 1IQWH 5DF0A 2VZ3A 1AFVL 1MLBA 4OLVH 5ESQA 2ATPA 3OJDB 5FYLL 4PRIA 5D7KE 2GTZB 2DWEB 3VH8A 5JIKA 5M94B 4F9PA 3FQTB 5DJZA 2UZIH 4PTUA 2EICA 4UDTB 4JN2A 3L6FB 2V7HB 3MA9L 1XIWA 2K7QA 2JJUA 3OKNB 4XZUA 4PLKC 4JCLA 1VACA 3BIKA 4OJFH 1LEIB 1JZ5A 3ARRA 4K3HA 4QWWC 4R97C 2BNQE 3LS4H 1HIMH 5E1AB 4EIZC 4WHDA 3CVHL 3QISA 4M8QA 1KB9K 1SM3L 3UTPD 4ERSL 5DVKA 3WE6B 4HUNB 1IZKA 3A6CL 1AJ7H 4UI2A 4O2CA 5F88B 1YEJH 3CNKA 3C5ZA 2VKWA 5DRNA 5KS9B 2DM3A 2DKMA 5CJ5A 1P4IL 1X44A 3FFCA 5A2KH 4Z6AT 3FT4A 1RUPL 3RU8L 1XZ0A 2GJZA 1WJ3A 4PRAA 1DCLA 3WNKA 5DD0H 2NZ9C 5ESVB 3QFDA 5K93A 5HI5C 1RIVL 1TVHB 3OG6B 1YEKL 4F8QA 3W5NA 4Z5RA 2YUWA 3EFFA 4X7FC 4L5FH 5I75B 3ARSA 1CDCA 3IU3A 5D7LB 3BD5A 3IU4L 3QIWB 4JRYB 5HI4D 3FAXA 1IKFL 3KLAA 1MRDL 3AY4C 4JPVL 3WKML 2ITDB 2QQNL 1XGQA 5DMIH 2RIKA 2YMXL 2O5ZL 4IIQC 3SE4C 1BMGA 2FEDC 1QHOA 3CGTA 1QD0A 4YO0B 3B2VH 3N0PB 4L3AA 5D7LE 3LKOA 3KYAA 1BD2E 1PX4A 2XZAL 4IHOB 5HYJD 4M6NH 4NQXB 2FO1A 4JO1H 5MEPA 4Z95L 1U8PA 2L7UA 4LRIC 3C2SA 5HYSA 4GMTH 4GKZB 3BE1H 3MBEB 4JHWL 1L9MA 1UENA 2CDFB 2FB4L 3SO3C 5J56B 2LAGB 3Q3GB 1E4XH 2AEQH 5D1XC 1LO4H 1Q9OA 4JPIA 5I8KH 2RJMA 2BNRB 1BFVH 3RTQD 4J2XA 5HI3C 1CYGA 4MJ4A 2X2YA 3EZ8A 3RBSA 2R39A 3CSBA 3IFOA 4NQCE 4I5BB 3RTQA 1S9XB 2H2SC 3CUPA 2ADFL 4LPCA 4HQQL 4X4XA 4NQSB 3UZEA 5DUML 4YPGA 3ZDYF 4XCNA 4FQXA 4FFZL 1KEMH 3M1BB 4WUUE 2PYFA 1ED3B 1DBBL 4UT9L 1AQDB 1KPRB 5I1KH 1CLZH 3NCBB 3WSQH 4NSKB 4JFZH 3EBAA 4YR6B 1RJZB 1X5YA 4TSCL 4JDZA 4JO4H 4QHUB 1Z6JT 5E4EB 3CX5K 1NCCH 1BOGA 2D0HA 2AJSL 3WIHL 3SN6N 4HGMA 3X13A 4CGTA 1YYMH 4K7FA 3I50H 4H26A 5CAYB 2EDTA 5I1GH 2RQ8A 1G9MH 4AMKH 3MPCA 4NT6B 5GHWH 1RJLA 2XZCL 1EZVY 2VDQL 4XPBH 3CK0H 5FFLA 2WLYA 1B6DA 1ZT7A 2B1AL 2J8OA 4NQEB 3T0BA 4NUJA 3CMGA 3MV8E 1R0AL 3ZSTA 4KJPC 3MRPA 4YK4B 1UM4H 3JVGC 2YC1A 3WL9A 5T33L 4M1GL 5GIRA 4NM8L 4BJLA 1RULL 2OI9C 5FCUH 2VDRL 3QUMH 3PWVA 1AY1H 1HWGB 1A6VL 3V0WH 2X1WL 4EZMA 3VH8G 3DGGB 4TQEL 3DWTA 1MCKA 1A7PH 5TF1L 3PDGA 1QNZL 2Y4SA 4XPAL 1OP5K