1ICEA

Structure and mechanism of interleukin-1beta converting enzyme
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
167
structure length
167
Chain Sequence
b'GNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-1 BETA CONVERTING ENZYME
publication title Structure and mechanism of interleukin-1 beta converting enzyme.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 167
sequence length 167
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1994-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iceA00
1PAUA 1KMCA 2H48A 2CNOA 2CDRA 4JR0A 3S8EA 1F1JA 1NW9B 3IBCA 1NMSA 4JR1A 5IASA 4JR2A 1BMQA 3H13A 4QU5A 1GQFA 2HBRA 2J30A 4JJ7A 3GJSA 3ITNA 1RHQA 5I9TA 4NBNA 4QU8A 4HVAA 2CJXA 3GJQA 4FEAA 3S70A 2C1EA 3NS7A 3R7BA 4D3YA 5IAKA 1RHMA 5IANA 2CNNA 4AW9A 1CVRA 4N6OA 3BIJA 4QTYA 3EDRA 1RWVA 3QNWA 4EHHA 3H1PA 4QUBA 2Y1LA 4ZVOA 3OD5A 3PD0A 5LUAA 2H5IA 4QUGA 3P4UA 3GJRA 1IBCA 2QLBA 1I51A 3KJFA 4ZVRA 3SIPA 3R6LA 5LUBA 5IC4A 5IC6A 2CJYA 5K20A 3R5JA 3DEKA 3K7EA 4LSZA 1RWXA 3R7NA 1I4OA 1M72A 5LU9A 3KJQA 5IAGA 2FUNB 4NOJA 2FQQA 3P45A 4QUJA 2Y0BA 1F9EA 1K86A 2P2CA 1SC4A 3V55A 4EHDA 2CNKA 1QTNA 3SIRA 3R6GA 1GFWA 1NMEA 4QUEA 1RWKA 2XZDA 4NBLA 4QUAA 5H0IA 3PCXA 4FGUA 2J33A 4N5DA 4JB8A 5IBPA 2H5JA 1I3OA 4D3ZA 2J32A 2K7ZA 4DCOA 5LU8A 1JXQA 4FXOA 4NOMA 3V4OA 4QUHA 5IARA 5JFTA 1RWOA 4EHAA 4JJ8A 4ZVTA 3PD1A 4EHLA 3V6LA 1SHLA 3UOAB 4QUDA 4QTXA 4I1PA 3H11A 4IYRA 2H65A 3UO8B 3DEHA 3DEJA 2QL9A 1I4EB 2XZTA 4QU0A 5IAJA 3R5KA 2AR9A 3V4LA 3DEIA 1RWWA 2C2KA 5I9BA 4D3XA 1PYOA 2QLJA 5IBRA 3KJNA 4NBKA 4ZVPA 2H54A 4EJFA 5IBCA 2C2ZA 2XYGA 4NOKA 1RE1A 4JQYA 2HBQA 4HQ0A 2HBZA 4N7MA 4N6GA 2CNLA 1CP3A 4ZVUA 4HQRA 3H11B 2FP3A 2C2OA 1QX3A 4IEFB 2QL5A 3EDQA 2XYHA 3V3KA 2HBYA 4N6NA 2DKOA 4DCPA 2XYPA 4PS0A 1RHJA 1NMQA 3IBFA 1SC1A 1SHJA 4EHKA 3R7SA 4DCJA 3V6MA 2C2MA 4ZVQA 5IABA 2H4YA 1RWPA 3NKFA 1RHKA 1RWMA 2H51A 3NR2A 3D6HA 4FDLA 4AWBA 4JQZA 4PRYA 3E4CA 2J31A 4JJEA 4N7JA 4NOLA 3RJMA 1RWNA 2H4WA 1QDUA 1SC3A 4EHNA 1K88A 2QL7A 1ICEA 3GJTA 4QULA 4AWAA 1RHUA 4I1RA 3D6FA 5IAEA 1RHRA 3D6MA 3H0EA 4PS1A 4M9RA 4QUIA 4ZVSA 4PRZA 4EHFA 2NN3C 2WDPA 2QLFA 4QU9A
chains in the Genus database with same CATH superfamily
2I3ZA 4TT3A 2F9MA 5CP8A 3ZJTA 1KOGA 2X3YA 4YY3B 4CLOB 2PH7A 1YIAA 4I55B 1XKLA 4OXRA 1PNQA 2I4TA 3NDIA 3ANNA 1P7CA 3HDVA 3NM5A 3EVAA 4G8CA 4KH0A 2V4UA 1Z0FA 1F6BA 4IQ4A 3REQA 3WGQA 1LLFA 4Y9RA 1D2CA 5CB4B 3UBTA 1VPWA 4RVCA 4TXMA 3VR2A 1NAHA 4ZT3A 3WQBA 4JC4A 4WQMA 4S1NA 3HO6A 2BBTA 4REQB 3RC9A 2CDBA 2QRVA 4C6RA 3BFVA 1C3OA 2Q6OA 5IUNC 3G2OA 5C37A 1M73E 5M34A 2WJ4A 4PRLA 2C0QA 5IVHA 1KHTA 1RLUA 3FCXA 2A67A 3EZXA 3NHFA 3KJFA 2HK6A 3GJ7A 3K9WA 2PRYA 1IOVA 3GWGA 3TVYA 3ZE8A 2GUGA 5EKTA 3S2YA 1RFGE 1SOAA 2J7KA 2DBYA 4WVFA 1AHIA 2V1XA 1X3SA 5A4DA 4H16A 3BIXA 1J8FA 1DC4A 4LC1A 3PQ7A 3ILYA 4F5EA 2ZRCA 3FPBA 4HAIA 4LSWA 4MKGA 3FLBA 5DX0A 3K0CC 4GU5A 3S5JA 3A32A 4JGBA 4GEGA 3A8TA 3THXA 2V7TA 2VJMB 1TRHA 4Q4CA 2GBPA 2ZZNA 4NBTA 4K3VA 1QG4A 2A0KA 3O4VA 1YA6A 1L8OA 2Z3ZA 4OQPA 4BAZA 2O50A 1W0JD 2PS9A 4YJHB 4B17A 2EW2A 3IB6A 4ERXA 3L4EA 1ZCBA 3OCJA 2IUEA 3AVQA 3KS9A 4JB0A 4K2AA 3EVFA 3FPEA 2OBYA 2W6ZA 3DYVA 3JAKA 4OSEA 3GLHA 3WYEA 4ZANA 3DEJA 1KZ1A 4HR7A 5KKCA 2OFXA 4NRDA 4QOSA 4KO1S 1QH1B 1NI4A 3O38A 4M53A 4XB1A 3EISA 4ME6A 3UGTA 4CKYA 4C7VA 2A9QA 2Q4OA 4BP1A 1Z35A 4FW9A 3HN6A 1ESDA 5EINA 2HREA 1DEKA 2Q3CA 2CT8A 5DRYA 4X8MA 2GZMA 2HSJA 2PZBA 2RFLA 5EUMA 3P2OA 3IKJA 5CFRA 2VOEA 4BATA 5IJ0A 1VXOA 4I6GA 1LSJA 2YUIA 4CMIB 3A4LA 8AT1A 1QR6A 2VNAA 2R7AA 4PSUA 3X2EA 2Y0CA 5BMVB 1VB5A 4M36A 4F3CA 3IEVA 2DWPA 1YD7A 3QKTA 4IQ8A 4KOEC 1PV1A 4EJ2A 2G83A 1V48A 4HDKA 3V6MA 3ZI7A 3I2HA 4QFMA 1QHNA 4R68A 4LWOA 4MRRA 1W44A 3F67A 3NNDA 3E8XA 4J2HA 1Q91A 1D03A 1RRMA 3OFSA 5AI6A 4EW1A 2XBMA 3ZGYA 2O19A 3BJIC 2KMLA 2H4FA 2OXCA 3CSSA 3P0RA 3C14C 3GCXA 3UUWA 3KFLA 2C78A 1I01A 1MRZA 3S28A 4CV0A 1O77A 3WGLA 2OTCA 3TPZA 1TAHA 1BOFA 2H17A 3GRZA 2Y1OA 4PICA 4F06A 4CIYA 3IR6A 3OQ6A 5FPPA 1EFKA 1QC5B 3R7FA 2RARA 2P6OA 2VDPB 4PLZA 5GOTA 3EAQA 3TZLA 1VLJA 2G40A 3R24A 4R8LA 3VVMA 3BSYA 3RBXA 1TCUA 2CXNA 2BFWA 2H2DA 2PQ0A 3M4XA 1JFFB 5ECYA 4FJ2A 4L5IA 2VNHA 1UPCA 2BGLA 2JDIA 3AW8A 3JQ9A 4J16A 4Q6WA 5GAJA 1KO5A 3X1WA 5KO2A 1GLVA 3WBKA 4R8VA 1XWIA 1JIUA 1FDOA 3ZCUA 3KHKA 3QLVC 3U44B 2E82A 1Q11A 2ZQ5A 2IOFK 3MUNA 4C4ZA 3DMNA 4GRAA 4QODA 1HDZA 5J4HA 2RHHA 3AL2A 3BM5A 2JW5A 4LK3A 2Q7DA 3V3TA 4XZ3A 2CSXA 1L0BA 4P84A 2VP4A 3F8SA 4P8RA 1QV7A 1P9RA 1X7WA 3GEIA 2VRWA 2XMPA 2OP1A 3WE7A 1UKYA 4G97A 5CVDA 2GWHA 1K7SN 3NATA 5LUBA 1JB9A 3VBEA 4EG1A 3DTYA 2YV2A 3I30X 5J3JA 1GSHA 1V11B 3SBOA 1SD1A 4KO8A 5EPEA 4QPZA 1GKLA 1NC3A 1QFXA 2GM9A 4OK3A 3WY9A 4DEVA 4CDRA 1SURA 2ID8A 1V7QA 2OR3A 2PL5A 1JMVA 1TX4B 1P33A 1Z34A 4MKHA 5E1MA 3VJKA 3RQSA 4YXWD 3IAM6 3PI6A 4YJ2A 2POCA 2Z9BA 1RM0A 1TU3A 2GFHA 1YKGA 4R8MA 4BS9A 3CSDA 4K9OA 5JV5A 4I9GA 2GD0A 4NBLA 2PKQO 4ZAWA 4PWYA 2EZ8A 4AY5A 2PFGA 1CZHA 1JECA 5BWMA 3OPYB 1T4DA 1XA3A 1H3EA 5K51A 3HABA 2NU9B 1ZL2A 4X71A 3VPFA 1V1MB 5EKDA 2XX3A 4DCGA 4A16A 2JAUA 1UBSB 1B43A 1FFHA 4WASA 3KSRA 3KOWA 1UBRS 3CLRC 3L5KA 3VJMA 1DCTA 4IYRA 2H65A 1DKLA 1E96A 2MYNA 3IEXA 5P21A 1XAIA 4ZICA 4HZUA 3ZNNA 3S1AB 4E94A 4HXGA 4U2FA 4WKNA 3BWMA 2ZWOA 5JAUA 4BX8A 3PC3A 4KUHA 5KVSA 3OM9A 3INRA 5DTQA 3EFEA 3HJRA 4HGPA 1XJCA 1N3YA 3K2BA 4WGFA 5KQPA 5ARDA 1EFUA 3AVOA 3A6LA 4GPTA 3TOCA 5L40A 3R76A 2QPAA 4ZEXA 2IITA 6NULA 3L7BA 1VXRA 4BQFA 3BDIA 1KRHA 4FNMA 4JBXA 3SM3A 5B6PA 4CLRA 5IF9A 4X8HA 3LPMA 3C1OA 1DC8A 1KMHB 4LYAA 4Q7MB 1WD7A 1Y81A 2D0PB 3ONFA 4FMPA 2HWWA 4MW7A 4AJ9A 1OROA 1UAAA 4LECA 2FUG1 2KWIA 4D43A 4PNHA 2XOKA 3N53A 4WBSA 1HEIA 1VGQA 3TPCA 5KDOA 1ZR4A 1WXXA 4LCJA 4PQRA 4RGYA 4FUQA 2WSSA 4GM1A 3LTEA 4P4SA 5E4TA 1N1GA 1W94A 1Z74A 5AFSA 1RI4A 3FWZA 3ZJUA 1TZMA 1ODLA 4Q66C 2GZSA 3UQYS 5JY6A 2PN1A 5I4BA 1ZOIA 2HGZA 3LXXA 1ICEA 2HHLA 3DDUA 3NIWA 3QYPA 4I1RA 4OHRA 4FZJA 4B3IA 1EVLA 5ALVA 3L5OA 5DO9A 2VQDA 4RDCA 1E99A 3LF2A 3WQRA 4D9GA 1WSAA 5DHPA 2B0JA 4RPKA 1U98A 3W2IA 1QIJA 1SRQA 4FR5A 4MA5A 1SVMA 3FTPA 3VTFA 2YJTD 3IV6A 5U4XA 3RK1A 2PQ6A 3IMFA 4H1VA 1J4AA 3JZMA 3ZHUA 3OHPA 2P41A 3T15A 1E2IA 2PLRA 1K75A 2AOTA 4OP1A 2XZPA 5TVKA 1XLUA 1P6UA 1QFZA 4G0YA 3AEQA 2NMVA 4H08A 1PZHA 3CUYA 3QVOA 3ETJA 1A9ZA 5H80A 2ZRQA 3PSAA 1U7WA 4WY5A 2XA1A 4DLSA 2P69A 2YFKA 4ND5A 4E2WA 2FZ5A 3H05A 3AJ8A 4B83A 1TIKA 3AX6A 4IHAA 2EBUA 4LJ8A 1I1HA 4MW6A 1AUVA 1PS9A 1WB5A 5D3ZA 4S2EA 1A4XA 1XTJA 1XKXA 3HJAA 3UWOA 3QYFA 2MSLA 2G4CA 3VKGA 1BRMA 1AD2A 1CYEA 3PC8A 2WHQA 1IY8A 1HZZA 1ONBA 1RYZA 1SKAA 3BOSA 1WCV1 3NUQA 1YCFA 2GCNA 1OWPA 5KMGA 1O6ZA 4X0EA 3OLCX 2QZJA 3NIGB 4Q9KA 5CG1A 1K4KA 2IYUA 1VKOA 4IP0A 4JL6A 1EVZA 2GN1A 4PW0A 4UJ3A 2WI8A 4BQQA 2WSMA 4RXUA 1A8QA 2OKCA 1NASA 3JYHA 1M6EX 1QH0A 3I4FA 3WMFA 2A35A 2IF0A 1OXKB 1P19A 3SF0A 4EM6A 2GHQA 3FH0A 3WHIA 5T7BA 1H2RS 3ZS9A 1N5LA 1VPDA 2FEMA 3DBHB 4WN9B 4DUYB 2C3YA 1QRTA 1E2DA 1UKBA 1V9CA 3LC2O 3W3ZB 3ZCTA 5H3LA 4XFDA 4HWSA 4B6JA 3AC0A 4CM5A 5JQWA 3TSCA 3FZYA 1FRQA 4C0WA 2G0NA 4ZGGA 3FGZA 1NM5C 5AJZA 3KD3A 1LJLA 2B6HA 2G7ZA 3Q87B 3VRHA 1I4EB 3NWJA 4EKYA 3KQQA 1EKXA 4TTRA 3DAFA 4E14A 2E3JA 4I5FA 2BI8A 1N0HA 1ZD2P 3DXXA 3FHJA 3DFFA 4NFSA 1B76A 2CYAA 3QUSA 1GYQA 4GLBA 4N65A 3JZAA 4PG7A 4UD6A 5CTAA 3GPBA 5DBHX 5AT1A 4ZV9A 3MA0A 4O08A 4EX7A 4F9GA 1TQ4A 4OQZA 2W6NA 2CEAA 4XDZA 3WJ7A 1TIBA 2YWEA 3DCIA 5DKFA 3UK0A 3UMSA 5I7SA 4HEQA 4WD3A 3T1TA 1HKUA 4L8WB 1KFKB 5K7SA 4IVRA 3OZCA 3TAHA 3HLTA 4JWKA 4F6CA 2I3AA 2G5GX 2H2AA 4UUQA 1NF8A 3HE3A 2IV2X 3ZQUA 2WM9B 3DV2A 4OHOA 1T8UA 4O4JA 4YCSA 2IP1A 2FVXA 1IMOA 3C70A 2ON6A 4MRMB 2BZ0A 3ZXYA 1NDUA 1ZH0A 2XUAA 1ZHOA 4LHSA 3EYWA 4EY5A 3AI7A 3ABRB 1Q83A 1AZWA 2QE7A 3NOXA 2WHPB 1CNFA 4N7JA 4PXSA 3VSEA 3D2AA 2X4GA 5EEHA 5GQSA 1PK8A 1B4DA 5HE8A 4X66B 1JHOA 1U0JA 2HO5A 3FAZA 1L3BA 4WCVA 5COBA 4PLTA 2OLJA 4BE4A 2FEXA 1PV2A 2ZRJA 4YQZA 5KYWA 5LQNA 4TLEA 1OC2A 2CLIB 4D0RA 3LPNA 4CTMA 3WL4A 1F0YA 1XNQB 2HA0A 4WLOA 1XHLA 2X9QA 3HEMA 4HPWA 3OTGA 3FHOA 3ILSA 2Z9DA 1T1IA 1KJIA 4FHZA 4TRRA 1KYXA 4FE7A 4LOIA 4P82A 5ER9A 2OYRA 2GM5A 2O2DA 1A2OA 4QGBA 3QUCA 4V1CI 2DZDA 4XJTA 1ZVJA 3K96A 3O47A 3AXTA 3LDUA 3PFWO 3IVAA 3WQQA 1T25A 1CK4A 3EC1A 2X7XA 1ZQ1A 3PGVA 3UK6A 2CNWA 3PQ4A 2NZVG 7ADHA 3E15A 5AXAA 4OHPA 3ZQ6A 2FJ0A 4OCZA 2QTHA 5EE1A 1SA0A 3CNEA 4M49A 1B6RA 1ECLA 4O4LF 4TS3A 2HPZA 2QW8A 5EE0A 4MH0R 5BVHB 2XB6A 2ZETA 4I8XA 4MS1A 4ALMA 1Z06A 1BQEA 2YASA 5E0KB 4HDRA 3KE9A 4GI1A 4A26A 3TGLA 1SG9A 1KMNA 1DX6A 1HFJA 4RIIA 2DTDA 1DJOA 4NLLA 2CY0A 4R5HA 3P2MA 1CDDA 3I6YA 5ILQA 2H08A 2A0YA 2LIVA 1Y8ZA 3A1SA 1H2AS 1EP2B 1LPNA 4FONA 1XUOA 4FX2A 4K6OA 4QT0A 4UCQA 1VRCA 1A7UA 4XR4A 5EFZA 1KOLA 2NNWB 2RCYA 2OCKA 2AX3A 5DASA 5KHLB 2HMAA 4EYKA 2V5VA 4DJFC 2FHPA 5G3YA 3HXKA 4Y2SA 2YV4A 4OXKA 1K66A 3KOMA 3NJ4A 5G0TA 4D6XA 1JEYA 3CF0A 2F1HA 5U4QA 4C89A 3OOYA 1MJHA 3LQQA 1T9DA 1PTKA 3L79A 2EL9A 3I1YA 5G1OA 3IIEA 2ACKA 1W46A 3TTSA 2IVFA 3RSOA 5AW3A 4LYGA 4GDFA 3JVIA 1KDRA 4ZDKA 4NBVA 3NKLA 4G07A 5D5HA 3K9GA 4WESA 5IZCC 1YTUA 3I28A 5CB8A 4B6FA 1ADCA 3IEMA 2V7UA 1T0HB 1XPUA 3CURA 1SOMA 1KI8A 4U8GA 3UAZA 3PA8A 1OZGA 2C2KA 1GNVA 2IHZA 2YQ5A 1CVLA 4NABA 4EJFA 1TTQB 1R6AA 3PB3A 4HFNA 3INTA 3FVVA 3K9BA 4NBKA 3SZUA 3QSYA 2QVGA 3OI7A 3K71B 4Z9XA 4Q1CA 1YJAA 3F2VA 4EABA 1D5WA 1FOEB 1FSZA 2HBQA 1AU9A 2TMDA 2ZKLA 2OQVA 3R8FA 2IV3A 4YJFB 1WLSA 5F2EA 2X7HA 1DJNA 3ETEA 3QTLA 1ZD8A 3SY8A 1VSBA 4A2PA 4D44A 5C8VA 1V5EA 4BLWA 2F43A 5EKUA 3V80A 5A6SA 4UDNA 2NTYC 4KIUA 2UVPA 1WETA 4G1UC 2IUSA 1QIDA 4BHTA 1AKQA 2BBSA 2FZ4A 6REQA 4L95C 3T9FA 5LYJB 2GPAA 2GQ0A 2QLMA 4LJ5A 3NR2A 4OAPA 3AV0B 3SFTA 1TFRA 3ADDA 4EKGA 3JATA 1NUPA 4PHFA 1NGSA 2XTNA 3PRJA 1QDUA 3H9EO 3GLSA 2A4MA 3L77A 1F6DA 1SVWA 5KTMA 1L7XA 3AFNA 4AWAA 3KSUA 4W8GA 4RV9A 3QFCA 2VA8A 1E61A 3M6LA 5TMEA 5LBIA 5TXGA 5CFNA 3U16A 2LUOA 4GGMX 1RRKA 4GWGA 5LA6B 2C7GA 2EGUA 4EB8A 1ANKA 2PS0A 2XMBA 2XW6A 3UNXA 2VHJA 1YXMA 4IX9A 4CJXA 3HLYA 3AG5A 1MB4A 1QTIA 1R18A 1UPUA 2BFEB 3RADC 2O5EA 1E0AA 4LMRA 5AI5A 3ADCA 1JU3A 1JLRA 1V1RA 1WUJS 2C8KA 1CYDA 2CFTA 2FMUA 2C3UA 1ECCA 2C98A 2Q6VA 4Q4HA 3BRWD 4ESOA 5K8TA 2NM0A 3ESBA 4UTPA 1F60A 3HCOA 2FY8A 4H60A 4O2BF 4C07A 4FBLA 5DDIP 1RAFA 2WSBA 3WL3A 2J41A 1A8IA 1T2CA 4MKXA 4QJ4A 4M1TA 4H1UA 4D1YA 1EFRA 2FAXA 3ZBTA 2WEKA 1QQTA 1U8CB 3R5XA 3FVTA 4TMYA 4QL3A 4UNPA 4AT1A 1FS6A 1OH8A 2Y0EA 4A82A 3KB1A 1M6NA 2V7VA 5FKJA 4GP7A 1E32A 1U2DC 1JPVA 2HADA 3ZD8A 4Y7DA 3KC2A 1M72A 1KO8A 2WT9A 4NAUA 3H2GA 5FULA 2AKEA 2BKXA 1QCCA 3KYJB 3O4JA 2GI4A 2VNIA 3GD7A 1DV2A 4GOKA 4HXEB 3ICEA 2YOHA 2RDMA 4Q3CA 2R96A 1TCAA 2G9VA 3HKCB 5JSZB 2GMWA 3A9VA 3K09C 3RFFA 5E6UA 1IVNA 1TK3A 2GN6A 3QVGA 4ZN6A 5K99A 4PNEA 3P26A 5BR4A 1C7JA 4M99A 5HF9A 3MSCA 3VSDA 2A1UB 4GVLA 1BCRB 4GO1A 1MB9A 3TMYA 1JBKA 3C5HA 2QY9A 1SCBA 3Q9NA 1RXCA 1R0KA 2O48X 5M3BA 2PX0A 4LNAA 1J24A 4PM4A 3UUEA 1P1BA 1ZBQA 2JGIA 3O82A 3EUWA 1T5TA 4K86A 4QU0A 4RYDA 5B2EA 3WRXA 5B57C 1K6JA 1M2FA 5CIYA 4E7PA 3IJEB 1L4FA 3O3NB 3D2LA 4M0PA 2XQGA 1HYEA 4NVRA 2H6EA 2AKAB 3N7AA 1R8XA 2IHNA 4KPYA 4LVUA 1KAOA 2QPOA 1CY8A 5B1SA 3KKQA 1XD9A 1OE0A 1EXMA 2X1VA 2H07A 2VJYA 3JVDA 4X7MA 5IVIA 2VNSA 3LUHA 1XB2A 4AZSA 1E79A 5EIEA 4ZOAA 4LBYA 1PT6A 3ZWCA 3I6BA 4M1QA 2CFRA 4LF5B 2WWFA 4MIEA 5KU1A 2AXNA 1N9ZA 3LQKA 2QRLA 4YRBA 1AK9A 5CYOA 5F73A 3CTPA 1V43A 3H75A 3UXYA 1XMIA 4BN0A 3GEGA 4C7JA 4I81A 1JH8A 1E1NA 4BYGA 3FRIA 1KPGA 5ESDA 1NW7A 3N3BC 2PXCA 1R9GA 2ANBA 1VBFA 2IPAB 3ZY3A 4D4IA 3O6VA 3OOWA 5B3LA 1QIMA 2D1FA 2IDKA 2FW1A 3LKZA 2YY5A 4ETIA 4AM8A 1GY8A 4IQ0A 3DAPA 3AJEA 3O8OA 4LYHA 3WLPA 1OX5A 4UQLA 5KTNA 4DA9A 2LR0A 5CFMA 1EHYA 1MT0A 1NQVA 1VGRA 2OBNA 1SXHA 2ZWVA 3CE6A 3JQ8B 5JAIA 4IIBA 3L7KA 4Q00A 1TEXA 1U2PA 3VV3A 1W7AA 2GF0A 5JEEA 5JUWA 2IU6A 1M1XB 2HCJB 3KYDB 5J63A 2GEVA 3NM6B 5L51A 4E1VA 4RK5A 1OFUA 2K4MA 3AWDA 3MW8A 4HT3B 4WA7A 4KR3A 2B4YA 1P2GA 3AHHA 1DRUA 4OXXA 4KRFA 2R5NA 2X6RA 3PJDA 2AD5A 4JOBA 4AN4A 2BGMA 3QXXA 2PH5A 3MT7A 2RGNC 1H6AA 4GP9A 3ESCA 5B1YA 3N0WA 3K0FB 1GOTA 2R8XA 4FP9A 4EG0A 3GFTA 3ISJA 3ZU2A 1PT9A 2AJTA 1ENZA 1NXTA 3JD1A 2G8LA 4H3KB 2P2LA 5GOZA 3R9IA 4EJMA 1B3RA 1JKJB 2P77A 4LXUA 1YBMA 4HK4A 2I7TA 4ZVOA 1CDEA 4BO5A 4CLHA 4LV6A 5DTIA 2P0AA 3K0EA 5ELXA 4MV6A 4ID9A 3FY4A 4UEJA 1XIVA 1VMAA 3OQIB 5BV8A 4CKZA 4DIMA 3VMFA 3L6EA 2CJYA 1R16A 2P9HA 3G89A 1JDPA 1CJKC 3QV1A 4X9XA 3T3DA 3ZV5A 4DF3A 3DLPX 4BMSA 3PE3A 2YOGA 4DV4B 2HJHA 3MT9A 5CDFA 3WDMA 3WXMA 2DMRA 5JNTA 5EXDA 2OPHA 2O1SA 3BORA 4ZQIA 2Q4DA 1UBTS 1A1VA 1PUJA 1G17A 2GRUA 3RVOA 2ZCUA 2H16A 2AF3C 2TECE 3OY7A 4PYNA 4BMNA 4EGSA 4PAWA 5CVEA 5TF4A 5A03A 3H4IA 1VOTA 4J49A 3S2FA 4MV8A 2ZOSA 4OHZA 3KZKA 4QUHA 3HACA 3R9XA 3I5AA 1OTYA 2BCGY 3K6RA 4DLVA 3CINA 2MYPA 3UOAB 1IUKA 3I04M 1LH0A 3N8DA 4KPUA 5F3WB 4LYEA 5KSPA 3CKKA 4DRXB 3PFHA 2GAJA 3QG5A 5LOVB 2P9GA 1T2VA 4P4TA 3BCUA 4TZKA 2BISA 2HZ7A 3OY2A 1A4IA 1NIJA 1Y5MA 4H3SA 1ZAKA 3JQ9C 3N2NA 5CDHA 3CW2A 2JH8A 2RGBA 1XTTA 3AZPA 1TPZA 1US8A 3AVTA 4ZJZA 4M88A 2FETA 4K28A 1KO7A 1KJ8A 2EKQA 4IXDA 4BBZA 3CRRA 2XDQA 1E4VA 1E9FA 2ZW9A 2NGRA 5K2OA 1TRKA 2HA2A 4LMBA 2R1ZA 4H0NA 1LK0A 4LJ4A 1ZVQA 3LFHA 5CX4A 2MIIA 5L8VA 4UVGA 2GK3A 5CNJA 1G7CA 3NBZC 4IXTA 1FQWA 4V24A 1M8PA 1Y48E 2B35A 4ZGBA 2OC9A 1VPVA 1KKMA 2IPLA 2VAPA 1EFAA 1PQPA 2IPOA 4P3YA 2ZIGA 2XZOA 1OHHD 4YXFA 2E4UA 1T0IA 1UBNA 2JHGA 3ELYA 5J9FA 4WZBB 1R0RE 1B2RA 3AKDA 2EX0A 2XTJA 3P9SA 1PL7A 1RJEA 1TMOA 3CMMA 4LF4B 4JAVC 2C8JA 3OLXA 4UM9D 3I61A 1OAOA 1YGYA 5CLLA 4ZRDA 5JZBA 4IF4A 3U7QA 1VL2A 3GVIA 3VR6A 3HM9A 2ATXA 4QRIA 4QULA 3KXKA 3L0YA 5IM4F 3DONA 2XD4A 1O6FA 4TTQA 5AM4A 4B44A 1HA3A 1DRWA 2XNCA 2ZAMA 1P4GA 5FPKA 4W7SA 2ZBQA 5GP1A 2EIHA 1Y3AA 1AUQA 2Q4BA 4O1HA 5DBEX 1ZK4A 3BD8A 3SLKA 3VZCA 1WOMA 3WBJA 4B7ZA 2DOKA 5T67A 1RW4A 1SHZA 1AA9A 1XHFA 1G1AA 4IJ5A 1XTIA 4TTJA 5HIJA 3B6KA 1I9CA 1FNMA 3LBHA 3LW7A 3NHBA 4G0NA 4JJAA 1BKYA 3LL7A 5DCYA 1CQWA 3W3AD 2OK7A 5DTEA 1ULSA 1YI0A 2FOLA 1JEEA 4FFMA 4PANA 5ENDA 1PWXA 1SPBS 3UJ3X 2W6MA 3U4QB 3CEHA 2PX4A 3DE5X 3OAAD 3KL4A 3GRAA 4TXHA 5EIOA 1YHYA 2JJQA 4CFYA 3O7MA 4O2RA 4H7KA 4YB8A 4XD7D 4Z9BA 4F8JA 5FDFA 4MDEA 1N2EA 3HYLA 2QMHA 1XMPA 1B1AA 2AFHB 3JWPA 4I8IA 5FBQB 4B47A 3ES9A 5HFAA 5B1DA 3RRMA 4E4YA 4J7XA 4CF5A 1Z22A 1DX4A 3ESZA 2Q5LA 2PIDA 5BQOA 3L4BA 3VNQA 2VBFA 4QGGA 4UNQA 1PUIA 3UAXA 4BL5A 3OQPA 4HAXA 3S55A 1GUYA 1TOAA 4M9UA 4W1RA 3TJZA 7GPBA 4BFSA 1X15A 4ENUA 4MRVA 3AUFA 4X6YA 4DMMA 4BZXA 4K1XA 4MEBA 1O96B 3OJXA 3VAYA 2HB6A 1ZD1A 4IF6A 1BWQA 3BMCB 3RB8A 4Q37A 3D3NA 2FDCA 2RKBA 2ZATA 4LJSA 2O0MA 2AJDA 3QOWA 2O14A 4QUEA 4V03A 1NP3A 3ACCA 4GZ3A 4JN6B 2FZLA 4BJHB 3JR7A 5BOSB 1XT6A 2CXRA 5H02A 1J8QA 2PX5A 4G5OA 1CV2A 1GSAA 3KLNA 2H2GA 5JNLA 2GLTA 1GGVA 2QMYA 1IG3A 2EKZA 2OHVA 4ML3A 3BTSA 4KPFC 1GRNA 4D0LB 1KZ4A 1OY1A 4DHWA 1G20A 2GPNA 2WLSA 2VSQA 1ISJA 5EP3A 2P6RA 5TQ0B 1JG6A 1ORIA 1RZ3A 2OZEA 3AUAA 4P35A 1TEHA 1AS2A 3QE2A 4R7ZA 2GEKA 3P0IA 4MV5A 1I2MA 1TA9A 3WYCA 2BEVA 1WXHA 3DR3A 4HDNA 4D9CA 2NU7B 4JLPA 3RYIA 4C3ZA 4CVNA 3HZHA 5I51A 2PKWA 1UBOS 1WUHS 2H4ZA 2RAVA 3H2BA 4LY3A 4OHUA 3RU3A 4CBVA 3CZ4A 4DCSA 4HLDA 4FCWA 1HFKA 4ZXFA 1ZK1A 2C57A 3O2JA 4IIGA 1CUWA 2Y6UA 3PNKA 3OLVA 1KR5A 1YBHA 2PD4A 4URXR 2YFHA 3GQVA 2I2CA 2YICA 4B6EA 1W88A 1T4CB 1WMBA 1U0OC 3CY6A 3NX4A 5C1IA 5BN1A 3SSMA 1HZZC 1ZK0A 4EEKA 3DKVA 3G2NA 4WSOA 4J0KA 1SVSA 4DC0A 4S04A 1LW7A 2I80A 3D7KA 3DCYA 3VI3B 3H1EA 3EPKA 3THYB 3OURA 1QYDA 1JLKA 5DFAA 4CR8A 1MV5A 5A1TA 3A3PA 2ZJ2A 4NJEA 3HGQA 5AWFC 1U7HA 3WSVA 1B8VA 5CH3A 1F06A 5JCZA 3N7UA 4D98A 4G0VA 2GJ4A 3DLHA 1X7DA 5FI0B 1U5AA 1CS0A 2HA6A 4O8ZA 2C1ZA 3IXMA 3IQFA 4AZ0A 4QBKA 3UTDA 3ERCA 3PD7A 4LOJA 4ND6A 4O4LA 5AW5A 1RAGA 2AIRA 2XSZA 3FHCB 2OAGA 3L7DA 4IGAA 4L4SA 1BIFA 1W5AA 4TT3D 1VLVA 4M7OA 1Q5PA 3O73A 2QAGB 2H0AA 5KPJA 4L3VA 4C2BA 4ZHQF 2EJVA 3WJAA 4BB0A 1W0KD 2PKXA 4B6SA 2R1VB 3TI7A 2QUAA 5B64A 1C9JA 5A04A 3JRXA 1GAQA 1ZXLA 1KBOA 1N6OA 1X74A 1DBQA 1Y6QA 2FG7C 2D62A 1PS0A 1OWMA 1F2UA 2XDAA 1GLGA 3VR2D 1XPJA 1OILA 3GFRA 2FPPB 1W4ZA 2OHHA 5EWJA 4FTWA 1X1QA 4NBRA 5GIPE 2JI8A 2ZI5A 3FZQA 4I2NA 5DOZA 2D6FA 2AQ8A 2B21A 3FOCA 3O8CA 2QRNA 1JNXX 3FPAA 3NIFB 3KLBA 4QTTB 5J4KA 2PRKA 4LF6B 4DGQA 1PF7E 4QYIA 5IULC 1JEDA 4NQZA 2EDCA 2O2GA 2IW1A 1W2GA 3Q41A 1FP6A 3EXFA 1EIZA 2QGZA 1WMEA 3TLXA 3SQNA 4DADA 4I14A 1RYFA 3ZIUA 4TYQA 2VP0A 1NBHA 1N9GA 1Q1GA 3LWNA 4LOAA 1IEVA 4H7PA 3A10A 2GRAA 4RPLA 4DXAA 2CCJA 3DW3X 4YTEA 3ZHQA 5CFOA 5AW6A 1J49A 1KBZA 2XCLA 1H42A 2YIJA 1AK2A 1R0WA 4TMFA 3RAFC 4D4HA 2P8SA 3UMYA 4JFAA 5EN4A 4LXGA 2P3SA 1S4QA 3GBSA 5SY6A 3ZWBA 4DCOA 1BGWA 2P7IA 3IVCA 1GL6A 2COUA 3GA7A 4BECA 3WL7A 2RBKA 3R7LA 2CFOA 2FEOA 3C6YA 5CAEB 1SQ6A 5TNXA 3DHNA 4K9SA 1NVVQ 2V7BA 4JQOA 4MO2A 3T7CA 1PGNA 2VP2A 3T54A 4O1IA 3IKVA 4A0FA 2A5FA 8LDHA 1GVNB 1QFYA 3FFXA 4G65A 1MX9A 4OPMA 3OVMA 1ENPA 1HE5A 3WLMA 1FUYB 3EQ8A 4PBSA 3WTCA 1GNLA 1IIBA 1RQPA 1RLIA 5JAPA 3C97A 3LK7A 4P6VF 2CFIA 3WO0A 2MSWA 1E2HA 3SYLA 3HXTA 2IXEA 4RPGA 3VHQA 5BQPA 2ZBEA 5CFZA 3AWIA 1QF9A 2ZJ8A 1NX6A 2J7PD 4PYRA 3JYQA 3LUJA 3LZDA 2HZBA 4GL4A 4HBGA 2PNFA 4Q4AB 3RBVA 2CMGA 3IB3A 3W9UA 4AJHA 2BZSA 1CX9B 1L5QA 2WNSA 1VPLA 4I1IA 4AMYA 2H4YA 3I2KA 2JLSA 2CJFA 2D0IA 3NKFA 2QIPA 4XM1A 4B8ZA 3BREA 3QXGA 2NUAB 2XCOA 4RLHA 3ZBUA 3YASA 3ZQJA 3GLFA 3BWEA 4DA6A 4UXJA 4AS3A 1EFVB 5AVSA 1QE5A 5FORA 2JGFA 2GXQA 2VNJA 2XUGA 4D8UA 1WU7A 1V7ZA 5A3VA 1WTCA 1ORVA 3IPAA 3R6TA 3SD7A 4ZP1A 3KDSE 2J0VA 4KLAA 3X1JA 1KYTA 2SECE 3DMTA 3PXGA 3EVTA 2HWKA 4BAUA 3NV9A 5EP1A 1VI2A 3ZWKA 4BLOA 2GNPA 5B53A 4BFXA 1AX9A 1QOQB 1RADA 1YR7A 3LO8A 1QIIA 1MOSA 4N5LA 3T3GA 4D45A 1BVRA 1NNUA 3NDBB 4PSVA 3TQOA 3NAGA 4EA6A 1JJIA 3M49A 4N8DA 2L18A 4X1YB 3TB6A 3CBQA 4FYKA 2YWGA 1PD0A 2YYYA 3MWJA 4RABA 1Q7RA 4X1KA 3ZVRA 1B93A 4FDTA 4AUKA 5B7QA 1LS6A 2GLUA 2XCRB 3PTAA 1E2JA 1KIFA 1USWA 4W5QA 3A6DA 1CY4A 4WFKA 3HKEA 1N8KA 3M6IA 4FFBB 1L1EA 3B2EA 2IZ5A 4QUBA 2JD0A 2WHXA 1FX1A 1OLUA 1WCYA 3PSHA 2RI6A 5IM5A 4D0NA 4F72A 4TRNA 4Q4LA 1S2LA 2WFLB 4QHYA 1W5EA 3IV9A 5F1YA 3WK8A 4C0SA 5K8UA 5TVGA 9ABPA 1RKUA 2RC5A 5KNCH 1JI0A 2QLTA 2ZPAA 1P18A 3A1TA 3W5JA 1Y4SA 4D57A 3IE2A 4LZAA 5B5SA 2ZIXB 1KFJB 3TRFA 1SKBA 4J0EA 2WWVD 3LMKA 4HHEA 1W5SA 3D02A 1C3LA 4JHLA 4L4RA 5F7OA 5KNBD 2X41A 2PZAA 4G0WA 2E85A 1ISSA 3G88A 4FLFA 5G0SA 5LYYA 4EG7A 2CJWA 1EGVB 1JLHA 3C5VA 3KQMA 1RRGA 4N1AA 4R2HA 3N8HA 3RJTA 2G4LA 3UH1A 4B80A 4CPDA 4LTMA 1W4CA 3COVA 2NPIA 2G08A 4W5NA 1UOOA 1W6UA 1RKQA 1G8FA 3UG6A 3W2FA 4HYTA 1X1BA 2GR9A 1IOWA 3QJ5A 1FRZA 4ZI2A 2INGX 2YCLA 3L1HA 4LXYA 5ILOA 2ZUFA 1DU4A 2WICA 3OX4A 5ANRB 1OC4A 2RKWA 3L2OB 1ZM3A 4HB2A 3CF4G 2CLFB 4N7BA 3OHMA 1ESMA 3WGYA 2RBGA 4ZYYA 9LDTA 4WXEA 3SYRA 4BB9A 4BASA 3RSZA 3IODA 2ZXFA 4A6DA 3GOHA 4RYLA 3X1ZA 4HOYA 4B2YA 1SFRA 1Z0KA 3DAYA 3Q3HA 5FIUA 1W0CA 2CW5A 1CQIA 4ZIRB 1S8FA 4QBTA 4BWYA 5L3SB 5IJ9A 1VYUA 3FHLA 3QVUA 4K6FA 4CQMA 1EM6A 2Q5IA 3ROGA 3L8GA 5SV2A 2E2WA 3H1GA 4J75A 5GZ1A 1J23A 1KQFA 1S3GA 1IEWA 1DKOA 1KOFA 3EVNA 2VF5X 1C0IA 4ZHSA 2QN6A 5ALNA 1Y5RA 2DH5A 1KK1A 2HCFA 5EXSA 3EOZA 3E81A 3EMBA 4NE9A 4OAQA 2C03A 3TMKA 4B5KA 2WUFA 3URKA 3H2YA 4ATNA 1Z6TA 5SYAA 1XXHA 2FWPA 1ZICA 5DULA 4ZVQA 5C0OE 4V0QA 5AYVA 3RUHA 5JH7B 3DOHA 2OM2A 1WDMA 4E3WA 2ZJ6A 4JSRA 4RZXA 4N82A 2XUKA 5A1JA 4JP2A 4WXRA 1IE3A 1ONSA 4RSHA 4YUYA 2WSSD 2A0UA 5G02A 4Z8XA 3AYXB 3DNMA 2FCRA 4CMKA 1EK0A 3TTTA 3VZSA 1IY2A 4IHJB 1JSCA 3HEAA 4J3JA 3K1YA 4EW6A 1Z63A 1SCUA 1Y98A 4RHTA 3MWDA 3ROFA 5EZ6B 2JFXA 5FNVA 1ZMRA 2WTNA 1N5MA 1A04A 3U31A 4KE6A 1DAKA 2WP0A 1GUBA 2C4WA 3RJZA 2EIXA 1ZXXA 1KVTA 2PVCA 4DQUA 3P94A 4IV0A 2WFMA 3OZVA 4GPD1 5DXAA 4MVJG 5BXQC 3CLKA 3DDCA 3UMMA 3G6WA 2JAWA 2NZWA 3OPMA 1KO1A 1CB7A 1HDOA 2QROA 3I0ZA 2F1IA 5T4HA 1WKCA 1GAEO 1FPQA 4OJNA 1TW2A 1A3CA 3WRXC 4EKNB 1XNRB 2ZK7A 2DPGA 3EYAA 4RFVA 4TLAA 3ZPXA 4WRRA 5KPDA 4CV2A 2V98A 3LJKA 5C31A 2IH2A 5DHAA 1KEPA 1VC2A 4RK4A 1K2VN 1JMYA 2QN2A 3MN1A 3N74A 1CUHA 4OX9Y 4DMKA 2JFBA 5KWJA 2LDXA 2Q07A 1GDTA 3ECAA 4BNXA 4I66A 1DKNA 2FMKA 4ZC8A 3VDMA 1LF5A 3QHAA 1PNOA 3GDHA 4IH1A 1VL0A 3P0HA 4LDPA 3QITA 4QVKA 1LBTA 2DFPA 4X60A 3LO5A 4KXNA 4YRKA 1YFJA 3AF2A 4D0SA 1X14A 2AUTA 3KG2A 4NV3A 5COQA 3CJTA 3OJWA 2D54A 2P9ZA 5AVRA 3CRW1 1QGAA 2C4HA 3DPUA 3TD9A 4ZZ1A 2X5XA 1YQ9A 1E7QA 1ORWA 1VHTA 2NU6A 4V38A 2I7XA 1JIIA 3PC2A 4KMMA 1IULA 4RE6A 3UC5A 1CUDA 5IBPA 3JVVA 3ZDYB 5JJKA 2NUPA 1QZ3A 1NQXA 1MC1A 3BMQA 2H9AA 3OUTA 4YP0A 4Z4EA 1CJUC 3C3MA 4EHAA 1RPZA 1G18A 4JK3A 2QRPA 1N3LA 3LVFO 4JX8A 1TDJA 1HOTA 1YOVA 3S68A 4BUZA 4F85A 1FNNA 1FP4A 4G4SO 4WXPA 1QRRA 3ZBPA 4DUZB 4EJ6A 3AGPA 5HQ3A 1N33B 3GU3A 4L75A 2QJRA 3WTBA 2MDTA 1V16B 2Q21A 2SNIE 4OXQA 4YCBA 3VAZA 4CF3A 1FFYA 1F6WA 3RM3A 4UTNA 4X91A 2XNJA 3T0FA 1NUQA 1PDVA 3SIWA 3DVSX 4R3UC 1N2XA 4HAZA 3GX1A 1RE1A 1EZZA 3AOEA 4D74A 2J9ZB 1FFGA 4URVR 1UADA 3BRQA 4EMBA 2HBZA 3TQRA 1YI1A 3MMZA 3UFXA 4P4LA 3FSEA 3VHXA 2GBGA 1NXVA 16PKA 1SH7A 3C24A 4OI0A 1M75A 4UM9B 4GHWA 1NNI1 2RG1A 4RDHA 5KNLA 3QMWA 2IL1A 3BSFA 5FL3A 4UATA 4JXXA 4OUDB 4HDMB 4HQFA 4Q7KA 1NUTA 1O0BA 1GAJA 5CVJA 1KTIA 3DXZA 4WJZA 1H5NA 2W6JD 1A9YA 3E18A 4M0UA 4ND2A 2WWWA 3LH5A 4LZLA 5DBGA 4MDFA 4BRWA 4UM5A 3EBPA 3CRNA 2WD9A 2XTAA 3TVDA 4OP2A 4K8RB 1CUUA 2Q9UA 2VKTA 3GAAA 3Q5GA 1XELA 3IUBA 1Y1LA 4CKCA 1P80A 3FX2A 4LI0A 2ZRPA 1TQHA 4DEXA 1W4LA 4DLWA 1JG1A 3D8SA 4PNZA 3U60B 3OCZA 3MJ4A 4L8FA 1HE1C 2XA2A 3DUFA 3O4GA 5G4KA 1KY5A 2HCRA 1NONA 3QX8A 1NY6A 3E9QA 4ZEWA 3H1BA 4D8VA 4HRXA 1B0UA 1J25A 2ID9A 1ZH2A 1O94A 4RM3A 1YR1A 4O2AB 1GVHA 5IRCD 1AO3A 4J94A 4DC1A 5IX8A 1JILA 4P83A 4DPMA 1KVQA 2AQHA 3GEDA 3RS7A 2ZRMA 4Z5XA 2DPYA 3AM3A 4RTPA 1NXXA 4QOJA 1LF0A 4M37A 4I4NA 2Z5FA 4EB6A 2ONJA 1BMFD 4WOCA 3RC3A 2QJWA 4ZI7A 1YBFA 1OPRA 3KOXA 3V48A 1MQSA 5C18A 1TI7A 3WLSA 1YRLA 2XF8A 1E9EA 4BN5A 2CZCA 4HX2A 1DARA 2CNWD 3UHAA 5EA2A 4FC6A 4Z54A 1Z5ZA 2WP8J 2Y0DA 2XUOA 3IEUA 4G89A 2XRYA 1UPBA 3B13B 4F4IA 3NTLA 1J2EA 1G8AA 1TJNA 4NYMR 4R16A 1WV1A 4AKIA 4H18A 4BX3A 4YR9A 2FB9A 4X3PA 2GF2A 4W1PA 1CF4A 1DMRA 5J1SB 4RA9A 3R8XA 1XEAA 2OXIA 1G8SA 1H6BA 1Z7WA 5KAPA 3PNOA 1GGFA 2YVAA 4IDOA 2Y99A 2C0CA 1R4NA 3C4VA 3DQQA 1BN7A 4ZQEA 1IB6A 1OXTA 3H5WA 1IDOA 4FKBA 4ARBA 4O2LA 2QX6A 1W2WB 4HLNA 2XB4A 2IBMA 1N77A 4BO3A 1XAGA 2OB2A 3NT5A 4Q1EA 2JAHA 3U4DA 1NP6A 1L7EA 3AIKA 2H5JA 5C46F 4RVOA 1OAOC 2C9YA 3KYIB 2ZRFA 3E9CA 1P8AA 2H2WA 4TRMA 3FCSB 4DS3A 4PE5B 4J0IA 1WNTA 2X58A 1YSCA 1SUSA 3LI2A 3IAFA 4J03A 3FKSD 1F4LA 1JLLB 1KJZA 5AJUA 4G4SP 1X7YA 1EP1B 1M0SA 1VLZA 3EEFA 1Y9ZA 3SHTA 5B7PA 2HFJA 1GPWB 1KSJA 1O58A 3UW1A 1RMTA 3V4LA 2HRRA 2XKJE 3EMKA 3FTNA 4AMZA 1TF7A 3LHSA 3OU2A 3QWAA 4IJUA 1KPIA 1CWUA 4B34A 5HNKA 3B1KA 3ED1A 3OMXA 4IDEA 2PUDA 4C2AA 2EBHX 2A9JA 4QEDA 1DIBA 3TGWA 5DU2A 1XZDA 1Z47A 1XEFA 2YCBA 1E8NA 1YFZA 3CKYA 3NC0C 2O4CA 4ITVA 4GXQA 3E7PA 3AF6A 4HG2A 4JT8A 4E11A 3FNRA 1XXLA 1DNPA 1RM5A 3HL0A 3R5FA 4HS4A 2CWDA 4BTVA 2JFPA 3L7JA 3M6AA 4L27A 3O31A 2NP7A 2PH3A 1TLLA 2ZAYA 3N70A 5DM70 3NRBA 3ZWWA 2B99A 1X86B 2PSDA 2VUUA 4MUYA 1A4RA 3C1UA 4TV8A 4DIOA 1VCOA 2JFWA 1EGMB 4QM6A 1Y0BA 3CGWA 2AZ4A 3EY9A 5AW8A 3W2TA 2H4JA 2FE1A 2XLBA 3EGDA 3EEIA 4YALA 1Z5UA 1R27A 3JSAA 5ER6A 3Q0EA 4UUAA 3TINA 3UMRA 3O26A 2ZR0A 3VV2A 3AHFA 4E3ZA 5FQOA 2JFHA 5FD8A 2F4VB 1S9DA 4MIKA 4RVFA 3P2KA 2AUNA 3AV3A 2AD1A 4O25A 1DC7A 1YB5A 5F21A 2P4SA 1G64A 2BHNA 1DWQA 2HF7A 1OU4A 2OCGA 5BWOA 3NT2A 4BNDA 2QTRA 3WICA 1EJ2A 2I3DA 3RH0A 2ZU0C 4QQNA 2X8JA 1V5FA 2M6SA 3WGUA 3SEFA 4Q19A 1A2BA 4RM2A 1WZEA 2XB8A 5F5XA 4GEKA 1UDCA 3GUUA 3K20A 3TR5A 1SAYA 2XOEA 2OXRA 3QWBA 1F4PA 2F1RA 4ETNA 4X7PA 3RIGA 4DREA 2GTIA 1R7RA 1WCXA 3FW1A 2CLDX 4WCFB 5FEUA 1ZM9A 2AXQA 1MC8A 4U3JB 2A3NA 3STUA 4MUIA 3AVPA 3C4JA 5DCLA 4Z86A 4OHWA 3BC1A 1T1SA 3IAUA 4MXDA 1I6MA 2Q6TA 5ALZA 2I7VA 4GW3A 1WVGA 4URUR 1LRLA 3IKLA 1JQBA 1YE5A 3D0QA 4I9FA 3HBNA 2IYAA 4LZNA 2I65A 3MOSA 5JDCC 1VE9A 1AQNA 4ZVRA 5JJBA 3HQ4O 5GV7A 5M5BA 2FSPA 1YT5A 1LQTA 3JY6A 1X38A 2JI7A 3KTDA 4UHFA 3I1IA 1RTKA 1KE1A 4TL9A 3K8OE 4OGFA 3ZDCA 3QY9A 5D3MA 1ZNYA 1D8TA 1ZJJA 3E9NA 1R8JA 1X8LA 4EY7A 1GO2A 2V6GA 3KB6A 4AY6A 2VAVA 3Q8MA 4YUVA 4EG3A 2UYYA 4JLOA 2O3JA 4FSHA 5BRAA 2WPDD 3ZOKA 2C88A 2PUWA 5CPFA 3WZLA 2Q2VA 3A25A 4MITA 5FB3A 1L5GB 1MC4A 3HUUA 2BFCA 2F3RA 1E8MA 2VZ8A 1TVMA 3T1VA 3AHEA 1BJRE 1CS4C 3I9KA 4HD8A 1QIGA 1R9JA 1TGYA 2FSSA 2ASVA 4JJIA 3N7TA 5EXTA 3A26A 5KVCA 4PXYA 3K0SA 2IF2A 1A8SA 1U2SA 1W76A 1ZZGA 2IYLD 3SR0A 3TIVA 3ZS8A 3OM1A 4U7FA 3F7TA 3R41A 3A9CA 2GVDC 1VMDA 1Q3HA 2LIPA 2OCAA 2Q6LA 3AM4A 3BWBA 1II0A 5EYPB 3WIDA 4C7XA 5A3QA 3C7KA 3FBTA 4OMUA 3F6RA 2W6ID 2IZOA 2JKZA 1T2AA 4CLDA 1A88A 4D8TA 2O8FA 4RJTA 1V8DA 4E5MA 2KLHA 4FYHA 3C3PA 3JQGB 3VVLA 5HZKA 2GBCA 4QRDA 4N6GA 3RSQA 3V4SA 3HJCA 2KB0A 1NZDA 1P44A 3A1FA 2UYHA 3MLBA 3LVRE 1ZGJA 4BO2A 4KBFA 2NXEA 1TL7C 1ISHA 2VNKA 2YRXA 3OQBA 3B8HA 4UW9A 3VJLA 4DV1B 1WDTA 1LC3A 2V6BA 2IV7A 1BOOA 2X5KO 3V1UA 1L5KA 1D6SA 2HPVA 3DWFA 3HWSA 4QICA 2BR3A 1SBHA 2AW5A 4EL5A 3U5TA 3FI9A 2I1LA 4A4DA 2GM4A 5T6MA 3OTQA 4B7XA 4YAFA 5KOHB 2CVHA 4OP3A 1RI2A 3GN2A 3L0CA 5MFPA 4IYJA 3MBKA 2E55A 3TECE 3CVVA 3VZPA 2ZSEA 4Z9YA 3GLIE 2BZ1A 2DERA 4NMLA 2WLTA 3L7IA 2POQX 3K1AB 3NDPA 2I3BA 1NVKA 2B78A 2FRVA 4KBYA 3EXAA 1QS0B 4H7DA 1Q74A 1QWOA 3FN4A 2C4VA 1GNTA 3GC6A 1RCTE 1YA8A 4PHHA 4QUJA 4Z53A 3QMPA 3D9QX 3RS9A 4MICA 3RAEC 2FX5A 4IDAA 4BO1A 3HI4A 1W52X 3IDSA 4MLDA 1CHNA 4QQKA 2I2XB 3JALA 1SY7A 3KQOA 2F9FA 1ADJA 2RIPA 2HK7A 2V97A 1BW9B 3AY3A 2FDXA 3I73A 4J3FA 4EGFA 1P9WA 5LFAA 2BSQA 4AI6A 2WQZA 3FZEA 2B0CA 2H0RA 4E4RA 3MUEA 3ND9A 5CB4F 1A5SB 1CE8A 2VDVE 2F67A 1QUEA 4FN5A 3HM2A 3UVEA 2RHTA 4B45A 3GFVA 1Q0RA 2HA7A 1KMIY 4Z0PA 3SQDA 1IHDA 2Z2XA 2B1IA 3T3HA 2JFQA 4Z3OA 2V0NA 1V41E 3LNCA 5FCDA 1YQUA 1VJ1A 2VSYA 4B2PA 3E48A 4Z4QA 1FDWA 2JFOA 4URFA 3VGJA 2O2ZA 3FOAA 5IC6A 3SHQA 4UARA 1BE0A 3ZXUB 1SK9A 3ZCVA 2FR8A 1NTOA 4NV0A 4OHBA 2WT8A 1LEHA 3BZUA 4Y1FA 3UHPA 2DY0A 2IOYA 4J1TA 3A3NA 3T9CA 4G26A 1FP2A 3PC7A 3IVRA 3TAUA 1YOBA 3DE6X 3KT6A 4JODA 5H7XA 3GPCA 2V7PA 3KUXA 1V7CA 1JDZA 2YXPX 4U2DA 3SZLA 4ZI5A 4BGIA 4EUHA 4CN8A 3ITEA 4W8OA 3ZXSA 2PD6A 4IFEA 5FOQA 4UUOA 3MTBA 4XGRA 4G8BA 4BDSA 3DMTC 4QXOA 4U63A 4G4JA 4OQLA 1B2LA 1U8UA 1OYVA 3C6MA 1M2KA 1N7JA 3EQ9A 4C0LA 3OZUA 3AU9A 3G85A 3WB2A 5BP7A 2VHZA 3A0RB 4HRAA 4M98A 5L6MB 7MHTA 3HZOA 5FUQA 4BO0A 3ZCQA 3ZGOA 1R0CA 3AR9A 3MTIA 1P9LA 5FWAA 4QO7A 5TPZA 4FCTA 3F1LA 2ZIVB 1Z38A 1MX1A 2GO1A 3ZNPA 4D79A 4G0XA 5J43A 1WVMA 2ZWIA 4CKBA 1G5QA 3H5AA 1M6VB 1PQUA 2OMKA 1PFWA 4XFJA 5DYWA 3RNOA 3WIEA 1Y42X 4L8YA 1Y4UA 2ZRBA 3Q12A 4K03A 4G0OA 3D7SA 4YPOA 4ZYZA 1O2DA 3O2SB 1SVIA 2RK6A 5EZ5A 1XTQA 2BKEA 2BP7B 2HXGA 4P4SB 1DWUA 4MRSA 4DCPA 1QSGA 2FZVA 3OEYA 1AUPA 1Q7CA 2WABA 2W98A 4YRTA 1CBUA 1DEAA 1NLYA 3K6JA 1J2JA 2DT5A 2BH9A 2I6TA 3B9QA 4BUJA 2HDHA 1RP1A 4AXXA 1UPFA 4JUFA 4MWZA 4QGHA 2GJAA 5AVOA 4GUAA 1ECPA 3RJMA 3VNVA 3T94A 4KWIA 1C9YA 2O0KA 4GBED 2VKQA 3PL1A 5CURA 5FBZA 3RT1A 4BVGA 3D7RA 4Q1VA 4U7HA 3ZUPA 1E20A 1RHUA 4E5NA 3IE1A 1H1LB 1NMZA 3AF0A 4PHCA 2AXEA 2B1QA 3VR6D 2I62A 4GYWA 1YC2A 2BZGA 1N6NA 1DJPA 2HUNA 2NYVA 3B52X 4H1HA 3PWZA 3L01A 4GRDA 2AC7A 1D4AA 1C9KA 1VJRA 1E6UA 4KJXA 3G9ZA 1EM8A 1EU1A 2NTNA 4YQEA 3O9VA 1YS4A 1UZLA 2DTEA 3K32A 3PQ8A 4UPDA 5SZIA 3MD0A 1FU4A 3SYNA 1T5OA 3QELB 1MNQA 4F60A 5KTKA 3K4QA 2JA2A 3A6EA 3FNHA 2OHGA 1VB3A 1XYVA 4M22A 5CT4A 4PX3A 2ETVA 1ZPDA 4HGOA 4RD0A 5EQTA 2BFAA 5DISB 1HV8A 3KK0A 2BIFA 4U4AA 5CITA 3R23A 2C77A 3KZ1E 4HF7A 2ZE7A 1J1IA 2WE7A 2Z0MA 4IGIA 4L57A 4N3BA 4AJNA 5LQRA 1Z0ZA 3D3JA 1WB9A 1OAKA 1QIHA 1AH2A 5IEBA 3PLNA 4BZQA 1Z5VA 2UUOA 2E6UX 4CMGA 1IY9A 2HEGA 5C7IO 5KQGA 1JEQA 1W96A 1ZJZA 5LXTA 1IM8A 1ZMXA 2IUFA 5LJIA 4UCFA 1NBAA 3CLTD 3UY4A 2Z1DA 5D87A 4JKYA 4M76B 3PCTA 4N12A 1ZEJA 3OIDA 2WRZA 3K6SB 4NCXA 2PTGA 4N5IX 1E2MA 3G0DA 4BX9A 3QNMA 4E09A 4DUGA 3VNRA 2VPTA 4C0HA 5D5QA 2XVYA 1P7ZA 5JBQA 2JGRA 1I3LA 2YDYA 4Z0NA 4CWAA 3OFVA 3F3YA 5IT0A 1WNFA 1AUOA 4G8JA 2WM8A 1TTTA 3BCHA 1XZCA 3UM9A 5JEDA 5MDHA 1Q19A 2X23A 3IQIX 4JB3A 1MU0A 3QYJA 1GHTA 5JC1A 3G9XA 3BHNA 5J2TB 4ER6A 1BQ4A 2HI0A 2XY4A 1JIJA 1PDWA 3RYFA 2I87A 5KYUB 4FOTA 2DF8A 5CW2A 3E61A 1O03A 5MHTA 1E9BA 1F2TA 3INNA 3IT1A 2C5GA 4J91A 4OEHA 4BBPA 4P5DA 4YT8A 4M9QA 1DCMA 1Y7PA 2WJGA 3QEAZ 3Q40A 1N2ZA 4YK7A 1CUSA 4DT1B 1FXSA 1M1UA 4EB0A 1OKKD 3L0BA 4M38A 3W8DA 4YRFA 1ABEA 2WJYA 3PUHA 4I5DA 4P4NA 5JNVA 5LM3A 5JSUA 3H7AA 4DLKA 4AQYB 2GN2A 3QI7A 1JEAA 1PHPA 2WU1A 5K8VA 1X8XA 3V8NA 4S0ZA 4MB6A 1OYOA 4M9SA 3W2EA 3P9CA 4C4SA 5I9LA 1KQGA 1WXDA 2XWSA 2R25B 2GCOB 3G8BA 3NYQA 5TJHA 2J0UA 3MWEA 4MR8A 4V1CB 3ZY6A 4AMVA 1NFRA 3H19A 1QH9A 2QRQA 2ZTMA 4R9NA 4F86A 2E4ZA 5A0TA 2WG1A 5A7HA 1OX6A 1IU9A 5CA0A 1N4AA 2FPOA 2ZSDA 3C3BA 3K30A 2M6RA 1GKKA 1PEKE 1DFGA 1WJGA 2E49A 2RGDA 1XFAA 3HYTA 3KSDO 3OF5A 4IW3B 2GYYA 2ZUDA 3CZMA 4MX8A 2BOVA 4UTXA 5AJHA 5DYTA 1UPXA 5TEVA 5NULA 4A0RA 1JJBA 3NRCA 5BNWA 1HSOA 5KYWB 5AM2A 1USGA 1OFGA 3KIPA 1PEDA 1W8DA 4KXMA 1ZJ5A 4EB3A 3D81A 4BU1A 4X44A 3W6NA 1FRFS 3LG2A 3MBIA 3PEUA 4LXXA 4UDYX 4E5KA 1VI5A 2G5TA 4QOHA 3F90A 1ZITA 1BD4A 5NLLA 2QQFA 4R1SA 5BSHA 1GZ3A 1YJCA 3KT3A 5EJGA 2P2YA 2CC2A 1WB6A 1MH1A 1DGQA 3CLVA 4YCLA 2CEKA 4KXXA 5K6TA 2XE8A 1LBHA 4GBGA 1JJFA 4Q1AA 4Q15A 3W5HA 4EFNA 2YMQA 3R8CA 3HDGA 1QP0A 2Q5QA 2XA9A 3KQUA 1CUEA 4A8TA 5GIOE 3GEPA 4MR9B 2XNHA 4U9HS 1DTWB 2XGGA 1MGPA 3E2PA 3E3NA 3IVGA 2JGLA 4NENA 1VL6A 2Q2NA 2CN1A 3SU8A 2YHIA 3ZGLA 4CZ2A 5A5GA 3NHLA 3PENA 2ZSUA 1M5UA 2B2NA 3LGAA 4HDQB 4IIUA 2Y6VA 4JJZA 4OHFA 2DETA 4Q9AA 1BS2A 3GV0A 2CXQA 3RSLA 2ARKA 1I30A 2PZLA 3B6MA 2C92A 5FTNA 2HSGA 1RWVA 2FN3A 5JPIA 1VIMA 3AOEC 2XYQA 3GOQA 4H27A 1U6JA 1CUGA 3P9XA 4LRSB 2QLLA 2WU4A 3V00A 2WINI 4I9HA 2NZXA 1E2UA 2QLBA 4ZDIA 4TUYB 1HR0B 2II6A 3RE1A 4JC5A 4B3FX 3VU0A 1K68A 3CT4A 1HBJA 4HNAB 3TXAA 1Z12A 1TB4A 2A7QA 2RHOA 3OIWA 3OTWA 1PNVA 3BA1A 4RZHA 5T3YA 1W85A 3S2IA 1SCIA 3B48A 1U9IA 1XVLA 3A6HA 2G1AA 5FQNA 5J5CA 1YL6A 3NTQA 3RNLA 4ND4A 4QGSA 2BUAA 4JJKA 4NG5A 5JMTA 1TF5A 2MU1A 1QIFA 2VSNA 3CX3A 1XMXA 5GONB 3EEOA 3EPHA 3QPBA 3RRNA 3TL2A 2ET6A 3MWLA 4EI9A 1IONA 3NNNA 4FDMA 4TTPA 1SBYA 2XXBA 3EH2A 1YIDA 3NKVA 4FJ0A 3W8NA 1NI3A 2VAMA 3C3XA 3KVVA 1P5JA 3TSYA 3WBBA 4OK6A 3E5MA 1NQUA 3KXDA 4ZEVA 5BR8B 3WAKA 4FGJA 1UDBA 2BDUA 1C0LA 2RGUA 4NF2A 4OI2A 4KQJA 1YVDA 4CEHB 4OQNA 5K3EA 2GF9A 4RIGA 1QVAA 2AK3A 2R8BA 4KRYA 3ZWPA 4X1OA 1JKIA 4WDQA 5FJIA 2XEXA 2VHCA 1Q0UA 2AN4A 3HSKA 1O94C 7YASA 4M1OA 3GBVA 2Z83A 2FPIB 1VCMA 1TYAE 2P3QA 4JVOA 5IBCA 5LSAA 1OSNA 1L8LA 5BWNA 1C30B 1PYDA 2JLQA 2OVFA 3T99A 1ADYA 2UVPB 3AY7A 4XM2A 2BN4A 1HNZB 1LCIA 5KWSA 3IR5A 2R7KA 1VLMA 2WUEA 2AOUA 3DBLA 2OFWA 1M2JA 4HPXB 4KI0A 4RVGA 5DGIA 3W5IA 4BB5A 4J4BA 3C2QA 5L7WA 1REQA 2HBYA 3CH6A 4G85A 4BVFA 1BXRA 3W77A 1XWWA 3BH6A 3FRJA 3LGXA 2GERA 5FL7A 1PJSA 2Y1FA 4FIDA 2R00C 4GWLA 4NHOA 3FPGA 2QV0A 1PQYA 2JGJA 1OZAA 3I0NA 1QPZA 1V4NA 1L4GA 3RR2A 4CF4A 1VKNA 1QO9A 2RHBA 2VT7A 3DG9A 3OPNA 4FHFA 4P0TA 3SXJA 2W2PA 3TQIA 2HYIC 3QBTA 1LFDB 1SXGA 3U37A 3FPSA 3KHSA 1DRKA 4L5CA 1Z36A 3DYIA 2A58A 2EFYA 2ZI6A 2FSIA 2P4UA 4HEHA 3J81k 1U9YA 1H66A 4KN6A 4M0MA 5ERGB 2QTMA 2H92A 1OR8A 4FS3A 1ZGAA 1L5MA 2CV1A 4YDQA 1FVHA 4AJKA 1MIOA 1N5IA 2QLFA 4N5HX 1JRLA 2W8BA 3A2NA 1LJ8A 1XZ8A 3AF4A 4Q4HB 3TO5A 2Q2OA 2CYCA 1VE1A 4QEZA 1IZ7A 2P9FA 4R9VA 1B7GO 4TWAA 4QJ5A 1P5HA 2NO6A 3Q10A 4RZSA 3FDJA 3FM9A 4D56A 2B3DA 2XNKA 3IOMA 4HVAA 1R10A 4KQ6A 1JGTA 1XVAA 3FPHA 4QDZA 2C58A 4KR6A 2Q8NA 2JEZA 1KC3A 2RGWA 3FWKA 4D5EA 2C5EA 4Z7QB 5C34B 2IGTA 2Q5HA 4WK2B 4DFDA 4FZVA 3TSOA 3WK5A 1RLOA 5FUMA 1CJBA 2WIDA 5DTMA 4CTNA 5IHXA 1RYEA 4AJ4A 5LQKA 2ID7A 3WAGA 2BFMA 4TMTA 3P4UA 4TTTS 4XYBA 5FA6A 2PUVA 2OL4A 3E7XA 1AZSC 1UWKA 3CLSC 3WB0A 2ZDGA 2D2FA 4K0KB 3B85A 4CR7A 1QYRA 2OZLA 4HQNA 4US2R 1JQEA 4LKRA 4RPJA 1LQUA 3UK7A 4C76A 1Z15A 3ZE0B 3V9AA 1XRLA 2X4IA 3B60A 2YYSA 1GPH1 3FSGA 4GX5A 4Q16A 2FPGB 3CLUD 3CCFA 3P45A 1MAAA 4HEA6 1F8UA 4M6WB 3U9SA 5JY1A 1BMTA 5BQXA 1WKBA 3L49A 3UJAA 4P3PA 4FYVA 4PLPA 2QHXA 2E89A 4B85A 1JNYA 5JSKA 3BFPA 3TBHA 3FFTA 1H0KA 1Z4QA 4MP3A 4N5DA 3MRSA 4ND8B 2JHPA 1EJ6A 4URYR 4XSHA 4E5PA 1B0PA 1JVNA 1U8EA 5JXHA 1BXKA 2W43A 3S2SA 4ZFNA 1NVWQ 3EGOA 3KZOA 1DXHA 4IS3A 4DEYA 1L4HA 3AUKA 2G5PA 3BCSA 4JIGA 1Y33E 3ULKA 1XMOB 5FWNA 4F1KA 4QOIA 3TNDA 2XNDA 4QO8A 3EJ6A 3TJRA 4ASUA 5IAJA 2O5VA 2CL7X 1Y1KE 1ES9A 2BGIA 4RV4A 1QCZA 4LZWA 1XU4A 2IKQA 2ODEA 3ICCA 3ONWA 1RBYA 1QB8A 3PUVA 3GGOA 1YU6A 2C9OA 4KL8S 3TE7A 4CG2A 3KETA 4TKVB 2GN4A 4JY7A 4KXUA 1HZJA 2QD2A 3KALA 4NOKA 4QATA 4KZKA 1FQKA 3VPCA 2QJTA 4C3UA 3GGDA 1YVEI 5A2QA 5BV0A 4IQFA 1EUQA 5BYBA 4RS3A 4BLVA 3QKUA 3V2HA 4NXNB 3L93A 5C5IA 5AD1A 2YZMA 5K09A 4DILA 1UCFA 4DRZA 1YNOA 4JASB 3M6VA 2ECOA 5A0FA 3DLIA 1ZUNB 4UVDA 5K3DA 4DG5A 4WECA 4YRDA 1G41A 1Z6GA 4N5MA 2DVMA 2O7RA 2Q3FA 2WG0A 3MCTA 3GARA 3P9ZA 3T5DA 5K0SA 2W42A 5EIHA 4UBLA 1Z4NA 4CLOA 2PRSA 4I55A 4DE5A 5KJCA 3A4YA 2AH5A 1SM4A 2WA1A 1L7AA 1I2ZA 2N46A 3H0CA 4ZT5A 1EGHA 1XDDA 2GETA 3D4PA 3GA0A 4OIFA 1KU6A 1UJBA 1ZI6A 3RRYA 1U63A 4N48A 4MP6A 1O3YA 3AO0B 4ZAXA 2HL6A 1QRAA 2GZAA 2RGYA 3FR8A 4WX2B 3ZEIA 1F8XA 4DR6B 4RF3A 1BU5A 4Z7OB 4REQA 4FEGA 3CVOA 1KEVA 3VPAA 3B82A 4MW0A 4U5XA 1MFZA 3AXSA 2HH9A 2MHCA 4RADA 4EA7A 1G4AE 5AW7A 1MLDA 3B3QA 4P93A 1Q0QA 1WKVA 2G3YA 4G5YA 2X6QA 3NBKA 3S6JA 2IEBA 3D8HA 1CR1A 4EVRA 2C9CA 4Y67A 4R71A 1MZVA 4GX0A 2P2SA 2PPLA 2WG2A 3X1KA 4E31A 1G59A 1NJ6A 3RJ9A 2DQ4A 5ALFA 2QTAA 1ODSA 2PGJA 2SKDA 3PUXA 3MILA 1W1IA 1DSSG 3V32A 4HWKA 5HK9A 3M6XA 3PGA1 2YINC 3RVQA 3NJ8A 1Y3DE 3DB1A 3OE5A 4FLMA 3R5TA 3G2HA 1I6LA 3JQRA 4QUGA 3DXYA 4AX8A 2EQBA 1S5PA 2X1HA 3T7KA 1EUDB 2VJMA 3KPJA 4GX2A 3COSA 4AZWA 4RTNA 3NO4A 5FUYA 2IBSA 1M76A 4DCVA 1P2SA 1A5BB 1CHDA 3NAQA 4F7WA 2H7XA 4ZEMA 2ISCA 5C53B 4LY6A 1YNSA 1DT3A 2WR8A 4XJSA 4YJHA 2VTVA 4OYLA 1ZP6A 3TTUA 4DOMA 4ENPA 3DULA 1O8CA 2FW7A 1EDEA 2WKSA 3ADOA 2IOQA 1U8ZA 2M6LA 2RK3A 1IN6A 4J07A 2C4UA 3HWWA 5BV1A 1XL1A 2XODA 2IS1A 2PZGA 5H81A 2R6GA 3ICWA 3NTUA 2CLEB 1JIVA 1KAGA 4V0RA 1QH1A 1ODIA 2HA5A 5BN4B 1VECA 5IDQA 3O5AA 3ZW9A 2W00A 4POOA 1DC6A 3HY4A 4MVXA 2FMXA 1NQOA 1Z26A 2GSWA 3DEFA 4B71A 2O1XA 3EQ6A 1A98A 4TTAA 4FS8A 1BDJA 1FSSA 2PCJA 2RGXA 4RC9A 3RBZA 3RASA 5KNCA 3RODA 3RF7A 3QUAA 5LNK1 4ENTA 2PKCA 3F4LA 3GY0A 3M1IA 2MSCB 4JL8A 4KC0A 4CMIA 2YV3A 5AW4A 1Y8AA 2HNBA 1SELA 2MR5A 3A04A 3OQJA 3IV7A 2I6XA 2I7DA 4LVCA 5BMVA 1G3MA 2EGGA 3TGPA 4RBNA 4QGAA 4HDCA 1CDZA 2LXNA 1V2GA 2EF0A 1AQYA 3UTCA 4J0QA 3DOIA 3NEJA 3Q7RA 2O2EA 1UBGA 2P11A 4R1OA 3HU1A 5FBHA 4GAEA 4QBGB 4HQ0A 4WOBA 4BWFB 4CODB 3K3PA 1UAGA 3CB2A 2QD3A 3OJOA 4YX9A 1PR1A 3IPLA 1UFQA 1SD5A 3HCBA 4X00A 4CIDA 2AVNA 3HK2A 3DMGA 1Y8QB 3VTAA 4G56A 4QE3A 2X9NA 1W4AA 1U8AA 5FUWA 3ZCPA 5KNDD 1BVHA 2DKOA 2H1IA 2FN4A 4GLLA 5AVZA 2YVQA 4ACBA 5CBKA 1PJBA 2OHOA 5COAA 1RPJA 3ZN2A 4J1SA 4MCHA 2PE5A 3U6BA 3M6UA 4L9RA 2G88A 3JTEA 4UEKA 1XN4A 3VVBA 3SVLA 4B9EA 4RUKA 3NNSA 5JLJA 1ECBA 1FLAA 4A6XA 4E5SA 4RMNA 4OYHA 3V7WA 5JWOA 1JFFA 5HJ5A 4J1TC 1J1UA 2X22A 4HH0A 4URHA 3W79A 5HKLA 3HXQA 3ZNOA 1MTOA 4LHZA 3AHDA 3CCCA 3VZDA 2FZKA 4WXMA 4INZA 3DYBA 1QLJA 1X8JA 4E46A 1QHSA 5EJ4A 1X1EA 2TSYB 1C3EA 1B6GA 2PJZA 4LGCA 3VH3A 2BEWB 3U44A 1NW6A 5IH7A 2FZEA 4BNJA 3MGGA 2F2TA 1U7TA 3I9FA 3HVUA 4IOKA 4PWZA 1EVKA 4B73A 3ORYA 5ECWA 3CRZA 3I3OA 1GZHB 3Q7IA 4R81A 3E9ZA 3K5IA 4QXQA 4ARSA 4BMVA 4PC1A 4PZYA 4JJ7A 3WRYC 5HZGA 4YJ3B 2OV2A 1N7HA 1X3LA 4MHOA 4QBHA 1KSHA 1GN8A 1V95A 5FV7A 4MINA 4ZJPA 1H22A 4JWTA 3ROEA 1V11A 5HQJA 4OGGA 5JQGF 1DIAA 3DHYA 1MEJA 2FPSA 2BFNA 2E5WA 4EFLA 3KSBC 4FGSA 5HZMA 3LC1O 2IZZA 2QNIA 5DM1A 4W5OA 3W8RA 2VZ9A 2OB1A 5ELMA 5GM1A 3I5MA 2ODTX 2OLEA 4OK5A 4P86A 5J2TF 3TW4A 3VX4A 3VYSB 5J2UF 1PT8A 3ILXA 5H9VA 3ZDEA 1R1DA 2XB2A 3EE6A 3WK4A 1I51A 421PA 1HNNA 1GL7A 4GBJA 3U3RA 4XQEA 1JL3A 1HYQA 3I2GA 1XBTA 4PYOA 2WWXA 1U6KA 1LBQA 1VZ3A 1DPGA 4UOQA 1GZUA 3PEVA 1XOIA 3OPYA 4M55A 1QYVA 6Q21A 5CJJA 3GFPA 1FUUA 2NU9A 4MRAA 3TAXA 1V1MA 5LP6F 1Q1ZA 3OKFA 3Q2OA 1YZLA 4NCHA 1PJTA 2DTXA 2DU8A 4JX9A 4R2MA 4AIRA 5IMBA 1S02A 2CMHA 3RS3A 3RFXA 1WF3A 3OOHA 1DQYA 1MDFA 1N2SA 3S1AA 4BQEA 1T2NA 4P0QB 2PS1A 3JU3A 4FFPA 1DINA 1F3OA 4EVQA 3F8TA 4QLOA 3H7IA 4ZREA 2PU5A 3N5KA 3BILA 3ME5A 1E1RA 4UOEA 4TMXA 5EUCA 1CJCA 2XD9A 4CUKA 2WJWA 4LGMA 5LJLA 4ZVTA 2BGRA 3BQNB 3H5NA 2Z2KA 4M0LA 2GEFA 4ZYWA 2BC9A 3UANA 2DFNA 3GG9A 2BEVB 2XHEA 4EW3A 1K6XA 1JU4A 1DBVO 3CR8A 3BAZA 1Q95A 5G53C 3HJNA 4NNOA 4CDNA 5KJ6A 5ERYA 1X7XB 2W4MA 5EIFA 3VO2A 1KMHA 5LOVF 2IGBA 3W3AH 2OESA 4QC2A 3G0GA 3VR5H 3KU4A 4NK4A 3STTA 2PT9A 3ANTA 3P0JA 1BZYA 1PEAA 2EZ9A 2Z4RA 3FMIA 4IFBA 1JEJA 2AI2A 2G09A 3D7MA 2JH9A 3K8YA 3OE1A 2FX3A 1KAEA 5TMBA 3C85A 5FWXA 3DC7A 2JIQA 1PFKA 1AIPA 1LZLA 3LWDA 5AVXA 2XWQA 3KHUA 4WK6A 3F4BA 2PYZA 4KAAA 3TUJC 2FMTA 2I76A 1KTVA 4K87A 1NW4A 3NOQA 3V8RA 5DEOA 3P9YA 5LDGA 3RUPA 4N39A 1A5AB 3T7AA 2AX4A 3ZGNA 2B3TA 2Y8EA 1TW3A 3QFFA 5EHQA 4EI7A 2IXBA 3UHJA 3T34A 1MX5A 4G09A 2I29A 2VL7A 4TM8A 5CFPA 4C0QC 2EARA 3BHMA 2BW0A 2VHEA 5CU7A 5DF1A 4ZZIA 2MSNA 4NCKA 1KQ3A 3WR5A 2JLBA 2G1PA 1R4ZA 4ARVA 1PGJA 1W35A 2AUMA 1SUFA 3GLUA 2J87A 1T3ZA 1T13A 1XCBA 2Z2IA 2ZEJA 4DABA 1DP4A 1JUDA 5EWLB 2A84A 2JGMA 3BWVA 2HUPA 4AFNA 4RK7A 1EG7A 2CD9A 4AC9A 4OHMA 2JZCA 3PTLA 3HB9A 1RHRA 2QOEA 1ZA1A 4JA2A 1L2TA 1TLFA 1HQCA 1T6BY 2LKCA 4N3GA 4AG5A 4GR5A 1Y9DA 1VHJA 3B3AA 2A1TS 3L3BA 3REFA 3EDMA 5DHSA 3ZVMA 4X7RA 1G0NA 2CXOA 3KPVA 1Z4OA 2PA0A 2OYSA 1PLJA 1S3IA 3MMNA 2VSXA 3L0IB 3U1VA 1QG6A 2OORC 1GZ4A 2QIOA 1CP2A 4M1WA 1G7RA 4HXFB 2F62A 2YC4C 4URZR 3RROA 4V0KA 2G80A 3JV7A 2DBQA 3PNYA 5F1PA 4ES6A 4HNTA 1I1OA 1D5CA 4XWGA 1TJ4A 4ZAYA 3LLVA 4KG7A 5L9AA 2FQ1A 2YN2A 4MUFA 4C0JA 5L95A 1P7WA 1BKSB 3HA2A 2YZGA 3HCEA 3IAS6 2E4WA 2XIQA 5LLTA 1TJ5A 2I34A 3I92A 4BJ5A 3ZJVA 3FPFA 3RWBA 1QV6A 4G81A 1AKMA 1JHQA 2P5TB 4IH4A 4YREA 1PVOA 1N4DA 3RS5A 3ETLA 3DBHA 1HL7A 4PX5A 4WN9A 1O97C 4JZYA 3FYDA 5JAHA 3COJA 1GEEA 4KIFA 5IN5A 2NT4A 1C7EA 1T1GA 3FCYA 1THZA 3L6RA 3NALA 3WB9A 4BEBA 4DV2B 4E5UA 1NJ5A 3BL5A 4D26A 1MO5A 2FWRA 2D2XA 2Y0BA 4JI8B 5AKZA 1WXEA 5HMLA 3PHCA 1E2KA 1E1YA 5DI3B 5EWMA 5JRDS 2Z08A 3NH9A 2DQSA 2GS9A 5IUKC 5ESWA 3QKIA 1R74A 1RCUA 4IRUB 3PWTA 1GTRA 1JXQA 1BCSB 1R64A 4XR9A 1O9GA 4RCYA 1YQEA 4S1VA 1T5BA 4L08A 3NVKI 1I24A 3AFMA 1LPOA 1NDHA 3U62A 1SIOA 4N41A 1TT5B 2LBPA 1GCGA 3PQ2A 1ZUWA 3RTBA 1BJKA 4IIEA 1P5FA 1TYDE 4JJ6A 4YAWA 1C7ZA 3IUEA 4YV0A 3TLGB 4MCAA 3PI7A 5DK4A 1M7HA 1IBRA 1QHFA 4EVSA 3FF4A 3KJNA 2CDCA 2JJYA 1N5OX 1R8QA 1C0PA 1FX0B 4GIBA 1ECFA 4RFSA 3WLJA 5J58A 3GLGB 4AUMA 4MRMA 4EGCB 3QIAA 1A9PA 3DF9A 4JBLA 2CZGA 4NP6A 2WU0A 4GOXA 4Q21A 4WGGA 2C0PA 1N25A 3JWHA 1P7YA 2J3JA 2QSJA 3OCVA 2WHPA 2I8CA 1PWHA 3P5BA 4MJLA 5DW0A 1IWBB 3RD5A 3S5UA 2XMSA 3V3KA 3NGLA 3MBOA 2PFKA 2Q99A 1XNHA 4KUGA 1ILEA 1FLVA 1XE3A 2CJPA 3CSUA 5IPFA 4U2BA 1H3NA 2O9JA 3H3XA 5EAIA 1M66A 3UJHA 1AC5A 4IZOA 2WIBA 1NV8A 2YTZA 3I5UA 3FZNA 1OWOA 4GZLA 5HG0A 4NNJA 3UUFA 4GQAA 1EAYA 4L07A 1WW3A 4UREA 3BDVA 4HQLA 4F71A 1QIEA 4YECA 3TZKA 1HDRA 2V4MA 2G5CA 1V26A 3E5RA 3RIYA 4GOLD 4G24A 2HSWA 3OIVA 3ETCA 5AW1A 5A4MS 1IBLB 3RHSA 4KV7A 2ZYUX 3QP9A 3KKPA 4HX5A 4X8OA 3VR4A 5CFQA 4QVIA 1FDUA 1SO8A 1KZ6A 4LRUA 5HW0A 1P4HA 1C3VA 2CF5A 3KCNA 5AHOA 3SJUA 1ZNXA 4DDVA 4ZYUA 1PAUA 3K35A 1DQPA 3TCXB 3IAAA 4EUKA 3HG7A 3KV1A 3S4YA 4EO4A 1NSTA 2VYND 2G28A 3GVHA 5FT9A 3UCFA 4EPXA 4XVCA 1RWBA 2PGIA 3V4ZA 4P92A 5BVHA 1U2GC 4NZPA 2RB4A 2SBTA 3LOUA 4F04A 2B37A 1V5IA 4PYIA 2QRMA 2Y66A 1V35A 1Z0AA 1WZIA 4PCVA 3T9BA 2AQIA 1YZGA 4L22A 1H2WA 4JC0A 2DUUA 4PY2A 1UR5A 2RI1A 2ZVPX 3D3QA 8OHMA 2H7VA 2O3QA 4Y1EA 3G8DA 3DM9B 3AR2A 4H1WA 4IIVA 5AUPB 5CYFA 1NJ8A 1YL5A 2W2KA 3FTCA 2Q4TA 3P2JA 3P9QA 5EVCA 3I62A 1W34A 2FJUA 3O2NA 4W6QA 4AZ3B 2J9GA 2OCIA 2GOYA 4PONA 3VKVA 1NR5A 4TWRA 3Q11A 2R7NA 2I55A 3GYGA 4R83A 2I6UA 3C45A 4XWYA 3WXBA 5ALMA 4EX6A 4B3MB 1G20E 4MGYR 1CY1A 2XCQA 2CXUA 2HY7A 1OJLA 1P0MA 5JZVA 1SKYB 5BQ3A 1GNQA 1VA4A 1SOUA 3FI0A 1EUZA 3IEKA 4BVHA 1BX0A 1QV9A 2XE6A 1JR4A 2NO9A 2HHCA 3CG0A 2FPRA 4A2QA 2IDMA 1JP7A 1BE1A 4OIMA 2Z9CA 1TVCA 5AM1A 3H3FA 4XGQA 1X80A 3SEAA 3CUKA 2GAFA 2VUHB 3AJRA 4XJXA 2P6UA 4NJMA 5AR1A 3FUVA 3UT0A 2FUEA 5CDUA 2VDJA 2XGOA 2AEJA 3PDIB 4C7BA 1T9HA 1Y9EA 5AK3A 3H1FA 5K8JB 4YP6A 5TSDA 5GV8A 4YJFA 1M5RA 2DPHA 4F9EA 4LSGA 5I7AA 4HGRA 4FYYA 4KGXA 4E5DA 4UQPA 5KYKA 2W2XA 3IFSA 4LE0A 3AHIA 1NRWA 1TUIA 2QORA 3BFKA 3UXEA 1VP3A 4HGNA 3J7TA 4CTKA 4FR2A 2I03A 4A8JC 2NU8B 3D8TA 5LYJA 1SMKA 1KKUA 1NXQA 3NH6A 4UEWA 4DCTA 1EDOA 3H99A 1B74A 4XDYA 4MGHA 5TPWB 3H5RA 1X1CA 2APJA 1SQSA 4W9MC 3WNQA 4MUJA 5LBTA 1J8VA 1T3LA 4OO3A 2WJHA 3QU4A 5C4MA 3LGSA 4NTZA 5L6LB 1PJAA 4UMEA 2OG1A 3OLZA 2Q50A 1JBQA 4TVOA 4JMLA 5LA6A 5DWQA 1JSLA 1IIRA 4RVSA 3MWDB 1VE6A 4AIIA 1TK2A 5EEGA 1ST3A 3PE6A 3LKVA 2QUKA 3BERA 5EL0A 2AOWA 2AOVA 2AYYA 2WIAA 3IURA 3HFJA 2BFEA 4P7GA 4P5EA 3H2IA 2PDAA 3P9KA 3WYDA 3CG4A 4WY8A 2I99A 3WZ2A 1QB7A 5MF6A 4W4TA 1BVYF 2OBMA 1AHNA 3PHGA 4QPCA 3OBIA 5DCUA 5DM4A 3ZU6A 1NBEA 4LFAB 2PVSA 3W5AA 2P6PA 5JAMA 2LE0A 3PPYA 1CW2B 3KQVA 1HO3A 1RPNA 2VUIB 3C7CB 1VKZA 3WGIA 3A3YA 1XCOA 2O0JA 2ODWA 1KQOA 3AERB 3IEPA 1GPBA 4JR1A 4Y9TA 3TCNA 3AFIA 4D82A 4JBNA 3DSRA 4HDAA 1GU7A 4H7HA 3FWYA 4WNAB