1ICEA

Structure and mechanism of interleukin-1beta converting enzyme
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
167
structure length
167
Chain Sequence
GNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of interleukin-1 beta converting enzyme.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords INTERLEUKIN-1 BETA CONVERTING ENZYME
total genus 50
structure length 167
sequence length 167
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1994-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iceA00
2CNNA 3SIPA 4ZVRA 4N6OA 5LU8A 1RWKA 4QU0A 3GJSA 2J32A 3H11B 3NS7A 4ZVSA 1I51A 1RWPA 3EDRA 5H0IA 2CJYA 3D6HA 2QLBA 1F1JA 2FP3A 2QL7A 2P2CA 3BIJA 2C2KA 4D3XA 4EJFA 5IABA 3DEIA 5IC4A 2H65A 3GJTA 1PYOA 4ZVQA 4JR2A 2CDRA 3IBFA 4QU5A 4M9RA 1RWVA 2C2MA 2HBRA 2QLJA 3P4UA 4FGUA 4QU9A 5I9BA 3R7BA 3R7NA 1NMSA 2J31A 5IBRA 4EHLA 4QUIA 1RWMA 3DEKA 2HBYA 4HQRA 4PRYA 1JXQA 4ZVPA 4AW9A 5IBPA 5LUAA 3R5KA 3V55A 2DKOA 2Y1LA 3RJMA 4NBKA 3H13A 1K86A 4HVAA 3NKFA 4JJEA 4AWBA 3GJRA 3V6LA 1NW9B 2QL9A 5K20A 2CNLA 3KJNA 4QUGA 3V6MA 4DCPA 5LU9A 3D6FA 3NR2A 2XYGA 4QUEA 4NOJA 1RHRA 5IAEA 2CNKA 1I4EB 2H5JA 2QLFA 1GFWA 1ICEA 1QDUA 2HBQA 5IASA 3S8EA 2Y0BA 1RHUA 2C2ZA 3D6MA 4PS1A 5IANA 1SC1A 4EHFA 2CJXA 3R7SA 4JJ8A 5IAKA 4EHAA 4QULA 1RHKA 3SIRA 4N7JA 1RHJA 3V3KA 3V4LA 2H4WA 4HQ0A 4FDLA 2NN3C 4JJ7A 5JFTA 2H5IA 4I1PA 4EHKA 1RWWA 4FXOA 1NMQA 2H4YA 4QUDA 4JQZA 5IBCA 2WDPA 4D3YA 4DCOA 3PD0A 4N5DA 4AWAA 1KMCA 4JR0A 1BMQA 2H54A 4QUBA 1NMEA 2J33A 4PRZA 5IARA 2C2OA 3R6GA 4JQYA 5LUBA 4EHHA 1RWXA 3GJQA 1SC4A 1RE1A 4JB8A 3DEHA 2XYPA 3OD5A 3H1PA 4N6GA 3H0EA 4N7MA 5I9TA 4EHDA 3R5JA 4FEAA 1RHQA 1RWOA 4NOLA 4QTXA 1QTNA 3DEJA 1M72A 4IEFB 4ZVOA 4ZVTA 5IC6A 4QTYA 3QNWA 4I1RA 2AR9A 2XZTA 4N6NA 2C1EA 1GQFA 4NOMA 2XZDA 4D3ZA 3S70A 3R6LA 5IAGA 4QU8A 2HBZA 1SHLA 2QL5A 4NBLA 4IYRA 4ZVUA 4EHNA 1CP3A 4QUHA 4JR1A 1QX3A 3UO8B 5IAJA 1PAUA 4QUJA 1SC3A 2CNOA 4NOKA 1F9EA 3V4OA 1RHMA 3P45A 3PD1A 2H48A 4QUAA 2FQQA 3PCXA 2XYHA 3E4CA 4NBNA 4PS0A 2H51A 3IBCA 3K7EA 3H11A 3KJFA 1I3OA 1I4OA 1SHJA 2FUNB 1RWNA 2K7ZA 3UOAB 4DCJA 2J30A 1IBCA 3EDQA 3KJQA 3ITNA 1CVRA 1K88A 4LSZA
chains in the Genus database with same CATH superfamily
2D0DA 3OH8A 3N53A 1EINA 1CUSA 2HCJB 5K4GA 1OTYA 3KCQA 3F73A 3RU2A 1QNLA 5CM2Z 2QPAA 3NRJA 2B3TA 1G6OA 1RXSA 1XQ6A 2Z2IA 1QZUA 3EIWA 1JFRA 1UKVY 5ITWA 1RKBA 4EI7A 3T1OA 5E95A 3UT6A 1SGWA 3EDYA 4OIMA 2HIHA 1LSUA 5NULA 2A35A 4A16A 3PL5A 5KNBA 2IS1A 2VDKB 1LF5A 2O6HA 2CHUA 1JQDA 3F46A 4RVGA 4QUKA 1PQWA 5JMPA 3FHOA 3E27A 2C2GA 1OKKA 4GNRA 2FCRA 3HA3A 3PE6A 1T8WA 1MC8A 3WL3A 4PRYA 1LBSA 1Q50A 1AHHA 1NVBA 1ZOLA 2V65A 2I22A 3NATA 4PHFA 4U5XA 5AVWA 2WYUA 4U39A 2AW5A 4F11A 4KDFA 3COWA 4OHBA 4C4AA 3A28A 3N39C 2OGTA 3KHKA 3LW7A 5K4HA 4BO0A 3UJNA 2D1QA 5KHLB 5I3CA 3D6FA 4AI6A 4XGRA 2PMDA 2XRMA 1DADA 2ZJ0A 4MYCA 5K2OA 3JASA 2ES4A 3NM5A 3IO3A 1EE1A 2PT9A 1GT6A 3H3FA 3DZ8A 1TM2A 3O4GA 1XKXA 5LQSA 3V8VA 4WOKA 1M7GA 2QW8A 1FFAA 3LYHA 1J9ZA 3VR0A 2XUGA 2YFKA 4OSEA 3F5QA 5CFQA 1AQJA 4I8XA 1IN4A 3P5BA 2CUKA 3WNDA 1HDEA 3OURA 3IEUA 2OR3A 2X6RA 1IK4A 3RSZA 4DCMA 5IZCA 1OLUB 2UZ0A 3E3OA 3K31A 2V7UA 3LHKA 4YAKA 4L75A 4JNCA 4ZQHA 3S2SA 4DV0B 2CV0A 2NN3C 1K8YB 1VIVA 3KTAA 5F2OA 4BQIA 3N8NA 4X66B 2D1FA 3OOHA 3IE1A 4J16C 3CYFA 1JNXX 2R751 1MCZA 2GHRA 4HB2A 1DTSA 2GBLC 2EW2A 4GX5A 2B3DA 4IXDA 3HJFA 4D0LB 4QGSA 3KT6A 1V1MB 3ORHA 4NCIA 3UPUA 1E2GA 2WTAA 1Z34A 3R6GA 5CB8A 1ZBDA 3G0BA 1XDDA 3CRZA 3DEHA 2X15A 2X1MA 3O2SB 5HZGA 2J3HA 1D0SA 2XMQA 5EJ8A 1F17A 1U7WA 1U9IA 1YU6A 3DXFA 3NRBA 4H16A 5GJWC 3SHTA 3C1AA 4UW9A 2I7TA 2Y92A 1Z2NX 2JBAB 4V0LA 1YBAA 2DC1A 2P5YA 1CR0A 4LC0A 3VR6A 1QB7A 5CDHA 2MIIA 2B5OA 4F86A 2M6KA 4NOMA 4N0QA 5LJLA 1WL8A 4A27A 1ZMTA 2OVBA 3CKMA 2GPNA 3LQKA 4HDQB 4J8PA 4NDNE 2OZPA 1OI7A 3ZTTA 5C53B 2WHXA 4JBXA 1R64A 2EHJA 2HJVA 4IMPA 4DJDC 3RJZA 4DV4B 4TWBA 2CNOA 4G1CA 4ML3A 4WOPA 2D00A 3K09A 3FMOB 2HU7A 4H1VA 1OU4A 4COOA 1EZ1A 4OI2A 4FLEA 4JEHA 5LM3A 3PJRA 3Q9LA 2JATA 3CV3A 1BN7A 4NYIR 1L5HB 2V59A 3ADDA 4AD8A 2I99A 2JEZA 2P2GA 1C3EA 1MFPA 2A9VA 3MCZA 1PLKA 2J30A 4LXIA 4R68A 2POCA 1O6FA 4RM2A 3QVWA 4TXMA 3WP0A 4BDTA 1AGNA 1R6XA 3JTEA 4XASA 2X2EA 3U39A 2BGKA 3VC1A 3I4LA 3VPHA 4YV0A 1GUFA 4KXFB 2BGWA 2GX6A 3KVOA 2AKEA 4FBGA 4X3CA 1KAEA 3FDIA 1KRXA 2YQZA 1KOJA 1G6Q1 3K15A 3E3AA 1JJFA 1NN1A 1SXJA 3N70A 4RTLA 2H07A 1KEVA 2VDOB 4KPEC 1QO9A 2EZTA 4G1VA 3EG5A 4N3CA 1JR6A 3A0UA 4FFMA 3ZCXA 3QYPA 4JVMA 3GROA 2ZYHA 3RIHA 1CZRA 1G291 5K6AA 1OF1A 1RWMA 2CBGA 4CU5A 4ZQIA 3T0IA 2ZR8A 3PS9A 3NYWA 1V96A 3FKSD 4CCSA 3KOYA 1JILA 3Q40A 1BQ3A 4MVJM 4N0DA 1JAIA 3C7AA 2YWGA 4L4SA 4BVFA 4PBSA 1F4VA 2OHHA 4X5OA 2EDCA 3F5SA 4Z9YA 1UANA 3DT9A 4I9UA 3A14A 2X3YA 3RC7A 4LQCA 1QQ6A 3S5UA 2XYGA 3B6KA 2NUAB 3L7DA 2GLUA 3MTBA 4DN6A 1QP0A 4B3TB 1Q0SA 5FBRB 5CNJA 3F1LA 1DG3A 4MVYA 1CS0A 2IYAA 5CEEA 4N48A 4PINA 3MFYA 3BD6A 1RSZA 4MI3A 5K99A 1K1EA 5L6MB 1FMLA 3R4CA 5K0NA 4BXOB 4KLCA 3RHZA 3K4HA 2IDKA 3PE4A 1IULA 5IFKA 4BVHA 2XEXA 3OPQA 3I83A 2J67A 3MPOA 2JK0A 4JJFA 4HAWA 3PITA 3LPMA 2DFPA 1UM8A 1KXJA 1Y3FE 4GX0A 1BRTA 1NC1A 2JJQA 4MW9A 4EA9A 4M8IA 1FXSA 4MHTA 1QTQA 2ZCUA 2DLDA 1XYVA 1S8OA 2HWYA 2VJMA 3E5RA 4QYWA 1T36A 3QYJA 4WKBA 2JASA 1WHSB 4JY7A 2HRBA 1BEEA 3B1YA 3IKTA 4A0GA 2A1UB 5FNVA 2GETA 3ZWOA 2ZAOA 1LBEA 2R5WA 2RGNA 3M6IA 1NF2A 2DQSA 4TTTS 2LVBA 1P75A 3EOZA 4UKDA 1PGOA 2X4IA 3T95A 1X1DA 3HYNA 2I2XB 2GPAA 1NJ2A 2J0QA 3FTEA 1KI7A 1NKSA 2FHPA 3A7DA 3BZWA 4G65A 4IXWA 4MLZA 2LGJA 4MWSA 1QOZA 5KYWB 2HV9A 2JGAA 4XEHA 4EYEA 5D3MA 3PVSA 2CEAA 3BL5A 3SQNA 1IB0A 4D0RA 3CVYA 4WUVA 1A9XA 1HT0A 2LCIA 3FVTA 3N2EA 5DNAA 5BWNA 1UBRS 1COZA 2ZBRA 3FX2A 3IESA 2DFDA 3AW9A 2RMKA 3QE2A 1YF3A 1ADCA 4ND8A 3HCEA 3FSGD 1E63A 3FNQA 4PHCA 1MRNA 1KDTA 1Q19A 2OFFA 4PNEA 3PCRB 1NE7A 3G0DA 3AP3A 4LCEA 1L5SA 2IYUA 4LXHA 3Q1LA 4RIGA 4RXMA 3DBHA 2NUPB 3FHJA 1VHJA 3HSYA 5MHTA 4IX9A 3EVAA 4KKVA 1WKCA 5DT2A 1VLZA 1UFKA 4BLTA 3OMLA 3UEOA 5JVDB 4IHJF 2XE6A 1Y1LA 1IIRA 2CDNA 3FTCA 2BKVA 5F5XA 4D8YA 4A6DA 2P4SA 2F17A 2C4WA 2WUDA 2CD7A 2VZ9A 1OXVA 3AERB 3BXFA 1VBNA 1E94E 2H17A 2RH4A 2BMAA 3BSYA 3AR5A 2WSSD 3D4OA 4ZT2A 3WTBA 5IKXA 5B4UA 3WLLA 1ESNA 1R15A 5DI3A 4MGZR 2F4NA 1R8SA 3KJXA 4MIEA 2FP3A 3O0TA 3MEQA 4PYKA 4R2LA 3UJPA 1B1AA 3JTMA 4G5QA 4KR2A 4RLQA 5B2ZA 3GLHA 4JU8A 1UKBA 4MGEA 1DKNA 1E3IA 1YI0A 1H05A 1Y4UA 4Q7MB 1V4BA 1DC8A 4PO8A 2FX3A 3GNQA 4M1OA 3RUFA 3SF8B 5ARBA 3ADBA 3P0JA 4HDRB 4WBSA 3L4JA 4J0KA 2RJNA 4E5YA 3U56A 3RRXA 1Z7BA 2DH5A 1E89A 2PT7A 4RK7A 4YJ2F 3KSUA 1DIOB 4M1KA 4Q24A 1C3XA 4TX1A 5FX2A 2OMEA 5K9ZA 4JP8A 3DBVO 4IOJA 2ZTUA 4UBIA 1BS1A 1D5CA 1OXSC 4WZAE 4I1OA 3DWEX 4KO2S 3EG9B 3L6UA 4KXXA 4G0OA 2ZSEA 1MW8X 4UCFA 4NU6A 3NR2A 1ESEA 1L7DA 3C8HA 4RLFA 3ZZ1A 3EPKA 2QRLA 2VLBA 3GPDG 1WCWA 2WJ3A 4EGJA 1M2FA 1YZHA 1VMAA 1P0IA 1BDHA 3QG5A 4V0NA 4ESHA 2I3AA 1SA0A 2A5JA 1EX6A 2P4UA 2OCXA 3DEYX 1QXSA 3ABIA 5FOVA 5TGZA 2FE1A 4WGGA 3AC0A 2FF7A 1J1ZA 3AXSA 3KVRA 5LPNA 3M3PA 1OMOA 4XUDA 1X9GA 1K2VN 2GEVA 2ZSJA 3KU4A 1OIWA 4KQ6A 4YTEA 1N3YA 5BORA 5AW3A 3FTQA 3AUYA 4HF7A 1V45E 1UBNA 1BHJA 4JUDX 5B7QA 3OKFA 2H5IA 3V2UA 1E1DA 1KFJB 5KQMA 2D0IA 3Q12A 4MYTA 4LPKA 2QUZA 4FHGA 5BYJA 4LC9A 2ATIA 2CLDX 3MOSA 4QXMA 3CVJA 1RAIA 4EGCB 1EDZA 1VL0A 1ZXLA 3L4SO 4XIJA 3VKWA 4GD3Q 1QRRA 4AAYA 4C5BA 3JYHA 3NBYC 2QZSA 1V1RA 3L0BA 4Q48A 1SCJA 3IIMA 2Q4RA 4TTSA 1G5FA 3IA2A 5PNTA 2O8BA 4DAOA 2YZ7A 3JASB 1ST2A 4B4UA 4BMNA 2JLQA 2BHTA 1AKRA 4GI5A 3AR9A 1DX6A 1YDFA 3QNWA 1OQAA 2YX1A 3M83A 1GGJA 1U3WA 1YZNA 3FLAA 5DYWA 1E66A 3CONA 3ETNA 4POOA 5ALRA 4DEYA 1F06A 2AEEA 1O89A 4LBVA 5IAGA 3ZDDA 3U31A 2ZW9A 3TRFA 2NZXA 3ZI4A 2A58A 3AV0B 3H5AA 1I1HA 2KLHA 1VG0B 3A10A 1V8DA 1PT7A 2EG9A 1R1DA 2AG6A 4HQFA 3N2GA 3FE2A 1U0TA 1V1MA 2P1RA 1YMQA 1MB3A 1CUGA 3HZZA 4QWMA 1V11B 3LOQA 3E5MA 4NPCA 1GYPA 4GBMA 1P1KA 2RHOA 2P0EA 3GG2A 3BE6A 5TX7A 3OA2A 1NHGA 4MVJE 2WABA 3B9PA 5TMEA 5LA6F 4EUEA 1TIBA 4X1IA 3GJ6A 4YV1A 2LV8A 1K3UB 4FKZA 3O4FA 4QOEA 1GDHA 1K7EB 4DQVA 3LCVB 3ED1A 2OXFA 4I5FA 4JZKA 4R3WA 3WWYA 4CKEB 3EMDA 4D2IA 1EXNA 1QE0A 2EBUA 5U9CA 3WZLA 5TR9A 1RWPA 3O7MA 4B83A 2V4UA 1BXKA 2VNJA 3W8FA 2VBGA 3V8RA 3VSAA 2BFCB 3CMMA 3IMFA 4HX5A 2JIBA 1Z29A 3FCSB 3NTXA 3K6KA 4CL8A 3KYIB 3DEFA 1Y5IA 1DG9A 3RYCA 4CG1A 3BMNA 3TEJA 4CM9A 1M6NA 4MGYR 1TGVA 2G72A 3H1EA 2QX9A 4M6WB 1GUZA 2VAMA 1GNRA 1W4CA 2YYZA 1II8B 2MDTA 2JBHA 1ABFA 4Z8YA 1SC9A 5IXSA 3KKZA 3OTWA 4JYMA 3TNLA 2BLLA 3E9MA 3EXAA 3Q7RA 1Z37A 4KYUA 2P7HA 3ZDXB 4QDZA 1HX7A 3SIXA 4GMGA 4N40A 3RIXA 3MLAA 5HVNA 2DPYA 1YNSA 2IE0A 2EWWA 1R16A 1I4LD 2I71A 4GAEA 1WD5A 1E4EB 2KB0A 1G8MA 2R5NA 4WZBA 2GB4A 3OHPA 3DT8A 2HUNA 4GL4A 4F1JA 1RZVA 3CUKA 4FC7A 1GRVA 1O2DA 4B2LA 1FFEA 2M6RA 1PR5A 3SX0A 5JI3E 1PJ2A 2NLOA 4PQGA 5IKOA 1FYVA 2Y8EA 3OQJA 5BQXA 3DDHA 2PT5A 3Q6IA 4MUBA 4TKUA 4ADSG 1G64A 1N25A 4L4RA 1AHPA 4C7MA 1X7WB 3FLEA 4H0CA 5AQ1A 3W6NA 3NBAA 3R5XA 2W2KA 1JPJA 5KNLA 4X60A 1IXSB 5A5FA 3PZBA 2ZAIA 2GJ9A 4JP1A 5K3AA 1ISMA 1K97A 5B64A 1G20A 1MR3F 2I6SA 1P72A 1Q0LA 1U9YA 3DBLB 3RK0A 3COZA 2B30A 4MPRA 3AI3A 4NZPA 2ZM6B 5EPEA 1OWMA 4JLKA 5J2UB 3ST7A 2FLWA 3DC2A 3K30A 2QUAA 1R0RE 1E32A 1R6VA 1ULHA 2V5VA 3G7NA 4KUGA 4TV8A 3ILXA 3C41J 5JD3A 1P29A 1B8VA 2GAJA 4KUEA 4RF2A 3RS8A 4O25A 4ALNA 4BGDA 5M29A 1XZLA 2FQ1A 3FB4A 4KVFA 4K9QA 1NN5A 4D3SA 5IMSA 4ZREA 4GXQA 2PLRA 3LC0A 3NONA 1VIYA 3ABZA 5EZQA 2CL5A 4AKEA 2PKCA 4EGAA 2V7QA 3DCJA 5KMGA 5TGTA 1TVKA 1OYVA 3KELA 3C3WA 4CDRA 2AA3A 1T3TA 4RF5A 3UWOA 2JLCA 3NIFB 3K0KA 2A7XA 2F43B 3BD9A 3ISVA 4OXXA 4K6OA 2IHBA 1XB2A 4BNWA 4CM5A 3IOYA 3PEVA 8ABPA 1G60A 1DKRA 1RI5A 1RHMA 2ECKA 2DWQA 3U7QB 2TMGA 2ZROA 2P2YA 4RXTA 4PE5B 4IIFA 1N0VC 6REQB 1KY2A 4WVLA 4UQPA 3IBCA 1R8YA 4Y8VA 4HDNA 2R0QC 4YIHA 2JK1A 2FDCA 3THOA 4ONEA 2C1ZA 3ZGNA 4JWKA 1PK7A 2JAOA 4TQUS 2PKYX 1YFJA 2GVDC 4OK6A 3KEQA 3SZOA 3ICCA 4P2GA 1NJ5A 1QM5A 1GPYA 2JGEA 1U8EA 4Z99A 2IOYA 3BIJA 2A4KA 1NKTA 2JZOA 2P5UA 2ZRQA 3L02A 3GUHA 4I55B 4NZMA 1VSVA 1BMDA 3D7RA 3O8DA 3MTIA 4AUMA 4M7PA 3KKNA 3HGTA 4WCDA 5C8DA 4DYDA 3DZJA 2YWBA 2K87A 4FGUA 5C4IA 2DWCA 3B2QA 4LDAA 4Q05A 4QOGA 1JXMA 3ZV6A 4AJ9A 4DG8A 3C2QA 1C2TA 1C1XA 3VOSA 4Y6GB 4EHLA 2X8BA 5I7AA 4TS4A 5H02A 2I55A 1HFWA 4QBHA 5IDWA 5DM70 2AIRA 2J6IA 5KYXA 1E7QA 1H6CA 2VCHA 3NHAA 4XDZA 2V6GA 4M4SA 4B0PA 5I45A 3IR5A 1OPRA 1FPQA 4G6ZA 5H81A 3HCOA 3D8NA 1NRWA 3KOXA 3LL7A 2DE0X 3IVGA 2GYUA 4ZTBA 1J06A 4BO8A 2QBYB 3QUTA 1PNVA 4ZVVA 3OTIA 3AVVA 1I3LA 1XRRA 4P82A 4RU1A 2V3CC 5KYKA 4JS0A 4RORA 4Y0AA 2PZMA 2XB8A 4NICA 4RSGA 4P8RA 5LXTF 3E18A 1SVWA 4YFVA 2I2DA 4OB7A 5LQJA 3UJ8A 3I05A 3LK7A 1IQ0A 1LZLA 3H05A 3RS7A 1V8ZA 3LLSA 4HH3C 5FPHA 5BQ5A 2GN6A 1LDMA 3OLCX 1EEHA 3EEFA 3QBTA 2ZJ1A 3EVBA 4G8DA 1CZLA 4MWBA 1D0VA 2OSBA 2Z1DA 4QNNA 3R7WA 1GLGA 1B6TA 4LV6A 1U8FO 5CCEA 4AKHA 1I4TD 3ZD9A 4Z9AA 3SBEA 1UXJA 2VNAA 1NLFA 2A92A 3JQBC 5KAMA 1YJQA 1WXEA 3WK4A 4A82A 5H4GA 1HE5A 5KREA 2JJYA 2QK4A 4MK4A 4O2BA 1VJDA 3H19A 4PQRA 3H0CA 3RAPR 1RMTA 2I29A 1EG2A 4XJTA 4ZAGA 1LXCA 2VIIA 1FLDA 5AESA 1ZJ5A 2X8JA 5JWRA 1TLLA 3VUEA 2VBIA 1Z5ZA 2HN9A 1JSXA 2NACA 4I6JA 2JRLA 2A30A 4I5IA 3WLHA 3R76A 3QE4A 4LI3X 1Z6ZA 3ZJTA 2B1GA 1W87A 1M72A 4MWZA 5AM0A 1XYYA 1Z6YA 2HV8A 2O07A 1ZRSA 2ZVPX 4FD3A 4CQJA 4Q0MA 1P61B 3WQBA 4F2HA 2YQ5A 3MUFA 1A88A 1D1PA 1E61A 2EZ9A 4IDCA 4M9SA 1I36A 3LNTA 3R0XA 1KI9A 4C89A 4MAAA 3VOBA 4QRDA 4TMVA 5DLEA 4O6VA 4PZUA 3SJAA 4M88A 3UTCA 1PJ4A 2WWVD 4L5YA 1O95A 3BD8A 4R0MA 2OPBA 5B3JC 3PYMA 4EUNA 2Z6QA 1VKOA 2HREA 5DV9A 1UFOA 3PD1A 3V48A 2Q5CA 2Q49A 3E8XA 4KFSA 3CH6A 5J4LA 2UYQA 3DOHA 3RUHA 3MWKA 2J1LA 3QZUA 4Z5XA 3OJCA 1EFRA 1B43A 4CDNA 2UUPA 1IATA 1M5TA 3DTVB 2VSNA 1TAHA 3G2NA 5C52B 1SXGA 1TK9A 1I94B 3O1LA 1G4HA 2NU8B 1D2NA 4EYGA 5FOUA 1NQTA 3JQCA 2I03A 4RCZA 2BD0A 5JSFA 4QU0A 2P91A 3L6EA 2HJ9A 1LNQA 4IH4A 4EPWA 4JXJA 4DDWA 4BEWA 1DL5A 1XTRA 3VPBA 2D2IA 2DQ4A 4Q4AB 4YRMA 4RC9A 1RVDA 1WDMA 3E9ZA 4M8NE 4Q02A 3RE1A 3MELA 5A6VA 3M9WA 4P7GA 2HH9A 2H7CA 3RVOA 4PX5A 4BNKA 1UK8A 4IFEA 3R0ZA 4EVQA 3KTOA 1U1EA 3MWEA 4MR7A 4CMEC 1ZD9A 3RKRA 2X58A 4J0JA 4U8HA 3W05A 4LVOA 3WFIA 2GZ2A 4EB0A 1ZICA 4PZ0A 1UP6A 1AA6A 2FRDC 1Q0HA 3CX8A 3FPJA 3PC8A 4GMXA 4KI7A 5KHAA 1BWQA 4FZ5A 3B6MA 4CKEA 3OM8A 5EFOA 4ARUA 2DKNA 3C1TA 3LFTA 1VLJA 1DCTA 3STTA 4X1IB 1W1WA 4R9UC 4ZJZA 2O05A 3C87A 3GVPA 4BQRA 1GLVA 4BX8A 5C1PA 1WDKA 2RBEA 3ZV5A 5JS2A 1TTTA 3Q5GA 1XKLA 5GGXA 1FUIA 3V1MA 2P9HA 2XA1A 4BGUA 1BVUA 4FSXA 3HDJA 1Q95A 2WHRA 3HJRA 3TVDA 3UK0A 4FHDA 2W2QA 3AUXA 4J6FA 4QJBA 2RGBA 2G1KA 4CW7A 5C5IA 1YULA 1K08A 3D7MA 3AF1A 4RS3A 3VPAA 4MAMA 4FCTA 1N7JA 5TV2A 1GCGA 5F35A 9LDTA 3WA7A 4XD7D 4DRXB 4HHEA 3VBEA 3DR3A 3NHJA 5ILOA 4O5OA 2XUFA 3LK6A 3QLUC 2DBZA 5A4FS 2I0FA 5EEHA 4YCNA 3Q8KA 2BJWA 3JRWA 3OOJA 2UUAB 4V39A 4JU9A 4R1PA 3IP9A 4D74A 1YKGA 5T7BA 3OIDA 4OY3A 3I39X 5K8CA 3KB2A 4GDFA 2WJYA 1V5IA 3IO5A 4XJXA 5LNK6 3AFOA 5CFPA 1A4XA 1SQ0A 2IZ1A 2ZB2A 3R8CA 1W0CA 3BMCB 3M5DA 3GBSA 1NBAA 3L0PA 2H1VA 1AB5A 1UWVA 4OJTA 2RAUA 4G5OA 4WKGA 4C6SA 5IJ9A 5IK2A 2VP6A 1DRJA 4W5TA 2B9VA 4RDIA 4BKMA 1N2BA 5JTTA 1U11A 1P91A 1H2YA 5FV7A 2C4UA 4FQ7A 3H2YA 2AD5A 1E60A 2QRJA 5A3RA 1REQB 1QGZA 4IO0A 4GZMA 1ESMA 2GQ0A 1N78A 5I9LA 1F5NA 2BHRA 4ITRC 3T3GA 1U7DA 4BCDA 5BN4A 2GEDA 1SC3A 2VHQA 1WO8A 5J2UA 1RWQA 3D6AA 3OQBA 4MQLA 4O4LB 4KDRA 4KN6A 2CLCX 4EKEA 1QTRA 1XZJA 2E87A 3I42A 4DDMA 3L46A 5KVAA 3Q8MA 2PWZA 4EBBA 3CZCA 4H0NA 1HFKA 4K5QA 2IYXA 3IAM6 1RWNA 4HYYA 5DNWA 2V0CA 3AI1A 4Q4JB 5K3DA 5KVQA 3Q98A 2G70A 2WJHA 3UJ6A 5HFNA 3O8RA 3P1JA 1BFKA 5IMBA 2NU7A 2ENWA 1IHYA 1G5PA 4URFA 1HL7A 1E6UA 3BM5A 1RU3A 3CLTD 1JNYA 1K6JA 1PV2A 3E70C 3PEUA 4ZO8A 2HEGA 3LL4A 3RKUA 3UNXA 4DCSA 1CDEA 1JZQA 1NJ6A 2ERYA 1F48A 3J7TA 1OH5A 3D59A 1ZISA 2P2CA 2I1LA 3CY6A 3AB7A 1GGKA 1T2NA 3I9V6 3KWFA 3QKSB 1PEDA 1BDJA 3RVLA 4TTPA 3G2IA 4NU0A 2RGYA 1G55A 3U3RA 3DKPA 3GJZA 3ZCSA 1NUHA 3JR7A 1Q0QA 4EZBA 2HF8A 3KEOA 3Q8WA 3R44A 1WU8A 4ZOBA 1PLLA 2NM0A 3X1DA 3L4BC 1JJVA 5CCBA 1CQIA 1ZO8A 2FN4A 1EFPA 2IYRA 3DOUA 1UFVA 4P35A 5FQNA 4HJXA 4YCCA 121PA 4FNOA 2WKQA 3EBPA 3H13A 2VZ8A 4WLEA 1ZH2A 5AK4A 2O7QA 3IHLA 1JH8A 3DFUA 1FL9A 2ZJOA 3E5HA 4FONA 5EC8A 1WY5A 3PHLA 5ADWA 1DTWA 1AKVA 5A0TA 3ICEA 3E2IA 4ZJYA 2P62A 1EDOA 1FP7A 1E64A 4MS4B 1N9ZA 3LX5A 3IDZA 4EPYA 1KH3A 5FLKA 3VPXA 3OFJA 5DWDA 1VMDA 3DMHA 4PZ9A 1DRKA 1SVNA 3SZRA 4DSZA 2IBTA 3TUIC 2FAXA 4TPKA 2LUOA 5ER6A 1T8YA 3TCXB 1EP2B 1YRHA 3K9CA 4HTFB 1ACMA 1WR8A 2AXQA 2B98A 1X7GA 5FTJA 4BN0A 2ERCA 3HR8A 2FWRA 3NDRA 2F64A 1N6RA 2E4ZA 5I5EA 3BXZA 4YY3B 4K9LA 4OUDB 5AICA 2JAQA 3C6XA 4F2DA 2IYVA 2QRGA 5M04A 3NUZA 1T9GS 3UFXA 1TXGA 2IYSA 3PD0A 1AQ6A 2YHAA 3B9RA 4O0MA 1AD2A 5D3ZA 3WGHA 2OZLA 2HHAA 4ZZ2A 3RSGA 1FYDA 4B6GA 2NTYC 1YVUA 1M74A 1I30A 3DVLA 1QOPB 4IG4A 1EFDN 2NUTB 2HSEA 2OC4A 3G9QA 3NP7A 3PQDA 4QODA 5B7GA 4LRWA 4QGHA 5B6PA 2OAQ1 1ZVMA 3WRWA 3IVMA 1YZTA 4PLTA 3PXGA 4XXHA 4C3ZA 4HAXA 1RWOA 2OLKA 1A7UA 4DAEA 4GZLA 2NZ8A 2ZRKA 1VCMA 1GDTA 1MAUA 2PXHA 1E8MA 2I8CA 3LBIA 2WWGA 2C7OA 2O14A 1AQNA 3IIKA 3DFMA 3K9NA 2WYWA 1M1UA 3DDSA 3A3OA 4LXGA 4P3XA 2I33A 2O5VA 3AEUA 3G8DA 3QLVC 4TL7A 5E9QA 4L51A 4S1OA 4WBXC 3EF0A 4CTNA 2XVAA 1H1LB 2IXGA 3QEJA 3ZLUA 3ESXA 1TEXA 2YN2A 1UPUA 4QBIA 4QOJA 4RY8A 2YMLA 5DM4A 3RYCB 5FPPA 5K51A 1R6DA 2GAAA 4HFMA 4GYYA 4KP7A 5F7OA 1G42A 2A9PA 2YHIB 3TKAA 5E38A 4IGKA 1FJXA 1YQTA 1SHJA 4IRMA 2A4MA 1VHWA 3JRNA 3LDAA 4JXKA 4KGDA 4H4CA 2RH5A 4BVLA 5JH7B 3K05A 3MTDA 3QKRA 2WEKA 3HVKA 4BFLA 1KVQA 3ORFA 3VVCA 2B34A 2GO1A 5DYGA 2YZMA 1ODIA 4CQLA 3DJFA 3ROTA 3UWDA 3WR5A 4YCJA 4R1UA 3OC6A 1O9HA 4ANFA 5BN1A 5LP6C 1JR2A 3KZVA 3CGWA 1F0PA 2BC9A 3I0NA 1AURA 1RQPA 1EYZA 2LNDA 3KPUA 3FROA 3VGPA 5LMUB 2OG2A 3M6UA 4I8IA 3NBFA 4K9NA 1AZTA 4M83A 2FR8A 2XOKA 4NCXA 3ZNPA 3A3KA 1GSAA 1P0CA 3OOEA 1Z8DA 4EG8A 1GNPA 3GCGA 1CE8A 1GOTA 1PDOA 4ERXA 5CAEA 1MU0A 3JD3A 4PQYA 3DW3X 3NYQA 4CF6A 1K3TA 2OCBA 5KWJA 3OU7A 2QYTA 2VJDA 2H59A 5JMWA 5C7IO 4KW7A 2P1ZA 3I23A 3MTAA 3L1JA 3A36A 3DXXA 3SYMA 3VU0A 4AXBA 3ZCTA 4DPKA 1JPVA 1T26A 4DCPA 3KR1A 3EXG2 3UBMA 1ORVA 2WT8A 2I8LA 3L8DA 1T5IA 1A7AA 1N2ZA 1JTVA 1LLCA 2H9AA 2HU5A 2ZKLA 3C5EA 3LU1A 3S27A 2OHIA 2OM6A 2WD7B 1AA9A 1D7OA 1PIWA 1YDHA 1IQUA 3NKVA 3DQQA 4UNSA 4B9AA 4GM0A 2ODEA 2PX4A 3C15C 3AF4A 3PIDA 4IV5A 2LDBA 5EWMB 1D03A 3NBKA 4FP9A 1R2QA 5ALTA 4EY5A 4YRIA 1DTEA 1GPMA 3PGJA 3LCJA 1P45A 3VZQA 1YRYE 2FZGA 2YN0A 3UB3A 5ER9A 1OBOA 1P2BA 3A2LA 3PV0A 3QX7A 1GJRA 1LD3A 3A1FA 4ALMA 4D79A 2PJRA 5EUQB 4M1MA 4KFCA 2QXTA 1PSDA 1V26A 4C7KA 3UT5B 1DZ3A 2CYAA 5KJ6A 2JL1A 2QW1A 3H1GA 3PPXA 4LWPA 3VR3A 5TLSA 1BE6A 1E5DA 3ODGA 3OICA 2HRZA 1XCGB 2NVUA 2V0NA 1ISHA 1MT0A 3IJ5A 6REQA 3OPVA 2IOHA 5BSMA 4F21A 5BPFA 1XPRA 2CZGA 2ZBPA 4TQGA 1BJTA 3JQBA 2QQGA 2EWVA 1BW9A 1ZUNB 3O8QA 4OLJA 4P9NA 4LNAA 4Y67A 3SXUA 1NU6A 3WWEA 3NTRA 2YRFA 1VP3A 2YTZA 3HXPA 3JATA 4IEFB 5I47A 1V6AA 1G5IA 4CM8B 2CMKA 1PS0A 1TCAA 5FL7D 3MQFA 3QBJA 4IQFA 4UUBA 5C9ZA 5AI9A 4JBHA 1M7BA 4QYMA 1PR1A 4F3TA 4LVNA 5KTYA 4X7BA 4AJHA 3UAOA 4LF5B 2CZCA 1AMOA 2ZRJA 2B4KA 5AVQA 1A97A 3VYRB 3MXOA 3JWJA 5IW8A 2XWSA 1W44A 2JI6A 3JQ6A 2W93A 3CJRA 4TMTA 4V24A 1W93A 2ZSUA 3ETGA 4O3FA 4OYLA 4E6EA 4L5AA 3ZHZA 1L9KA 1W76A 3IQEA 5F23A 5K3EA 2DWOA 4X90A 1X39A 2H48A 4PANA 2FOLA 1XVLA 1SVLA 1L5WA 3U7RA 5KVCA 3E4CA 4XGIA 3N05A 3TJZA 4W5RA 1MGOA 1ORHA 1XD8A 4P31A 3UYKA 4PC3A 1E6WA 2AN5A 3G02A 2ZJ3A 1K8ZB 4IOLA 1UKAA 2WPDA 2D8MA 3PF9A 4MRMA 1QVAA 2IP1A 3ETHA 2KSQA 2OWDA 2CW5A 5FAXA 3DVQX 3HN2A 5IEJA 4HRAA 1QF6A 3MM4A 5AWFC 2GYVA 3ZCRA 3LW8A 3P94A 3KBBA 4MKGA 1SUPA 1Z3IX 4C0KA 1O6BA 5HF8A 4HNAA 4HNSA 7ABPA 1ZN2A 2FDXA 2JKVA 1J07A 4IHJA 4M55A 4KR6A 1QVVA 3BUSA 3BTOA 1VCOA 1N2EA 4PSDA 4P5PA 4NFSA 3DD5A 3S2EA 1HY3A 4W5NA 3SEQA 4C0SA 2IZZA 1I9CA 4EKGA 4KYIB 1AZWA 1X0XA 3UMSA 2C9OA 3D6VA 2WTXA 4GWGA 2JLWA 1P2VA 1YT5A 2NXJA 3PR3A 7REQB 3F6SA 4FKMA 3X1YA 3C14C 4RFLA 3PNYA 4RZ2A 3AKYA 4UU7A 4KHZA 5K4AA 4A8JB 1TQ4A 2V9PA 3K9LA 4O4IF 1GHTA 3PNKA 3JAKB 2XODA 2GN4A 3H7AA 3K92A 4NATA 2EEPA 1RDFA 1JSCA 3IRUA 4HSEA 4XCQA 3VPGA 4GBJA 1E6MA 2XX3A 5E2AA 2W6QA 3NMUF 5IAEA 4YHHB 3ZE7A 3LDGA 4MULA 3JYNA 4K88A 4OM8A 4Y6QA 4JI6B 3UJAA 4ARBA 4A92A 1SUDA 2ZRNA 2WHEA 1EXMA 1NI4A 5IN4A 2O7SA 1E3TA 3QWHA 1U6KA 4I8DA 4U7TB 3W5IA 3EZXA 5HS4A 1S0UA 4OQLA 4DIMA 1YONA 3OUZA 4C7JA 4D80A 3S8EA 4M0UA 4GR9A 4EHAA 1DI0A 1UJ2A 3TOXA 2B1RA 3DL0A 4NBSA 4I1PA 3F8TA 4KWTA 1C14A 4BOYA 2CMFA 1FP1D 3ZLTA 3GLIA 2L0XA 1E1QD 4ARZA 3SX2A 3ES9A 3LQ1A 1ULBA 2EF1A 4FE4A 1BQ4A 4ON9A 4DQ0A 1O0CA 4ACAA 1BXRA 1Z16A 3CUSA 3ND6A 4HPJB 2WAXA 4KXQA 1QIJA 4ZAVA 5J63A 2AC7A 3E23A 1EI9A 1ODTC 1B7GO 4OYHA 4G0VA 4ZYYA 2YWJA 2R6R1 3DHEA 5BW6B 2F1KA 3S40A 1QG2A 1PYGA 1LLDA 4DLUA 4G1EB 4HN4B 3SC2B 4CQMA 4PN7A 1V7ZA 2PS9A 2UVPB 1Y9ZA 1YZLA 3NH6A 3CRQA 3A6KA 1E0KA 3GU3A 4Y9RA 1C9KA 2YW9A 4EFMA 1C1DA 4F9TA 4DB2A 1U80A 3OTQA 1JJ7A 2FP4A 2WBLC 4HFNA 5FNZA 3SNHA 2R7AA 4D3ZA 5AW6A 1A9OA 4Q7JB 4XFJA 1HMPA 3WYAA 3HADA 1B74A 3CUEF 3OAAD 3P9PA 1JKMA 2CJWA 3L4EA 1Z7GA 3N0TA 3ORQA 1SFRA 1TRHA 2X42A 3EGDB 3GAAA 1VDMA 3W2GA 4IRXA 1EFLA 5FTLA 1X86B 5CB0A 5CDSA 2JLVA 3AF0A 5HP4A 2BMDA 3E81A 2PQ0A 1OBHA 2YWEA 3QXJA 3CURA 4FFSA 3GX1A 4CUKA 2JIZA 2XUIA 4RAOA 4U2DA 2BGGA 2PT6A 1P5JA 4HAUA 4RTSA 4QLOA 1W36C 4DVJA 2QUJA 2QUBA 3V8EA 4U2BA 5AD1A 1OFTA 2WQZA 4DEXA 4E4TA 4ZOCA 2WQ7A 1VLMA 4YJ3A 3NJ8A 1N1GA 4X94A 1UMDB 4JMLA 4Q34A 4ZT5A 5EMMA 4ZYWA 4JR2A 3TSWA 3KSRA 1QCYA 1YQQA 2C0PA 1ZMBA 3LC1O 2WI8A 1Z6XA 4FFRA 4QTTB 1JEAA 4AROA 4TV9B 3KZ1E 5KAPA 4YT8A 3LBNA 2PPVA 2J6CA 4J2HA 3IOEA 4JP2A 1BGWA 1Y7TA 3SNKA 3WK5A 1ZOIA 4NFYA 3KOMA 4XLLA 1N5MA 2FEOA 3UUFA 4W8GA 4B8WA 4E7PA 1Q22A 1EFVB 2JGIA 3QIVA 3TZHA 2Z95A 2GF9A 1XX6A 4WZZA 4ZV4A 4RKQA 4WVFA 4ZOLA 2I4MA 1IZ9A 2GN9A 3NBMA 2F7SA 4ZEMA 1NVUQ 2RB5A 1ZA2A 4JXZA 3II6X 5DNCA 1UL1X 1AIPA 2YS6A 3NPMA 1MNQA 3ENWA 3ID6C 3O2JA 2CNKA 5BXQC 1DJMA 1Q7BA 3CEJA 2IK8A 2O0HA 1UIRA 5EQTA 2VHWA 4YAJA 5JAOA 3OTHA 4DSAA 2P9BA 3FNRA 5EKSA 1L1RA 2OP0A 3ZOKA 3AUSA 4DS3A 4M9CA 1KP9A 4IO1A 2O7RA 2A94A 1U6JA 1VDZA 4GP6A 4BV2A 1IFXA 1XQWA 3V7UA 5BT8A 5SZJA 1QHEA 4JUFA 5EIOA 2R25B 5HKKA 1XCJA 3KAKA 1LH0A 3L1VA 1U04A 3NU1A 2Y9PB 5F7ZA 8ATCA 1EAMA 1VYUA 2X5XA 2RGUA 5TT1A 3NGLA 2QWXA 1BHO1 2KHZA 2KMLA 3B5JA 4WBNF 2IS6A 2FEXA 3NBQA 3TKYA 1XEXA 1J21A 1EGVB 1AN0A 5IJAA 3MRVA 4XD7A 2AMYA 1TO6A 2IHTA 2WJ4A 5FQOA 1W19A 3VPFA 4DLAA 1DAFA 1FVXA 2XCQA 3IP3A 2GK4A 4D45A 4EHDA 2PXAA 3EGIA 2VATA 3BF7A 2BIFA 4FGJA 4J2OA 1EDEA 1YXMA 3VZDA 1RIIA 3TZCA 5BUZA 4X3OA 1TX4B 2QSYA 2QRHA 2WD7A 2Z0MA 4NCHA 2Y2VA 3TUZC 1AM4D 3O0DA 1PL0A 1X15A 2BJHA 4FYWA 3FFTA 4JBGA 3WLMA 5EJ4A 1EFTA 1RBMA 2BGUA 3SGLA 2ZB4A 3UA3A 4UQLA 1LVUA 2XGGA 3FSRA 3H97A 3I3SR 4ZAYA 3H9JA 3AEXA 3B52X 1V71A 1U9ZA 2EL9A 5TQ2B 4AJOA 2GCPA 4MRRA 1VMEA 4RD6A 4MGKR 3CGGA 1U1IA 2ANBA 4JK3A 1RD4A 1QFSA 4NOKA 1QOQB 3PDCA 4IMJB 1WF3A 3QU5A 3X1JA 5CR9A 3ACCA 2G09A 3TVTA 4ZPJA 2PVPA 3ONWA 3MGCA 3MJSA 2DLNA 3CRMA 4REMA 5LNK1 3HRHA 3U4QB 2CXXA 2NVUB 4X1YA 5FB3A 1HYBA 4W5QA 5JZVA 1XF9A 1X3SA 4BO1A 3HDTA 4E11A 2E1PA 5KOHB 2A5FA 5J23A 3AY0A 4ND2A 3NT4A 4PV7A 2AX3A 1Y34E 1EVIA 3ANTA 1QP8A 2PX6A 2ZWAA 3AR3A 4X3PA 1L5NA 2V03A 4S0ZA 1X7YA 4U3JA 4UTOA 1J97A 3ZE8A 1R3DA 2Q6LA 1YIAA 3B3QA 3HUFA 4E33A 1GKIA 2GZMA 3N2YA 3L0DA 4OFZA 1E5TA 4PGAA 2QD4A 1E6KA 4AUNA 1LFDB 1VIDA 2DXIA 3K5WA 2L19A 1JAZA 4KO1S 1B0AA 2IUYA 1SXJC 1FSSA 2YNMC 1KF0A 3W9BA 4B7CA 3JVDA 3ZHVA 1MB9A 1RYZA 1ZGHA 3TTXA 2A2ZA 2XUZA 4M8LA 1P1BA 4ZCIA 1W1UA 3QU9A 3MMSA 3EVDA 3WGMA 3DVAB 1AQUA 2D74A 4X93A 4TXLA 3H2KA 4BO5A 2CXQA 3OLZA 3UMRA 1RYHA 1Y3CE 3Q2IA 1E9SA 2QRUA 3BYZA 4AX8A 3UMJA 3SF0A 3ONFA 3ZOZA 4F6RB 3DFKA 3OAAA 3K0CA 1YA6A 1N3IA 2P9ZA 4U2KA 4AJ2A 3QW4B 1B3BA 4BFTA 4JUIA 1LDYA 4M1WA 3UF0A 2HADA 3ICPA 5MN5A 3COJA 4KVAA 5CA1A 1JIVA 1WB4A 3DHNA 1KORA 3D2BA 3U17A 3URMA 3ISJA 4DIDA 2DSTA 1EVKA 1UMBB 2HA2A 5JO0A 3LT5A 3BGDA 4EW1A 4BNGA 1O97C 4XQGA 1AS0A 1Z6PA 3W5CA 3LVQE 2OBBA 2ZPAA 3INNA 3P96A 5LBTA 2CJPA 4XB2A 3WIOA 5FOTA 1QIGA 4H15A 1RLMA 3NWJA 5KB3A 2WWYA 5F2NA 5EJAA 4X8LA 3EIUA 4UHJA 3NNNA 4RVUA 4IJVA 2IV2X 4MV4A 3TZEA 3UW3A 2ZZMA 4RBNA 4XUEA 3OX4A 1CR2A 2QSUA 4ILKA 4G1MB 3W5AA 2G63A 4OQDA 1OLUA 4KREA 2MSNA 5KTNA 4D9CA 1Q0PA 1V3QE 2OC9A 1KKUA 4ZDWA 2XDYA 4BQQA 5KWSA 1UBFA 4YLEA 1TZBA 4EHHA 4NVRA 2CB9A 4S04A 5BV0A 4ND3A 4G0ZA 1BAPA 3PGXA 2ZBUA 3O9ZA 3Q3GE 3ZWKA 2HAEA 3KUDA 4FFDA 4MQFA 4YR9A 5IS2A 3CNLA 5BVGB 4IWNA 1WPRA 5AW0A 3K2QA 2P4HX 2R4QA 3OCVA 4PG6A 1W29A 2RI6A 4YAWA 2QUHA 1XOIA 2IW1A 3NEYA 2DAPA 3ESRA 3I28A 5ABPA 5ALPA 5JEDA 2TMYA 4DLZA 2JGNA 4XOUA 4U2GA 6Q21A 4KVZA 4KU4A 3A3YA 4YRSA 2HBZA 5HQ3A 1TZMA 5K0TA 2C78A 3RTDA 3K35A 1M0TA 4C2BA 1PQ4A 1JJAA 2C54A 2WJJA 3FAZA 1YZYA 4R9SA 4W7SA 4B3SB 2ZAGA 4HXFB 5CVJA 1PW5A 3CPEA 2PO7A 4RH1A 5KKCA 2PS1A 1K7XB 1SUWA 2J4CA 4UCXA 3LKZA 2ATEA 5AJUA 4FZJA 1V5WA 1C9EA 2P69A 2YXPX 3F71A 2ZTMA 4KR3A 3NNSA 2Q6VA 4XIYA 2JI4A 3D81A 2P79A 5CX1B 4NQRA 2HA5A 4MROA 3RIYA 3FOZA 1H85A 3WQRA 4TLLB 3DNPA 2E2WA 2OD9A 4WLFA 3DE7X 3K9GA 4LZNA 1FJ2A 3NCHA 1JLLA 4N6OA 4JN6B 3KE9A 4LAFA 1TUIA 2AR0A 2QP9X 5BSUA 2BI7A 1DELA 1JG6A 4Q1EA 1L7XA 2REXB 3FZYA 1YZ3A 3EGXA 3QYFA 3B6JA 3MA0A 2OO3A 1T5BA 2Q5HA 3PC6A 4QBKA 1GPKA 2YYYA 3OIYA 1AHNA 3WGNA 4BQEA 3A32A 5L7YA 3AVOA 1V16B 1JR3A 2JFOA 3ZIAD 3R0VA 3T0FA 4CMIA 2VG8A 1MJ5A 1TM4E 2DBRA 4E5VA 1EFRD 1XRMA 3EH1A 4Y2XA 3WA6A 1I7NA 3ED5A 4DLRA 2H92A 3T9DA 1DPGA 3U3DA 2WM2A 3G6KA 3DKVA 2QT0A 4ZU3A 4MIKA 4HDAA 1IMOA 4KJXA 4DQKA 3ROQA 2K5UA 3DZGA 3KG2A 5IBQA 3NGXA 4K6HA 1N8NA 4O4LF 4RE6A 3CKKA 1DDGA 3HLTA 4XQ0A 4GC5A 3MT9A 1YUNA 3K0FA 5H9VA 4PLGA 3S44A 4B6SA 2Q5OA 3VKFA 4CTMA 1YRAA 2OM2A 2NT3A 3GRVA 5CNMA 4ZT4A 4B85A 3ZCUA 2JIRA 1NBOA 4JOCA 4Y2TA 3S29A 1JHDA 4ES6A 1H2EA 2WJIA 4YP0A 1IEXA 3JRXA 4QIHA 2PUGA 2DU8A 2VDUE 4TZ0A 4DJFC 3GGDA 4YMSA 1BX0A 3N75A 2OV8A 3THRA 1Z33A 3PFFA 2XQKA 2YVQA 2WWIA 1RC8A 1X80B 2VXYA 4D8UA 5JFTA 1OFUX 3GRRA 2EIXA 4G4JA 1OE0A 1KFKB 3AOGA 5LB4A 3Q7QA 2IX3A 4BPBA 1KDPA 1YR7A 2ZUBA 1DIGA 3MOIA 4CF4A 3K9BA 4MS1A 5GPBA 3QI2A 3WJ2A 5KKAA 4A3SA 4BLUA 4M0KA 1DOHA 1F4PA 2VTVA 1KAQA 2GR9A 1XD9A 4WSOA 1JTEA 5B3KA 2BH9A 1RXEA 2PFSA 4O2RA 1EAYA 2ILVA 2RHLA 2PPLA 2X0RA 4HT3B 4OU5A 3M70A 4I4IA 2I6UA 4D81A 1PHPA 1W4AA 4JHXA 4O1HA 4PLVA 4X65B 3F5MA 1XA3A 4D6YA 1ANKA 1MN6A 2BFPA 5LDDC 5F98A 2FFQA 1A0OA 1QH9A 2DCUA 4J29A 3FVWA 4YJHB 1M5RA 1I2ZA 3HLKA 1GL3A 1FP6A 1JIUA 2DPMA 4A7PA 4GQIA 3RFXA 4BTVA 4OGFA 4YYZA 2B25A 2GFQA 3B6IA 5BSEA 4G07A 1YJXA 4U6QA 4CFZA 3KT0A 1KBQA 4QQRA 4CIBA 3SVZA 2PKWA 3FBGA 1Q91A 3L7MA 1QKIA 1RP7A 3SDSA 10MHA 2O2IA 1YS1X 5TXGA 4XGKA 3ROZA 1CZKA 2IZ6A 3RAJA 1MX1A 5DULA 3UV6A 1NQOA 4N39A 2FA9A 1O95D 3BMQB 3BXOA 3F6EX 3L0IB 3SEAA 3W2HA 3AF2A 4V38A 1LDBA 2RHDA 3CX4A 2R8XA 2WSMA 3A9RA 3E6AA 1IAQA 2R1TB 2XDAA 3QF4A 1W4RA 2XV1A 2W9XA 2ZI6A 3KQMA 1RTKA 2FPGB 5E8JA 4DIFA 1J5EB 3PWZA 2AZTA 4JI3B 1T1IA 4IHAA 4NMMA 4GKKB 3WLEA 1F8UA 4Z54A 1M1YE 4BX9A 1V2HE 2BFDB 1AKTA 3H17A 2J3IA 1D1TA 2O3UA 2B0CA 3JAKA 4KPGA 3EXHA 3HDVA 3ORRA 1XAHA 3UJ9A 2FR1A 2NZYA 4LIPD 4FFWA 1B76A 1N8KA 1TEVA 1Z15A 3HCRA 3D6HA 4NYIQ 3SKXA 2I2FA 2TECE 4DIKA 3B3GA 2WZQA 2OCLA 4KE8A 1XXLA 4KR0A 5TJ9A 1G2IA 4Z6KA 1YE5A 3RJ9A 2SKDA 2O0KA 2JEOA 4QG7A 3RVKA 1IHUA 1U3FA 3N2KB 1BC5A 1ATZA 1KI2A 4XRRA 3WB0A 1LLFA 4BVJA 4B2YA 3IPAA 1KZ9A 4JWTA 1R8QA 4DQLA 1HFJA 3KKLA 1FX0B 3I8SA 1EEXB 3S55A 1ZUD1 5IP5A 3X1ZA 1CEEA 1MVNA 4R1NA 3W3AH 3KUUA 4PNZA 5DN6A 1JMVA 1Y9JA 2IEYA 4LCJA 3ENVA 3STWA 1WVMA 2ZBQA 2C7BA 2FFRA 2CLLB 1XMIA 3FM9A 3UCXA 5LP6B 1Z38A 4B09A 1XQ1A 4F38A 3E9CA 1XTKA 2E85A 3GFVA 4ZIRA 1WCIB 2Q21A 1EJ0A 2WLTA 4NOJA 1Q0RA 5DASA 3A1DA 5DNVA 1I4EB 5IEBA 4MQBA 4F91B 3BE8A 3HYCA 1RJEA 1D8AA 2IH4A 3EK2A 4NEGA 1Y81A 1ZCBA 4IAOA 5ALOA 1Y33E 2VEDA 3TRIA 3EXFA 3HG7A 3T3PB 3AONB 4ZRMA 3T7SA 1K0FA 3SOPA 3V9PA 2R44A 4UE2A 3H6HA 1KH2A 3W1EA 4BNIA 5ALYA 2WG2A 4L7VA 2OXEA 1DKLA 4KJZA 3JD4A 4EQ6B 3O84A 4KGZA 1ZN8A 2REBA 3MB8A 1SBCA 3O92A 3T5MA 1DG1G 5JS8A 1CHNA 2VYCA 2G08A 5IUNC 4DLSA 1ZSYA 2GN2A 1UBEA 4JNKA 5D2CA 2ZJZA 1L5RA 4RPGA 4X91A 4CDMA 1JX6A 3BS4A 4KQEA 2H7XA 2WM8A 2ZQ5A 4H60A 2RK4A 3FJ1A 5JFGA 3KZOA 3WHIA 3G79A 1R6BX 2OBNA 1TA9A 5D5PA 2SHKA 3IPCA 1MJHA 1YB6A 3UHAA 4WN9B 4BB6A 1QRUA 2YMPA 1BFUA 1G16A 3BKWA 3IUSA 3QX8A 4Z1MA 5ALVA 1CUFA 2FK8A 3IIEA 1PL6A 3DUFA 3NBXX 2G9UA 4OMCA 4DIEA 9GPBA 3KCNA 1DEAA 1O5OA 2XCIA 3F3SA 3FMPB 1AV7A 3VX4A 4EAQA 4P4SA 2DQKA 4K03A 2BFEA 1E3WA 3JXEA 2C4VA 2QM8A 3GELA 1JKJB 4M1TA 3TOZA 3QV1A 5BUSA 1PZGA 2J5QA 2GASA 3VKVA 1DBIA 1L2TA 1MQSA 1U2QA 4N76A 4Q00A 1YR8A 3BA6A 3I62A 2OXCA 1UF9A 2JARA 5I8WA 4ALIA 5IYZB 2QAJA 3PUXA 4JROA 1A8PA 5C7LO 2UXCB 3Q8XB 1NNSA 2H8GA 1MDBA 2SKEA 5T4FA 2EKQA 3R6DA 1FP2A 5CT6A 4B6QA 4BAZA 2P4QA 5FUYA 1SWWA 2AOVA 3OU6A 4MVJG 3VO9A 5FOQA 2PD6A 1OH6A 3OPYI 4W9NC 1Y1SA 2DR3A 2J48A 1JA9A 4R9RA 3D4BA 2CCJA 2QQ0A 4DR1B 1O94C 1RQ2A 2A5GA 3UOAB 3IELA 2PBRA 5BVGA 5J58A 5EXDA 4UTRA 3PNBA 5AM1A 3CF6R 3VR5H 3HB9A 5F1PA 2OCAA 3EFBA 5D3MB 4M1YA 1CFJA 4EA6A 1Z5PA 4YYEA 1QONA 2YJGA 3TFOA 4K26A 1Z39A 2PWBA 2HDNB 1HPLA 1PG2A 4G56A 1W75A 4HLDA 3KT3A 3MQ2A 3E7FA 5ALKA 4CTJA 5IABA 2WT4A 2QGNA 1RMYA 3FHLA 3GLGB 4G1FA 1O0BA 3M5WA 5TMDA 1GTG1 1OC2A 1TAGA 2H65A 2YRWA 1EHIA 5B7NA 3S2UA 3AKZA 4MQEB 2H1SA 1V9SA 1GLNA 5HQTA 3LI2A 2HKIA 3W6UA 1E58A 2WV7A 4G86A 3GNTA 2NUPA 2PWYA 4BFXA 4YK7A 1OLXB 2JIPA 1Z5OA 3NYIA 4IJMA 4HY3A 1N77A 1XRNA 4DMHA 4PXSA 4H0FA 3Q7TA 3H2SA 4RK1A 4EW2A 1J0EA 3ZTYA 4MW0A 3EMVA 3ZHXA 3CRRA 3KB1A 3NKFA 3N76A 3T9BA 5CT4A 3QWIA 1EWVA 1NN0A 3RGWS 3EIFA 2IIQA 3ELYA 1TPYA 1PQUA 3PNSA 3HJHA 1XIVA 5AXDA 1TB4A 1OR8A 3P32A 4JQSA 2BEUB 5DCLA 1YKFA 5KSPA 3AI7A 2EJTA 4WW0A 3HR7A 3RSQA 2AC2A 3SG0A 4B4DA 5EZ6B 2Q1XA 2QTWB 1UINA 2WYHA 4BFVA 4QT0A 3CR3C 1MAWA 3REQB 3VH1A 3MC1A 2BFOA 3ZHSA 4Q1BA 2J59A 5J5AA 2J3MA 1J70A 4CV1A 3PJDA 2J3EA 1T34A 4DUPA 2DJIA 2PUDA 3EEIA 2O1EA 2Q3EA 1KXZA 3AFGA 2RI0A 3SM3A 2PUCA 2I54A 1DJNA 1A8HA 1OLOA 2V5UA 5AIBA 3WMFA 2Z6VA 2PZ8A 4B5LA 5HK8A 2ZATA 2ZRAA 4FCWA 2VPIA 1JQAA 4A1FA 4IIVA 1C3OB 1Y89A 4GRDA 4P7JA 4CIVA 1QU2A 4PGFA 4JLPA 2OQIA 4NEHB 1U2TA 1BMQA 1WUKS 4R5MA 2PIDA 4N4AA 1G3QA 2Q3MA 2B9EA 3PU6A 3LH5A 3UGTA 3QV2A 3P9ZA 3OJWA 2ZSBA 2CFRA 1GQYA 3C8UA 8LDHA 3L7NA 1V0JA 1GUYA 4Y30A 3W06A 1AGXA 4X1YB 4LHSA 2X19A 1X6VA 3HP7A 3PP8A 1YZGA 3TN7A 3WYEA 3D0KA 4R8MA 2Q8PA 4R16A 3ZDQA 5C4MA 2I9KA 4KZPA 5FI0B 3KXLA 2C7VA 4CUJA 2I2CA 1J33A 3IAEA 1X80A 1YC5A 3ZWNA 5EI5A 1DKMA 3L2OB 2VCYA 1Z7YA 3A31A 3MRSA 3ZLVA 4TYPA 3LLUA 4EHNA 4QUHA 3KPYA 3GJ0A 4QPDA 5KQLA 4F4CA 4Y9DA 5IYZF 3UAWA 3EC2A 1CULC 1FZQA 3H9UA 2NNLD 4G24A 1G3MA 1AE1A 2JFPA 2DCMA 2HQBA 3PUHA 1J5XA 1M0SA 1Q0UA 1S01A 1HF3A 1QAQA 5DCYA 5ELXA 1X13A 1C0KA 3ZXIA 1FMCA 4IQ4A 4MCHA 3TLCA 2FSPA 2JGJA 3A9SA 1I7DA 1TT7A 4K9DA 3R40A 4Y6RA 2MMGA 3P9QA 5F4BA 1A4IA 3L79A 3I2GA 5AOVA 5KNDH 3PQ2A 4FYHA 4NBUA 2FW6A 3OZXA 5LCXA 5IK2D 3MMXA 2AUTA 1U3GA 4OXKA 3H1AA 5EIFA 1PWYE 1S2MA 1YC2A 5EMJA 3TSZA 5H70A 2PYZA 2Q6OA 3HU5A 2H00A 4CI0B 1GZ4A 1ZWLA 1PYOA 1REQA 3GI1A 1LU9A 5HE8A 1EHYA 5H16A 3OQ1A 2ZG6A 1DIAA 2HBRA 4R2MA 1Z17A 4H7HA 1GZUA 2GZ1A 1NUPA 4HAYA 3UK7A 1SG0A 3KOWA 3W2IA 4ZO4A 2QRVB 3DEKA 3NRCA 3LPLA 2HXSA 2G5CA 4DY6A 3WRXA 2VHTA 3QUCA 3DVRX 2IWHA 3WBFA 3G2OA 4PPFA 1VSTA 2PX8A 1UK6A 1HSOA 3R5KA 4HMPA 4OSOA 5D1HA 1DZIA 2W2LA 3QEOA 4O4JA 1L4NA 2BDUA 4U7PB 2QD2A 5CFOA 2ZRCA 5DDIP 2Q46A 2VA9A 2FE4A 3S1AA 4A6EA 3AVWA 1U94A 5FYQA 2R6ZA 3PC2A 2D1YA 2ZZNA 1J22A 1SCKA 4IIJA 1NAIA 2Q2NA 1U4NA 3IX7A 1Z4KA 2QLNA 2B4QA 4TSFD 1L7VC 2WIAA 4C0XA 5IHXA 1EX7A 1JE0A 1K8XB 1YR1A 1N6LA 4FYXA 2AFRA 4HS4A 1FMFA 1UDCA 3RS5A 3N6VA 4DY4A 3A70A 1KIAA 3KTDA 5TQJA 1NRIA 4PS1A 4ZDIA 5B1DA 1DAIA 4CTKA 4D4JA 3OFSA 4OCZA 3QPCA 1XCMA 3RBZA 4LRQA 2Y6UA 2Q6KA 2L18A 2VI5A 2MYUA 3DDNA 3PPVA 4AUKA 3TTUA 4GRIA 4UREA 2H4YA 1WUJS 3RVBA 5DVZA 2PAFA 4O5AA 1QAMA 2MR6A 3AXTA 1G8KA 1ZVJA 3KKOA 3ZD8A 5CDYA 2O6LA 3C5WP 3KJEA 5HKKD 3ROGA 1WCV1 3KOUA 2MSEB 4FC6A 4YCMA 1YS6A 3ZDYB 1YDWA 4B33A 1TTQB 2YOGA 1SKAA 1L4HA 3LLCA 2K2QB 4R01A 5JATA 4L4UA 4MCAA 5D01A 3RK1A 3SZLA 2BLNA 2WTMA 4KAJA 2ETXA 2IRWA 5I3ZA 1FBNA 3RBVA 4ZQFA 3PUKA 4BNDB 1DUVG 3LBFA 4KXNA 5JJCA 3B85A 3VH2A 1RM3A 4L4YA 3EQ9A 3HY4A 3BHNA 3WMRA 2A8YA 2IXAA 4X0EA 3DO6A 4L5BA 1AOXA 1GPJA 2QY9A 2V6IA 2GEJA 4LZLA 2L69A 4BO3A 1E1NA 2R84A 1E79D 4R6XA 5IAJA 3D4IA 4ZP1A 4DEVA 1PR2A 3ZS8A 3CUYA 4QECA 1H1DA 2PGJA 3HA2A 1LJUA 3KD3A 3QPUA 4W1QA 5AHOA 3NLLA 2FSGA 1ORTA 3ASUA 4RPJA 4PSCA 4NYMQ 3WISA 3DOOA 1KPIA 3MNFA 5JROA 1Z75A 2C4TA 5BR4A 1YMUA 1NVTA 1RT9A 2XI4A 2Y1EA 1AKEA 1QE5A 2GD0A 4UBKA 1F60A 2NUTA 4DBVO 4D4GA 3VR1A 4NCAA 1QYDA 3KLOA 2NU9B 5CLGA 1WE2A 1KVTA 1CY1A 1QGYA 2CFTA 1DV2A 5KMGB 1L5YA 1FDVA 2PKQO 3REOA 4CLOA 2JDIA 4LOAA 5IYZA 4KB5A 2VJAA 2DBYA 4AYTA 3GZ4A 5E6RA 3PVZA 1VGRA 1UWCA 2WAYA 3U3MA 2EFHB 1L3IA 2YV5A 3JWHA 3QU4A 3QVOA 2IKQA 2PEYA 5DGHA 4R1LA 3VMMA 3HU3A 2VYQA 3VU3A 5KVSA 5ALFA 1R5BA 2Q5LA 3I32A 5HUQA 1KI1A 3TMYA 1W0KD 4L6CA 1MQ9A 1NQXA 2O8VA 5IM4F 3VKHA 1GPDG 5FKJA 1ZNWA 2Z6UA 2WZCA 4L2IB 1YZKA 1Y5LA 3HZOA 3RIMA 2X1HA 2Y1LA 5BOVA 5J2TB 2W42A 4AWBA 2AFIA 4HEA1 2JAUA 3DSRA 3T3DA 1KJZA 1J2TA 1H6DA 1MB0A 3JU3A 4MR7B 3GFFA 5BVHB 1PVVA 2CUTA 1FEZA 1B00A 1K5HA 2A9KA 3L6CA 2HX1A 3JZAA 5JDIA 1Y6GA 2N42A 1CV2A 3EUAA 1XPJA 2DH6A 2ORED 1JG1A 1KEWA 4H7PA 5I9SA 1P0FA 1TLTA 1PUJA 2QD3A 4EPTA 5C51B 2LZ0A 4CEHA 4V0SA 4R6WA 1YOBA 4XVRA 2HA0A 4Q1FA 5BP7A 5SY4A 4R2XA 1T3HA 4TKZA 3PQ5A 1G59A 2Z1NA 4OAOA 4ZCTA 2C97A 3GDOA 1U0OC 1SN7A 4FPXA 2WKPA 3SEFA 2GM4A 4J43A 1W6UA 2NXEA 4AG3A 1ZRMA 2EX0A 4NNOA 1HGXA 2OBLA 2OV2A 1OBCA 2HCFA 3NOOA 5D6NA 1KYVA 1TKBA 4RIEA 4A10A 3VU8A 2I80A 3AESB 2IYQA 4J0IA 2E18A 4QUDA 2AK3A 5HZHA 1P62B 2ONJA 3OLYA 3EZGA 1KSJA 4N5DA 4PHGA 4EDFA 3A27A 3ZVKA 1KHTA 5G53C 4R1TA 5GY7A 2ZYRA 3W9UA 1CRLA 4J0CA 3UQZA 1SXJD 2CE2X 3W9SA 4L4ZA 4DSOA 3BIOA 2AMJA 1GNSA 4MVJD 1L9XA 1GYQA 4ROTA 5T67A 1F0YA 4NCKA 3RSSA 5CXQA 1FSGA 1GSOA 1P18A 1XDSA 4C7VA 4DANA 3BK2A 3DMPA 3HUDA 5ERXA 1PE0A 5FLEX 3LDFA 4CCYA 2A57A 1NVVR 3O9VA 1J8FA 3T0GA 1TOAA 1V48A 1JHMA 2VAVA 4Q6WA 1BGVA 1KZ6A 5IJ9B 1JUDA 3K70C 2VSXA 2YVKA 2C5GA 3DGFC 2GDZA 2PLFA 4TOIA 4U2EA 2AFHE 1CUAA 3MGKA 3QVUA 4XDGA 4ESOA 1MHTA 3OECA 2BPOA 4FFLA 1G21A 4DA6A 3GEHA 4MLPA 2PR2A 1M67A 1PG0A 3LOUA 1GA1A 4IJ5A 4OJQA 1N6HA 4FILA 3C6BA 4A73A 4J0HA 1PZHA 3AKCA 2CJFA 3LVRE 3ERCA 2DSNA 5LZ9A 2AEMA 3C48A 2HLHA 4AK9A 1UC9A 5BN4B 3QHAA 1XCLA 1EJBA 3LRXA 3QJYA 4OPMA 2I3ZA 2J5RA 2NXCA 4U00A 5CK5A 4B3BA 4JKOA 3O8BA 5FWXA 1LBQA 4EO7A 4JYZA 2VZLA 3DAOA 4PO1A 4DLBA 4JL8A 3EEYA 2CMGA 2PZFA 3K6JA 3H65A 5DK4A 3U37A 5AKKA 3SHQA 1H9CA 2AG1A 1KGSA 1JIKA 2C4MA 3QMWA 3UAYA 3L93A 4IUCS 4FWBA 1VJ1A 2D1TA 3DEAA 3DMRA 4G85A 4JSTA 4OHWA 4KNYA 3NWEA 2KBEA 2DTXA 2J85A 3V4RA 4BNZA 4PLYA 4BLRA 4ETNA 2Q9AA 4RPLA 1IQPA 1YZQA 4DCVA 5KTMA 2QROA 4L76A 5T3UA 2AF3C 2AC4A 3JQDA 4JFRA 2VP0A 2Z8YM 3KFXA 1QCCA 1T6BY 3RODA 1UQUA 3TOCA 1UPCA 4MO2A 1FNBA 1BEUB 2HXYA 2HYDA 4Y9SA 4TUYA 4ZHQB 1CJCA 4BTEA 3HA7A 3WOHA 4AP6A 1HFEL 3DE4X 4YT5A 4E5UA 2XMBA 5HFAA 4B3HA 4O0LA 1YK1A 1C8KA 5AKLA 1HQDA 2HRQA 2R96A 2OQ2A 2V0GA 3NVDA 1RMQA 4KQ1A 3U7EB 1KO4A 1N5JA 3RAGA 4L3OA 5LC1A 4B81A 4M36A 2FWBA 2WG0A 3OBIA 2X8LA 4P1ZA 4OJNA 2PSEA 1EB9A 4L72A 3BZUA 1NW6A 2DKFA 3TE7A 1HE4A 1K8QA 4GOJA 3HO6A 2WU3A 2Q4OA 4QE3A 3NHKA 1GZ3A 4I08A 4KKXB 4O4HB 4AP5A 4DJTA 221PA 3FVVA 3ER9A 1CCWA 4UUAA 1N7GA 3VO8A 2NXWA 2IY7A 1XQVA 3LPCA 2H63A 1P5ZB 2X0EA 1ID1A 1PS8A 2FZKA 4JSRA 4R71A 4U7DA 4CF7A 2HIAA 4FS3A 5ICGA 5AKXA 2CXPA 2NZUG 4DARA 3ZI7A 1G20E 3IHKA 3IQGX 3GVCA 4E88A 3K5PA 4H7DA 4PYOA 4ND8B 2OYCA 5JECA 4UE6A 4I1SA 3L7LA 1OKKD 4L9AA 4H1UA 1EK0A 5FOSA 1YA8A 4EVIA 2XB6A 1AQLA 3H2JA 1BOOA 2ZXEA 4Q16A 1P7WA 3PXBA 5DF1A 1SOVA 1FS5A 2QD5A 1F12A 1RBYA 1SURA 3NC1C 4LNUA 2WWHA 1MXHA 4AF8A 3R9XA 1XTZA 3CTMA 3QH4A 1Z8NA 1B2LA 4FE3A 4KBGA 2PM8A 3LY5A 4TQ9A 5DB4A 3AHFA 3WGZA 1TYAE 3U5ZB 3DLBA 3GEPA 3A1CA 1F8YA 5BR1A 1TCVA 1USIA 1XU7A 4N65A 3NWBA 3H86A 4YRJA 2AQ8A 2PJZA 5CDUA 4UM5A 3ILSA 1K06A 3T3IA 1ACLA 3ZGOA 2NTEA 5IJ0B 1P1IA 4WLVA 1DJOA 1MJNA 1MEJA 1Q6YA 1T2VA 3SMQA 4E94A 2WVHA 4Y2UA 1MIHA 2C58A 3LP6A 2JBAA 2VP2A 2D2FA 3LIPA 2JJ1D 1NA5A 2GZ3A 4MQEA 4DZZA 1A9PA 2VK4A 2X23A 2G9NA 2IU0A 1MJFA 3I12A 5KYYB 2C83A 1JLRA 1ZJ6A 2PBZA 1SR8A 2AFHB 4L8FA 4P38A 4ARZB 2UUCB 4ZV9A 2B2NA 3F90A 3ZWVA 2C5LA 4QYTA 4V1CI 3VNVA 4X71A 1LA2A 4YCBA 3CNOA 3KEMA 1BXRB 1EWRA 3SSNA 3STVA 1URPA 4D56A 2HW8A 4OLAA 1DJQA 2ZAMA 4U7JA 3QK7A 2FW0A 4OQFA 5LMNB 2FSUA 4O3MA 1CVRA 1IWBB 1Z56C 2GTHA 3CWQA 3WOVA 1K7CA 3PFWO 4ZZIA 2FPXA 3QMVA 5F3DA 4QRHA 4G5XA 2YHIA 1NSFA 2C82A 1X87A 1L5HA 4F3YA 1GZDA 1I32A 1QORA 1GM5A 2IHJA 4IS2A 2QLBA 1FYFA 3ANXA 4WADA 3M2PA 3KU1A 2OOSA 3WGUA 4D98A 4EO4A 1OI3A 3N0RA 2IYZA 2B5VA 1QO0A 3DTTA 4BMCA 1H0HA 1OBFO 3WNCA 2WAOA 2FPRA 4FSDA 2DHEA 2VPQA 3OF2A 2QJWA 5FBHA 1R37A 4O4LA 1ISFA 4N41A 4XFKA 2ET6A 3SVLA 4Q3EA 3RRZA 1E9CA 1E9VA 2J6BA 4GOND 1LPAB 5AKIA 5ERYA 3U7JA 4B71A 3HTXA 5IX8A 3LNCA 4UU1A 5FXMA 3V55A 5KOIA 4DCCA 2OFWA 1OB5A 4PU0A 2IBMA 3N6RA 2PNFA 2ZBFA 1KTVA 5K0ZA 3CZQA 2F67A 2GVZC 3IBYA 1OTHA 4YJGB 3DKIA 2QAGB 4IL5A 4JI8B 1J8MF 5JRZA 1FK8A 3F47A 5ALWA 1BKDR 2FGJA 5IPFA 3MINA 4ZPXA 1X1EA 3BX1A 2HK7A 3IOCA 4AZ3A 2PRZA 4P3NA 4RO0A 3RU7A 2XGOA 5CH3A 2QVZX 5THKA 4DR4B 3QKSA 5DM0A 2HBQA 1LGYA 2COEA 2YMQA 4RHTA 1QYCA 1GPWB 4WV3A 3VZSA 1V7QA 1O94D 2B35A 1GTJ1 1ULUA 4G9GA 4NPHA 2Q8NA 1IU9A 4TUYF 4O2AB 1P5FA 3C0KA 4YXFA 1UXIA 1JN0A 4K6KA 1AUQA 4UHFA 2WK1A 4KPYA 1ADBA 4RKWA 2ZQYA 1GD1O 2Y0EA 4NV1A 3EARA 1CX9B 3GAZA 2GD2A 4WJLA 3GVXA 1OA0A 2CNWA 3DNFA 4JX8A 3ETJA 3N2LA 1L7OA 1WXGA 4F84A 1R0WA 2HJSA 2XRZA 5ICFA 1E1CA 3OIGA 2PUFA 5A3VA 2B36A 3OJFA 2AOWA 1WA5A 3RYFB 1FXWA 4Z9BA 4D42A 5JYCA 3BWVA 5JYBA 4RGBA 5FA8A 3VYTB 3W5DA 2OY0A 4GVXA 1RWXA 2XHZA 1SC4A 2ZTLA 3MBKA 5DW3A 2QVXX 1KTIA 1J1UA 2GYYA 5CT5A 5ALHA 2R6JA 3A2MA 1ARZA 1Q14A 2XVZA 2DOKA 5LZ8A 3RFCA 2FU5C 2F9FA 1HEIA 2J87A 3MMPA 1D2HA 1LK7A 1XMXA 2QNRA 2A1UA 3PSAA 4M7RA 5DGTA 5EKDA 5FNVB 5K45A 5K01A 2WTUA 4WK0B 2H9YA 3BL8A 1GQFA 4LX8A 2W2VA 4EM6A 5JPCA 5TEWA 1I8TA 3EXHC 3O8QB 4Y2RA 5AOBA 2J3DA 4DLLA 4EDHA 1T4DA 2NP7A 4PAGA 4FM9A 4DMKA 3FMGA 3OY2A 5CUQA 3O5AA 3DDUA 1NZDA 4XQ9A 3LYAA 3IE2A 1J42A 1ULZA 2RG1A 1Q17A 3D7SA 3G2KA 2JI7A 4L8YA 2JPDA 5JT1A 1KY3A 2A0FA 3VSBA 3ZNQA 2IPOA 4I9GA 2X77A 4LY0A 3EZ9A 5HRCA 2JHPA 4K9RA 1F0KA 4ED9A 2YVAA 3FZQA 2AMLA 2GJ8A 1CF9A 1NONA 3UG7A 1GRCA 3ZWPA 2AOTB 1NQWA 1FMTA 2J4DA 2Z09A 4X85A 3UHOA 1RYBA 5CVUA 1YI8A 2NSHA 3L82B 3TLYA 4BNYA 4DLNA 3AY3A 4Q7EA 521PA 2ODTX 4TSKA 3RBAA 1EJ2A 2WD8A 4ZVRA 2FPMA 3RUIA 4Z4GA 4DRZA 4TZ6A 2A9QA 5EL0A 2DMRA 3S1AB 1NNUA 5IJXA 1J0DA 3UIEA 3M34A 5SV2A 1ZIDA 2Z5LA 3JR3A 4MMXB 4MP3A 1M6VA 3GQVA 2JZCA 3P5SA 1Z82A 1PU2A 3LXMA 1SZJG 3DBRB 5HMMA 2GD1O 1I2AA 4GYWA 1D6JA 2ZOSA 5CLHA 1W35A 4E07A 2EP7A 3CUUA 3SI7A 4EJ0A 2NP6A 1E3MA 1QLWA 2I3BA 2VYFA 4B6EA 2UZ4A 4MW7A 1P4GA 3R1IA 1FSPA 5YASA 1J9GA 2OAP1 2YHUA 3ZZMA 2PX0A 2QENA 4IP0A 2FZVA 1Z6TA 2HMYB 3Q41A 4JGBA 3QOYA 4JDPA 4Q3KA 3IT3A 1KZ7B 4UVHA 5GIPE 5J4HA 1BJKA 4R84A 3STHA 5EWLB 3ZXSA 4PPYA 4EJMA 3BT7A 2J9FB 4LK3A 2BSQA 4LY9A 1EX1A 4Y0NA 3QXGA 1VPLA 5AJTA 5A4JA 3U4QA 1RKQA 2V6BA 4QUGA 2Q5QA 4E08A 5DM2A 2GNPA 1I4WA 2G0TA 3VZBA 4EPXA 1L5FA 3OQPA 4W5WA 5KX5B 5K05A 1M2VA 3LPAA 4YLGA 2GLTA 2Q50A 4BB0A 4ID9A 4F9FA 1UWLA 3K0SA 5CDFA 5TJHA 5B6JA 4R2JA 3F8SA 1HE2A 2Z8YA 1X7YB 3HFSA 4V03A 1UC4B 2CLKB 3GT3A 3SP1A 3ZIUA 5MFPA 2PV0A 4OQNA 1D2MA 2GK3A 4L9RA 3OSZA 1PGNA 4MXDA 1U8UA 3R7FA 4AY5A 4Z4IA 3DFFA 1W0JD 4YMLA 2YCLA 2LRHA 3RV4A 2A1TS 1FB5A 3IVCA 2NG1A 4RHCA 5HKBA 1UBCA 1CS4C 4Q1DA 6AT1A 2RONA 2YV1A 1NASA 3NEPX 4G5HA 1F8FA 4TRRA 5ENZA 1XLTA 1L4LA 3GBVA 3VBCA 1HBJA 1TC2A 2B61A 2EKPA 4N9QA 3QGMA 2ZR7A 3SXJA 4CFSA 1UK7A 2O8EA 2DWUA 4LXYA 4JUAA 4YP1A 4ZKEA 1I7PA 4GR4A 3MSCA 3DMTC 1X1SA 2IXTA 1ZY2A 4M76B 3VYUB 2EZ8A 1I0IA 3SR0A 4NOLA 1WW3A 4C1BA 5DNYB 3WMEA 4HBGA 2CFSA 1CP2A 2A7QA 2G9QA 2ZWVA 1SCBA 4P98A 5U1PA 2ZYUX 3TO5A 5EKXA 1H2BA 1XNHA 4M0CA 4OBBA 2Y93A 4ZEOA 1Y1PA 3CW8X 4INPA 4BNHA 4KMMA 1ICIA 3OZRA 5DKFA 4L22A 4XWOA 4OI0A 2UXDB 3T8YA 3WIDA 3GCZA 3H2GA 2C84A 4AS3A 3D3NA 4NENB 2ZRDA 4JR1A 4ER6A 3NV7A 3I2FA 3NV9A 1NWCA 1DUSA 4AYWA 1OPXA 3REFA 4OHPA 4JP5A 2QTTA 5HCUA 5J4KA 2FP4B 2Q3DA 4GMHA 1EM8B 3VNAA 3ABSB 1DC5A 1WSDA 2GT1A 4BDSA 1EDBA 2HNAA 4DLVA 4GGPA 4ACBA 4AG6A 3NDBB 2DR0A 4US1R 3S81A 3H1TA 1JLSA 1P1HA 3L7CA 1U28A 3GCWA 1H4SA 2ASEA 4JB3A 2ODNA 1QG4A 4EPVA 4CKZA 5EHNA 2NUBA 4OKNA 1NOIA 3T9AA 1LBHA 4HWTA 1IEVA 1NATA 2WNIA 2W22A 1RLOA 4OXIA 1HH4A 4TV8F 5KYWA 3PR1A 3PQ6A 5CGZA 5EINA 4UCWA 4ZEVA 4FLMA 1RPNA 3EVZA 3GLRA 2QBYA 1T5LA 4M21A 2R4TA 2PYDA 4Q4CA 3M9LA 1PWXA 5J5VA 1HDGO 3O90A 3GDFA 4ZGGA 1JSLA 4OSPA 3RSCA 5D84A 1U2SA 2ECFA 5AK6A 2AJ8A 4RSHA 1QCZA 3OPYA 1RIFA 3L77A 4LDJA 5H82A 4V1CA 5HWSA 2P6PA 3D1VA 2PEZA 3K5IA 3P2YA 4B7ZA 5I9IA 3L84A 4PPQA 3Q9SA 3WAGA 5B3LA 3IMEA 1GTMA 1DE0A 1P33A 2WHYA 3F7OA 3I45A 3OCZA 4X8HA 1T6NA 4AIIA 4IF4A 4MJ7A 1KH1A 1IOLA 1GVNB 3ELDA 2PSSA 1YDEA 1XTSA 4IIHA 5A7FA 1P1RA 2W6OA 2ZULA 4X41A 1HE3A 3HNOA 4JJEA 4GE0A 1QIEA 4R54A 5CBKA 1AS2A 3M5CA 4WERA 4F45A 5BW4A 2ZRLA 2GESA 3PUIA 5KEIA 2EARA 3BPSA 5FDFA 1Y8AA 3IBTA 1KE1A 2GAOA 4HPXB 4G0QA 4HZIA 4KGXA 4PQEA 1YS9A 3TPZA 1JU4A 4IHJB 1NRJB 3UVEA 5TE9A 2X0KA 3MERA 1E9AA 3EMBA 3D2LA 2MSCB 1TO2E 3ZU6A 3S2GA 3BB3A 2F4VB 2P0AA 4IGIA 3ZLJA 1IUPA 1DCFA 2XB2A 5F7XA 2PUHA 3SVTA 1BX1A 2A88A 1VRCA 1R3UA 4MV9A 1W4LA 4ALJA 1JSRA 2FJPA 1M2NA 4MUXA 4X7MA 4B47A 2B4YA 2FW9A 1VSQA 3O26A 4ZTUB 4XWYA 4UOEA 4FXOA 2ZE5A 1J1IA 2FPLA 3JWIA 1W2GA 1WY7A 1ZH6A 3CUWA 3ECCA 3GPIA 13PKA 4BIIA 3T41A 4NH0A 3JWPA 1DBWA 4QG3A 1TA0A 4DMGA 1Q83A 5CLQA 1DMSA 2ZJ7A 3NVAA 3DBLA 5G1PA 4JQOA 5HTKA 4KQWA 2FXIA 1QYVA 3TR5A 3TQCA 5T57A 3TRJA 1GL9B 5D3KA 3WB9A 4OH1A 3CRW1 3L7JA 1QU3A 1ZWKA 4D9IA 2PZBA 3QFSA 1IC6A 4HZUB 2QE7A 5LXTA 3ZYZA 4ZCRA 3E9RA 3I6ZA 2XNDA 4AWXA 2AYZA 5TF0A 3DOFA 5HILA 3KVNA 3PX7A 1JEDA 3DMFA 2A9OA 5DLDA 4WLNA 3EIHA 5T6MA 4AL4A 1DV1A 1HDRA 1PSZA 3OZWA 5ALZA 2C94A 4R7ZA 1BXZA 1MXFA 2BKXA 1GT91 2P9FA 3Q11A 4YDHB 3W8DA 5AHXA 4PLFA 2ZSHA 4RVCA 4TWAA 2D4HA 4ZHQA 3ZU4A 2CXNA 5C1DA 3FGZA 4UHDA 3W77A 3RYFA 1KJQA 5EJGA 1NXWA 3SJCA 5GWXA 1QHHB 2QTVB 2ZGVA 4TL8A 4ZI7F 3U0VA 3PZRA 2C61A 1ZZGA 1JMYA 4B76A 2CL6X 1NW3A 1QCDA 3A1TA 4JL5A 4CLXA 5EA2A 2JIOA 5TRTA 2Q5JA 3EDRA 2RKWA 1SD2A 5JFOA 2C2BA 2FRXA 3EZNA 1EGAA 2VEOA 2IUUA 2W8ZA 4IIYA 2GKGA 2OORC 3QTTA 4GI3A 2QTRA 4NESA 4O4JF 2N9UA 1W6RA 1YUMA 3GMTA 3NC4A 2H1IA 4QU5A 1N5OX 2CXTA 3IHWA 3P7MA 3TK1A 3NASA 4C6TA 3AGPA 5FUXA 3RR2A 3L92A 3N0XA 1EBBA 4I3GA 1PK9A 1RRGA 2ZIXA 3AFHA 3KP1A 1J8QA 3DWIA 3KM0A 2HWWA 3LYUA 3LOPA 2NZJA 4QVGA 4B46A 4BZZA 4EZEA 5ETJA 2IS4A 3CUVA 3RFVA 1FU8A 1N1DA 4MVWA 3VR4H 3HQ4O 2D2EA 2QZ4A 3ROMA 3W5SA 1BMTA 4NLLA 1KDOA 3DVAA 3COVA 1NLZA 1IK6A 4KXMA 6YASA 4Z0NA 1XQ9A 3BXHA 3EC1A 3HB0A 3C3XA 3WGOA 3ESYA 1SO8A 4F3NA 1J4AA 2V7BA 1TIKA 2CDCA 2YQ4A 3ELUA 4QXPA 1RXCA 3SSAA 4D9HA 2J7PA 4XVUA 4Y7DA 2VP3A 1M6VB 3HXTA 8GPBA 3C7TA 1A1SA 5K3CA 2OCYC 2OCDA 2ZWIA 3UGQA 4BQOA 1C81A 3B78A 1AY0A 3FWZA 3VFDA 1DLIA