1ICEA

Structure and mechanism of interleukin-1beta converting enzyme
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
167
structure length
167
Chain Sequence
GNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-1 BETA CONVERTING ENZYME
publication title Structure and mechanism of interleukin-1 beta converting enzyme.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 167
sequence length 167
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1994-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iceA00
3KJQA 1PYOA 2CNOA 4QUAA 4PS1A 2CJYA 4EHHA 3PD0A 2QLBA 2H5IA 2H48A 5K20A 1NMSA 3R5JA 2H4YA 2J32A 3ITNA 3V4OA 4PRYA 3D6HA 5LU8A 1KMCA 2XYGA 4QUHA 3DEKA 2K7ZA 4QU9A 1K86A 1RWKA 2C2MA 4HQ0A 3D6FA 4QUDA 2QLFA 4JB8A 1RWMA 3H11A 5IARA 1NW9B 3BIJA 4NBKA 2CNNA 3P45A 4QU8A 3SIPA 4N5DA 4I1PA 4JR1A 3V3KA 5IABA 3OD5A 2CNKA 2C1EA 1SHLA 2CJXA 4I1RA 4ZVTA 4PS0A 2H51A 3EDRA 3PCXA 4N6GA 5IC6A 4QUIA 1M72A 1RWXA 2FP3A 5IBRA 2XYPA 1I4OA 3GJRA 2DKOA 5IASA 4QUJA 3P4UA 5IAJA 5IAGA 1RWWA 3R6GA 4HQRA 1RHRA 3SIRA 3UOAB 4EHDA 2FQQA 2NN3C 4N6NA 4D3XA 1I4EB 1RHMA 4QUGA 4AWBA 1K88A 2C2ZA 3RJMA 4D3YA 1RHQA 1SC3A 3NS7A 1JXQA 3R7BA 4EHNA 1SC4A 1RWNA 2C2KA 2H5JA 2AR9A 4QUEA 1I3OA 1SHJA 4QU0A 3V6MA 1QTNA 4AWAA 1SC1A 1RWVA 1CVRA 3IBFA 4QTXA 4DCPA 5LU9A 1GFWA 4NOKA 1GQFA 3QNWA 1F9EA 2CNLA 3H13A 3V4LA 2HBRA 2CDRA 1NMQA 4ZVUA 3GJTA 2J33A 4JR0A 1ICEA 4FXOA 4NOJA 3E4CA 1IBCA 4JJ8A 3H11B 1QX3A 1I51A 3NKFA 4EJFA 3IBCA 4IEFB 4IYRA 4N7JA 3UO8B 1F1JA 3KJFA 3R5KA 4NBNA 4JQYA 3R7NA 4D3ZA 1NMEA 2H65A 2QL7A 2J31A 2Y1LA 5H0IA 2XZDA 2XYHA 4EHAA 2XZTA 4ZVQA 2QL5A 3V55A 3S70A 3GJSA 2H4WA 4QU5A 2QL9A 3H0EA 4ZVPA 2HBQA 1RWOA 1QDUA 5JFTA 4N7MA 4JJEA 3EDQA 2J30A 3PD1A 1RHJA 2P2CA 4PRZA 2HBZA 3D6MA 4QULA 4FDLA 5I9TA 1CP3A 4NBLA 4FGUA 4QTYA 4JR2A 1RHUA 4ZVSA 2Y0BA 4N6OA 3DEJA 3V6LA 3S8EA 5IC4A 4DCJA 4JJ7A 5IBCA 3NR2A 4NOMA 5IAKA 4LSZA 3DEIA 3K7EA 5IAEA 4FEAA 4EHFA 4JQZA 1RWPA 2WDPA 5IANA 2FUNB 3R7SA 5I9BA 3KJNA 1RE1A 4HVAA 5LUBA 5LUAA 1BMQA 4EHKA 1PAUA 1RHKA 4QUBA 4EHLA 2C2OA 3R6LA 4NOLA 4M9RA 4ZVOA 3GJQA 5IBPA 4DCOA 2HBYA 4AW9A 3H1PA 4ZVRA 3DEHA 2H54A 2QLJA
chains in the Genus database with same CATH superfamily
3RJ9A 3H5TA 4GOXA 1ZVVA 2CXQA 2HGSA 4NCJA 4KUGA 2YMPA 1J0EA 1QO9A 3ED1A 1CUBA 2B4RO 2JJ8A 2WM2A 3VZCA 1F9AA 4BVHA 4Y2HA 3GDHA 1KMCA 2VSYA 3K2QA 2G07A 1W87A 3TN7A 2RGDA 5EHGA 3V4SA 3TLYA 3T94A 1TU4A 2BBSA 4Q1EA 2FSHA 2JGRA 4IJWA 5BN4B 3IE1A 2TSYB 4L5JA 4O0MA 2AR0A 2Q3DA 1VLZA 3VYTB 2VJOA 5HKKA 1YRQA 1R50A 3GJ7A 2RGAA 2L0XA 1TTPB 2ZK7A 3VU3A 4BLQA 2CV2A 4PAOA 5JECA 1RI1A 1UC4B 3G2HA 1K8XB 2GH1A 2PGLA 3GH3A 3U3XA 3IIMA 4FGKA 1EWKA 3I04M 3LV8A 2GAIA 5HMLA 1J7JA 4OXIA 5KVSA 1I24A 4F6RB 1I4TD 2YH2A 2GBGA 2PAFA 1XJCA 4HRXA 5EUCA 1SBQA 4AWBA 3W5AA 2AYXA 5KTKA 3DO6A 2I2BA 3NYQA 3SZOA 3M70A 3WFZA 5KDOA 5KVCA 3QEBZ 1QGUA 3A6PC 4MWTA 4HXYA 4UZFA 2C9YA 1EUDB 3COZA 2DFLA 2WUFA 3AP1A 4H7FA 3GZJA 3I2GA 1YS2X 3WZ2A 3AF4A 1L7XA 4ND8A 3CURA 4PSKA 2BKEA 3V4ZA 2Z30A 1R4AA 3DLPX 2AZMA 4NJOA 1M34A 4KYUA 1WF6A 2BJHA 4LJLA 4R2KA 3U31A 4CMIA 4O4IA 3R4VA 3SXPA 2NZUG 1IM5A 2PZKA 3ZLVA 2JIRA 3KL4A 4BEWA 2ODBA 2W2KB 1ZEMA 5AW5A 4CR8A 3C7CB 1RS0A 2BHRA 2N0SA 1UJBA 2XMQA 1P4JA 3A4IA 3SKXA 1KAMA 4EHAA 1R8QA 2C96A 3ZHCA 2QRKA 5JDIC 2H4WA 4FGSA 3U39A 2HUPA 1NQVA 4JA0A 4BEBA 2FMFA 3RYCA 1M0WA 3DAOA 1CB7A 4B34A 2GF9A 1CRZA 1V45E 1Q7BA 2J0QA 2B2NA 1UP4A 2B8NA 1OREA 4FDLA 4WLEA 2O2SA 2PH1A 1BXRA 1KY5A 1DIRA 3HJNA 4ZMRA 3OZFA 1FQJA 5EMNA 2XCRB 3IX7A 2XVYA 4S1OA 4AY2A 2DY1A 1ISFA 2OSVA 2YWFA 1M6NA 1XWFA 1NQWA 4PY2A 5FH9A 2YQ5A 1W6UA 2NV0A 2P77A 3TG8A 4C0QC 5KS2A 1KYWA 3E9NA 3FYUB 1DXOA 1KMHA 2BP7A 2JIQA 4DJTA 2KB0A 2XKKA 3ECSA 4EYKA 4XIFA 5DYGA 5GVSA 4B7UA 2VF4X 1YRAA 3DLTA 1U98A 2B21A 1MB4A 5CYPA 3ZW7A 1NF8A 1OX4B 3C8UA 1GUDA 3U3ZA 3FUXA 3KLPX 4X6LA 4BRUA 3FA2A 4TL9A 5HK8A 3PQEA 2Y0CA 3PT9A 4X94A 5A5EA 2VQEB 4N4AA 5KDDA 4IJKA 1RRGA 3JQEA 1VG0B 2X3YA 3GG9A 1G17A 4P0QB 1RPNA 1QLJA 3VJRA 4OHFA 4K0KB 2W2VA 2CNDA 3JXEA 2HEIA 3M6AA 3TO5A 5LP6B 2VQFB 3ONFA 4A4DA 2MYTA 1S3IA 3PFKA 4AYWA 4M88A 2OHHA 3LZDA 4KYIB 3IO5A 4EITA 2VP3A 2YX1A 2YHBA 3M1AA 2UXDB 1I3KA 1SAYA 2F6RA 2UZ1A 2GILA 2R9VA 4GUDA 1YULA 3RSGA 3IL2A 5AUNB 3WSWA 1S5PA 5TGZA 3KUXA 3ZZUA 2IS6A 1E3IA 3HKCA 2GPTA 4CF4A 3U1TA 2H1VA 4AXBA 2VZLA 4TKMA 1NVFA 1QIMA 3K0AB 3Q1KA 4Y2GA 1KFEB 3TSYA 1FP1D 3OE7D 2WFLB 5C34B 4D9MA 1I3NA 3M6WA 1G8KA 3GU3A 4KGDA 4C0XA 5D3MB 4HDKA 2IIPA 3HDQA 4I6GA 1TYZA 1ZD3A 4WZBB 1QIFA 5HIIA 4MJ3A 4E4RA 1T9BA 3HGTA 4PQFA 4Q1CA 1KERA 2DPMA 1A9ZA 2AUTA 2VTBA 1EJ0A 2EP8A 2J48A 3U7QA 2NP6A 1JU3A 1YFZA 2XLBA 2BCJQ 3TLEA 1U9CA 3BFJA 4GI3A 4RD6A 2B8TA 4UBIA 5A4FS 3H9BA 2C2ZA 3DFFA 3G2PA 4LXHA 4PNPA 1CVLA 3QU5A 2ZE8A 1ULTA 2Z4TA 3F3SA 3VR4D 3DBVO 3TRFA 2Z0MA 4M0PA 3L43A 1PRYA 1Z0AA 1A9OA 5J2UA 3C87A 1Y8ZA 4DB4A 3LHIA 3IAS6 3ORSA 3R3HA 1HZZA 4AYTA 5FOVA 2W6ZA 1M2KA 3AFNA 4FPXA 4RHUA 4YRBA 2BSQA 4LSMA 2QW8A 3NKLA 1T5LA 4BVLA 3QKRB 4JR0A 1Z6ZA 3VVCA 1QV9A 3WX0A 3KYDA 2J45A 4TMWA 1N2IA 2H4JA 1QX3A 2WM3A 4J0GA 2A5JA 4UE3S 1SXJD 4QPNA 1T9KA 3TOSA 2BEJA 1R4NA 1B15A 3DAYA 4GW3A 1H2AS 1IY2A 3WWOA 4EELA 3I2HA 3QWBA 1XTQA 3SZLA 4YAUA 4GKAA 4M1YA 2L82A 2EZ8A 2QE7D 4JT4A 1SK9A 4NEHB 3V8MA 3AO0B 3L18A 3MOSA 3OETA 1DT5A 4R98A 4CF6A 3A9VA 3CZPA 5F9HA 3E9EA 1CZOA 5DM70 1KQNA 2FCAA 3VR3A 3VA7A 4LDZA 3PHCA 4L5YA 4BMCA 4NXMB 4XD7A 2QD2A 1JKJA 1SO8A 4GNKA 3WSTA 1WL8A 5FWAA 1YACA 1SKYE 3HCDA 3AR5A 4DNPA 3HFSA 1P61B 1V16B 2D06A 3CJQA 3DJYA 3QQPA 4FX5A 1U28A 2JATA 3GEGA 5I9BA 2QBYB 4NNJA 3K1ZA 1SXIA 4BVGA 4DUYB 4Y7DA 3PP8A 4U0JA 2CZQA 5FLXA 3ILVA 4N03A 4Y98A 3SHVA 5JYCA 2WSYB 3RGGA 2CUNA 2D2EA 3BJIC 1LSUA 1AN9A 2R6AA 3LUJA 4M98A 3OCJA 2QTAA 4OHVA 1J9GA 2DKNA 3NHAA 5EZYA 3B20A 3SYNA 4P7BA 2P1DA 1S8NA 1VRWA 3F5DA 3I0MA 1Q17A 3FSRA 2WIDA 3ZNOA 1JT2A 3FFWA 4UEKA 3HN7A 1VMDA 5ALMA 3IMGA 2FZLA 2R8ZA 1JSLA 2BBWA 2VYVA 2Q1UA 2P4QA 3EG9B 2FOLA 4FYHA 2F1RA 1K27A 5EIXA 1UXKA 4PRLA 3BH0A 1CUIA 1BOFA 1W4AA 5DOVA 2H4YA 4OX9B 2DSTA 3RKSA 3BS4A 4NABA 4CI9A 1I0ZA 1HFJA 1KETA 3NXSA 4DT1B 1L3IA 4IIHA 5ADWA 3TSWA 2DFDA 2RGWA 1PTJA 1ZH0A 3N2GB 4QU9A 5J2UB 5LQCA 4PSUA 4HXFB 1KIAA 1TVEA 4HO1X 1X70A 2OL4A 3BX1A 3I9MA 5ALJA 5EP1A 2K87A 4B0OA 2CNNA 4QU8A 3ZK7A 4TKVA 3QX8A 1Q1EA 3ON5A 4NCXA 5F9FA 4IH4A 2Y2VA 3FDZB 1L9XA 1M0TA 2W2LA 1A9YA 5AXDA 1HE2A 4WZAA 2QKYA 4E88A 5DI3A 3SR3A 4RL4A 1XJ5A 3SHFA 1M6VA 3RC9A 3GF4A 4FDTA 1DG1G 2XNDA 1SG6A 1JQ3A 3MAJA 4UUPA 3JQAD 4O2BA 2EXXA 4OV6B 3FTCA 4FCWA 1QGDA 1ZKMA 2HHJA 4O1IA 3GD7A 2WJYA 3EDOA 1RAHA 3MINB 4LJ7A 1VSQA 5BN1A 4IOMA 2ADOA 3H4VA 3R0VA 4Q15A 2JEYA 3VYUB 1EHIA 1Z2OX 1BWPA 1WMBA 2RHJA 4UHHA 4B7XA 1P4HA 1T5IA 4IG4A 2R7KA 4XIYA 3RQSA 2IBMA 3EVBA 3U4GA 2J4DA 4H7EA 2F1KA 3FETA 2ZCJA 1QFJA 2PL1A 2QMZA 3EIFA 5DHFA 2WJAA 4A8JB 1G8SA 3VR4H 3FNRA 2ZT8A 3R7LA 4FZ5A 3V1LA 1RKBA 1KORA 2PZFA 1BCRB 2DTEA 4JEIA 3DTYA 3HACA 4DQXA 1EH5A 2YV5A 1G6OA 3E18A 2OE2A 4KAJA 2V4MA 3T52A 3GNQA 4IJVA 3E7XA 4NFHA 3J81k 2E21A 2WF8A 4ARUA 3WA6A 5CM8B 3LDGA 1XLVA 2CFRA 4QFMA 1O57A 1PL8A 2P78A 3C14C 3CPEA 2VXBA 2XKBA 3A9UA 1U8AA 1TCAA 4XJXA 4PF1A 2FFHA 4UPEA 1T6ZA 1KOFA 1K6JA 1XHFA 1T3TA 3FZGA 1N6IA 2P2CA 2GVDC 2YN0A 2ZRIA 3GGDA 4KQ2A 3SEAA 4IIGA 3D1JA 4UDYX 4P93A 4C89A 3L0SA 1TYCA 2XCTB 3I5XA 1HDOA 2J6BA 3SS7X 4W5NA 1E1KA 3N86A 1KYXA 5BSRA 2EJVA 3TZLA 4PBRA 4EX6A 4JJ7A 1NV9A 4E5UA 2XUGA 2X0IA 5DLQC 1K08A 2I54A 5U4XA 1KQFA 1H0RA 3TF5A 1DJPA 1IHXA 3G2QA 4CNBA 3OJEA 2PO5A 1K4MA 2JGEA 2OK7A 3SEFA 1EWTA 3AUSA 3IEMA 3KOOA 4OX9Y 1NVBA 1GRNA 3TH5A 3IH5A 3LOQA 1NQ5A 1KZHA 2EKLA 2BFCA 1PFVA 3L7LA 4MICA 3WGQA 4PLFA 3QIAA 4TZ0A 5BSMA 3UXMA 3UPUA 3ZY5A 2PAAA 3X1YA 3HCEA 4ZO7A 4RPKA 3VX4A 1T2EA 4BP9A 5EZSA 2HL6A 5LZ7A 4CKCA 2H0RA 1T29A 1SQSA 2R8RA 2GD1O 2FHSA 3WK6A 2WUVA 1Q0LA 3PE4A 4GVPA 1YB6A 5DYNA 4BE9A 4YRLA 1YTUA 1Z82A 1TJ4A 1I2BA 1CPYA 3PUXA 3N5CA 4KLZA 3TSAA 1ATIA 2ZPUA 4Z1MA 2YOGA 1RM3A 4PHFA 4C87A 2HZ7A 2WBLC 2Y9PB 3F9RA 2YMQA 3PYXA 3ZQJA 4GECA 3NBZC 4JBYA 4D45A 4W7IA 3GDWA 5LNK1 3C7AA 1SZJG 4HAUA 3LQRA 3ESRA 4WD3A 3EA5A 2PMKA 1XFAA 1Z25A 5L3RA 1ZUD1 2XMCA 1NW8A 2W71A 2Z4SA 3GFRA 4TWZA 5E6SA 1DO2A 1NQXA 2ILTA 3FUCA 4C3VA 4I1PA 2PKWA 3KWLA 1N2CE 1SZCA 5EUBA 1VHWA 2QGZA 2AFHE 2HLHA 4UREA 1G16A 5JWRA 1E64A 1WHTA 2X13A 1EX6A 3JZIA 4U0KA 4I7EA 3TLBA 3I6QA 2Z4RA 1D4OA 1PQWA 3D3WB 1U9IC 1HZJA 1CF2O 1YNSA 3FMIA 3BB1A 3KYBA 1VLJA 1KYZA 1LQ2A 3NAQA 1BU5A 2WZQA 4X97A 1BX1A 4QARA 3TNYA 2G82A 2JFOA 2VJCA 5C8YB 3NDPA 3FDJA 1OH5A 2ZI7A 3NM4A 4RY8A 3M5PA 1AQUA 3B7WA 4HDOB 5JDIA 1J1IA 1C7JA 1MG0A 1TC1A 2IBTA 1LY1A 1VPEA 3ETLA 5B55A 3JZFA 3VKHA 3DCIA 3FCEA 4B6EA 3BMNA 1WV1A 1E3LA 5CVVA 2RARA 2NV2B 3EQ7A 1IM8A 1V96A 3F49S 3CF0A 5AVTA 4CVNA 2IOHA 2JEZA 1SD2A 2FPMA 1WULS 4IIYA 1BDMA 1O97D 3MRXA 1EDZA 4UAUA 4U4AA 5FOUA 2Q3EA 4B6RA 4C4XA 3JD1A 1WXFA 1D2CA 4FYYA 4IGFA 1HG1A 5DJ5A 2JGMA 3RYHB 2KMLA 3BWDD 3T4EA 1E1RD 2OV3A 5B1SA 3QG1A 4WLUA 3STUA 1JILA 1MPTA 3EH2A 1XDDA 3B13B 3AKEA 3M89A 1BA2A 1T1GA 3N2NA 2RGNA 3ELDA 3GJSA 3ZJVA 1U2EA 3B1YA 4MJXA 4CQMA 6LDHA 4XUEA 1DQRA 1Z6GA 1TB4A 2HMYB 2M1XA 4JYZA 3T38A 2C8KA 4K5QA 2I6TA 3DM5A 4LMAA 1ONPA 4OM7A 3WB1A 3DC2A 3L7NA 4I1SA 4UUOA 3WFJA 1E3QA 4DIFA 3LKVA 1TU0A 4B83A 3HS3A 2OXFA 1B41A 1RABA 1U3GA 1V3QE 4H08A 1QC5B 4CMEC 5KYKA 1UBOS 4MKIA 1MJFA 3OLZA 3GA0A 4GP7A 4ZEXA 5IYZA 4CGZA 5AKXA 2QMQA 1GUAA 5EWJB 5DCUA 2H17A 1T9DA 1WMFA 4M0KA 4ZDKA 5FL7A 4XQ0A 3LZ6A 2XMDA 2ISSD 3U60B 4BKOA 2XE4A 2KYRA 2X1VA 4DCTA 2BGGA 3ADOA 5LUAA 4MW5A 2I4RA 3MUFA 3Q85A 4MKRA 4UDNA 4RK4A 5JROA 4WKOA 4UC0A 1J42A 1O7JA 1RR6A 2E89A 5ALRA 3RFVA 3GP8A 4S2EA 3FCUB 3HCWA 3QE0A 4KXMA 1PEKE 3RUFA 1YKFA 3W0LB 5D6NA 4DJEC 1BS1A 1OLSA 1MQSA 1K6IA 2IPOA 2Q9AA 3HUEA 2UV8A 4Y6LA 3IQFA 1EWQA 2Q6VA 3TW8A 3LQ1A 2RH4A 1W85A 1F4PA 1F8GA 1GPBA 2M6LA 3F8SA 3D4NA 4XCXA 3P52A 3IJRA 5IDVA 3HL0A 2X4DA 4R7ZA 4Q9KA 4EUKA 1MPXA 2VJMA 4L51A 1BGXT 2W2OA 3ICVA 3R5JA 1TO1E 4GBMA 4IW3B 3R3VA 4F46A 3LVBA 1RRKA 1R6BX 4RQTA 1AT1A 4DMLA 2VHWA 1HQCA 1Q0QA 5IT0A 4PN3A 2MT9A 2BFPA 4FYPA 4EUFA 4RF3A 3WOVA 4G81A 4KSBA 3W8RA 5KWSA 1RI4A 4NBKA 2JK1A 3W9UA 1ZOSA 1I5EA 2HU5A 3OQMA 3THYA 4MW7A 3K8ZA 2Q8PA 1LU9A 4XIGS 1V8BA 5JO0A 3A3PA 4X1IB 3A2KA 4ALLA 1FNCA 1IY9A 2XQIA 2WKQA 1GADO 2B4QA 2YWGA 4DV1B 3S2FA 1V3VA 1E0JA 2RKBA 3ESZA 3S2IA 2F1JA 3I6BA 2AG5A 3CNHA 1HO3A 1IEVA 3H1GA 3LIPA 5DISB 3SXUA 1QRDA 2IZ5A 3JASA 2ORWA 2DLCX 2HT6A 4AQ7A 4CR7A 3Q7SA 4LDPA 3VJLA 4BKMA 1E4YA 2C8LA 4D4LA 3MJTA 4Y9UA 5DDIP 1AQJA 4GVLA 1JAHA 1M5RA 3D43A 4P84A 5DFAA 1DX4A 2E4UA 2EFDB 3EZYA 4N47A 4J49A 3IXMA 1A0OA 4MV3A 1DTWA 1Z17A 1DX6A 3VVMA 3JR3A 1RWVA 4HN2A 3EZFA 4HNAA 3WHKA 2CFIA 1VPVA 2GEVA 3WIUA 4WKPA 3L93A 1IJFA 3EQZA 5E6UA 1E4EA 1L5QA 3AR7A 2GJ9A 1KAOA 1DVRA 3DEFA 2DC1A 1G5FA 5LCXA 2C84A 3T9AA 3WNZA 3ZWKA 4F04A 1DEKA 4Z4QA 1WE2A 1IPFA 3D31A 1R3DA 5DW3A 3COYA 2F48A 4KAAA 4D9EA 4DPLA 4N7JA 3WYGA 3NRJA 2FMUA 4L4XA 3SJUA 1WXHA 3TZCA 2QHXA 1ECPA 5ALTA 2YZGA 3EULA 1VG8A 1V9LA 4WLNA 5DN6A 2NVUB 4BBZA 4YWJA 4G0UA 1OC2A 2YVUA 4JT8A 4DV4B 4J1TC 5ERXA 2A9RA 1GYRA 1PJCA 1VQ1A 4QE3A 4Q4HA 3VR5D 4EW1A 3N8DA 4RE5A 4TTJA 1G18A 1PVVA 3A6EA 3KTFA 2AZ4A 3PHGA 4J3JA 1TADA 1ISJA 4DZTA 3WLHA 2JH3A 2HRCA 2FQYA 3QU2A 4PVDA 2R48A 2NVWA 3U7EB 4RZXA 1ZJ5A 2QUZA 4R9UC 5DHSA 2CHUA 4OYRA 5SY9A 3TBHA 1LI4A 4DIMA 4O5AA 3GJYA 1EKXA 2CBGA 1PK9A 2CXHA 2R6GA 2BKUA 4GOOD 5EZ6B 3UTCA 4PC6A 3UQZA 4DL9A 1SKBA 2HRBA 4GAEA 4UTPA 1RLMA 1YQQA 1ZD5A 3DVSX 4K9LA 3LLMA 3QUSA 1BU8A 3EMVA 2BHSA 2ZVJA 1YZNA 2GK3A 4B40A 4ZOAA 1PDOA 3D7SA 1RXYA 4JI3B 2WMOB 5IBPA 1LI7A 3T4PA 4HNGA 1SCNE 4YDRA 1XD2A 4AW9A 3CKMA 4LOIA 4J8PA 4OI4A 1QQAA 2VSFA 4OHXA 5ED0A 2V54A 3G23A 3H42B 1PYOA 2ZTSA 3WKCA 2WM9B 3N5KA 1MU0A 3TW6A 3ZH2A 4N0DA 7ADHA 5JS7A 2XITA 3O1JC 4X3PA 4AJ1A 1W4BA 4E21A 2X8WA 2HJHA 3HXPA 2OV4A 3KB1A 1LX7A 1NJ1A 4IDEA 4AVYA 2IP1A 4ZVLA 1BEEA 2KSQA 1M2FA 3MCZA 2F8SA 2BGMA 1ZONA 4BQNA 4RLFA 1I30A 3CM0A 4LPSA 3ONEA 1ZJYA 4LGVA 4JZYA 4DB2A 1D5CA 2QSYA 1ZWKA 2WAYA 4KQ6A 2Z43A 5B6PA 3AB3A 5CBPA 1RP7A 2WJ6A 2R8EA 2P9HA 4MWCA 4X1OA 2QRPA 3L4BC 1FFYA 2M9MA 1N9KA 3DR3A 4BJ6A 5CAEB 1C50A 3AJRA 1QYRA 1DBIA 1OFUX 1RIFA 3KR0A 4PRKA 1WXQA 4GOJA 1P1RA 2DY0A 4LC9A 3KZMA 1Z36A 3PLNA 1VLVA 3A9TA 3R6WA 4JBGA 5AHWA 3VUFA 1QE0A 1P5JA 1PSDA 3BRCA 3PQ5A 4IUDS 2DULA 2QRMA 2PHZA 2C78A 3OEEA 4BUCA 4CJXA 2ZYSA 3RDPA 1A5AB 1VECA 1NAIA 3JTEA 3RAJA 1PEYA 1PWZA 4RESA 4C1NA 3BWEA 2WIJA 3NUQA 1CZUA 4EY6A 2F3RA 1F5SA 1XI2A 2DTDA 4TRMA 1UFVA 2IU4A 3ETCA 3F6PA 2FWPA 3NC1C 4IHKA 3OA0A 3N07A 1IEWA 4IQGA 4NAUA 4PYMA 1N1DA 1KDVA 3WGVA 4MAAA 4FMDB 2BMAA 4GNRA 3CZMA 4CIYA 3RK4A 1VSVA 4CPDA 5DGHA 1EE2A 1EFLA 3EUAA 3IEXA 1Y6FA 1Z8FA 4NOJA 2XIJA 1G19A 4LTDA 2D0IA 1EXMA 1E3EA 2P9TA 2QMUA 1HE3A 3AEQB 4HYEA 3UIEA 5HQTA 1X8JA 5T3UA 5LQNA 1BKDR 1MB3A 4DCGA 3UB4A 3BQMB 5ADVA 2EYQA 5H0IA 4BE7B 3DMFA 5KBYA 1CP2A 1EQ2A 2O2CA 3IUMA 3OZDA 3GV0A 4ZVMA 4C6SA 4WJLA 4DN6A 3H5IA 2Q7DA 1YV9A 1XFDA 1CUDA 2QL9A 4KE6A 4WERA 2VHVA 2OGWA 4Y2UA 3W4JA 1E3MA 4KUEA 1QBKC 3K9LA 5CG2A 5KTNA 1H66A 1N5OX 3NRBA 2OOSA 5GOTA 4ZDWA 3ZV3A 3C6MA 4PLPA 2EAUA 1XP8A 3KT0A 4KQ9A 3NHMA 1MO4A 2OZKA 2RH5A 4YA6A 4D74A 3TR5A 1KFJB 4CTNA 2P91A 3QELA 5CW2A 4YUWA 5BSVA 4MO9A 1NYQA 2C8JA 2ETVA 1Q83A 2LNDA 3C4VA 4B4VA 2ZIAA 4OB8A 5ECDA 5EHQA 1ORVA 2PKRA 3TNJA 5CDGA 4G0WA 3MM4A 1QR2A 3D0OA 3RM3A 3EFHA 1EFPB 1NLYA 2QN2A 1ZYUA 5ALOA 3R3UA 2I2DA 1H0HA 2OTCA 2YZ7A 4MW1A 4S1TA 3V1UA 1A9TA 3O4RA 4NBVA 1UJ6A 3M2PA 4DLPA 2XZOA 4NU5A 2P3LA 4BLSA 2J09A 3BIWA 3FPFA 2AG0A 1DDIA 2PUVA 2ZU6A 4XJSA 3G82C 1CD5A 3K1AA 1U9IA 3FCXA 3PK0A 1JIIA 1G3MA 1RAEA 2G8LA 2V65A 4PYNA 3WOHA 5BWBA 1PSWA 1YQDA 3K0FA 3PE3A 2GN2A 3WYBA 2ST1A 4DJAA 3D6HA 2IE8A 4FIZA 3C3WA 1OVMA 2P2DA 4HG2A 1CHNA 3SYMA 2WU4A 4QPJC 2D5BA 1GRQA 4KLRA 4GSLA 3IDFA 3GDGA 4XSGA 4ZRDA 1FY2A 4F6LA 5DNVA 2O0HA 1S7CA 4CCYA 1Q44A 1E7YA 1J97A 2WB4A 2H51A 4NONA 4R01A 3PT5A 2HV9A 1R9GA 3OBBA 1J20A 2A84A 4C2BA 1HYHA 1I4OA 1JH9A 1VLLA 1QZUA 4WLOA 5JDCA 5EESA 3BMCA 3PBKA 1U1FA 1R37A 1Q84A 4C0AC 4RDXA 1QHNA 1J1UA 3IR6A 1THZA 3DBLA 1YR9A 4IWYA 4XPIB 3ED5A 3VC1A 3WLSA 1KYYA 2ODWA 4TL6A 3HU1A 3QU9A 1X7YA 5K3FB 1S3SA 2YN4A 4FYWA 3UENA 3ZGLA 4UTOA 1EFUA 4TYYA 4FFWA 1H9CA 1Y1TA 2D8AA 5ABPA 2EP5A 1AO3A 2FSVC 2G28A 1H0KA 4UPVA 4D99A 4ZPXA 2VYND 4Z0PA 3IESA 1L4NA 3ABSB 4CMEA 2JAPA 3HJHA 2ZSFA 3P2JA 3NJRA 4M8IA 5FTLA 4Q9NA 1A3CA 2GKSA 2AC4A 4PU0A 3WWDA 2BCGY 1E6UA 2ZJOA 4CL2A 2HDOA 4L7VA 1G20A 2AZTA 2O06A 1A97A 1G0OA 4JDPA 2ENUA 4M46A 1IZ0A 2CK3D 2J59A 3OF3A 4JSRA 5I7RA 1GRRA 2VZEA 1ESCA 3FR7A 1A8PA 1I4LD 2B1IA 2Y27A 3G9XA 3MYRA 1NW4A 3N0VA 3U56A 4WESA 2XQVA 3WRWA 1LPAB 2V9ZA 2IHZA 4QU5A 3QYPA 1KEZA 3A27A 5KTOA 4H0FA 1R64A 3TRHA 1V26A 3MWJA 2H11A 4GPTA 3ENZA 3HB5X 4H59A 2OHOA 3RRNA 4GC9A 4BLOA 5L3SB 2Y05A 5CEEA 2IZOA 1T9ZA 3UMCA 4OBBA 2QX8A 3PQ7A 3FNIA 1T5DX 4S1NA 1U02A 2OUIA 1SC9A 3RI3A 3E3LA 3TQIA 4UQPA 5BMVF 3CUUA 4NOMA 1ITZA 2RAFA 3NFYA 5INTA 2B9VA 4YCAA 2QE6A 3ZGYA 2LV8A 4LRSB 3ZDFA 2PT9A 1AGNA 1FRZA 2NLOA 5IANA 1ZLYA 1GSHA 1U0BB 1IK4A 4M36A 1Q0RA 3LY7A 3HJRA 3O9MA 1M7HA 1YUMA 1HDGO 3FH0A 3M9WA 1NF3A 2R11A 3NIDB 3GCDA 1DOAA 4LWQA 4P8RA 1DZIA 1X1TA 2XZPA 3ISJA 4B0PA 8ATCA 2ZBVA 2AKAB 3O9ZA 1SCJA 3TXYA 2DQSA 1KQPA 1K5PA 2GI4A 2IOQA 2RMKA 1PR1A 2B4TO 3AW9A 5DASA 5ECYA 4JASB 3GPLA 3EEIA 4L8GA 2D2VA 4HX5A 4MWEA 4I50A 3KQPA 1E0KA 3WWCA 2ZYDA 4D8VA 4MAMA 4BX0A 2QVBA 4Z9XA 2LXNA 4DIEA 4EHHA 3UK1A 5BV2P 3HCAA 4N9QA 4LZJA 3C5WP 4B45A 3CF2A 1X1AA 3OJ0A 3W5SA 3F2IA 1L4YA 4W9RA 2C9BA 2GK6A 1X74A 1UKCA 1WMSA 3LL7A 3QLJA 4I19A 3VU9B 4V1CB 2C4MA 5T4EA 5A6SB 3RJ5A 1ULBA 1Y5NA 3M2TA 5UKDA 2ZJZA 1L9KA 3N9IA 4QELA 3DLAA 1J90A 1KS9A 1IRXA 3H04A 2JGDB 2XTMA 3OTIA 2I6GA 4F11A 2VQSA 1KFBB 3O8OA 1IRIA 4YRAA 2XCUA 2QI9F 2O8BB 1U7WA 5DI9A 5E8JA 3LCRA 1ZK0A 1BN6A 2BUAA 1YZVA 2PWYA 3LBIA 4OUDA 3GWGA 4GHWA 3P0FA 3ZNQA 3KEQA 2FW0A 1CUWA 1PT5A 2XBLA 2V97A 4KN5A 3ZWCA 3QGMA 3TUIC 3SJAA 4ZALA 4ZYYA 5KJCA 1NXSA 4B6SA 3WLKX 4J29A 3DOJA 5EPOA 1G41A 2GYVA 3LP6A 4QD3A 3P9NA 4F2GA 1C8KA 4FEYA 3UOGA 4U2KA 1JEQB 1GKLA 1Z8DA 3ER6A 3NIWA 1PJLA 2C0QA 4J1TA 3B82A 1BXGB 5TMBA 3U4HA 4C4YA 4C7OA 4JELA 4RF4A 1FLVA 2HFKA 4FCTA 4OEHA 1N1EA 4C7VA 4B8YA 2O7NA 5G4KA 3PVCA 1MOZA 4R9SA 5CA1B 4W8HA 2JD1A 3HY3A 2HMSA 4Z8YA 3UXYA 4KXQA 4MW4A 4P5PA 3K4QA 4CKEB 4ERNA 5K51A 1G7TA 2GZ1A 4NP6A 3TMKA 3T0FA 1X7ZA 1Y4SA 2WUEA 4LRXA 1MAWA 1ECCA 3E4CA 1ZH6A 2NZ8A 3PJGA 2O4UX 4B31A 1ZDMA 3O4FA 4JYAB 5AXCA 1XV5A 3KJFA 3KZCA 2GSDA 2QW0X 4BC0A 1NAHA 3HYCA 4DBZA 2W2MA 1I33A 3ND7A 2WJ4A 2ZDHA 1SC6A 5I5EA 1ZN8A 3AHHA 4AYXA 5I9LA 1CV2A 1N25A 4WW0A 4DFDA 3T54A 2G6TA 4IGAA 2EKPA 4Q82A 3TJRA 5EIOA 4EGFA 1QHIA 2OFFA 1FS6A 3WKAA 4TSRA 1YQTA 4E5KA 3ZWOA 1N34B 1KGDA 4DCCA 1LDNA 1Y3DE 2DUUA 3LQFA 2P90A 4LXUA 3HPQA 4WFKA 5H3HA 4N6OA 1FTQA 5EPUA 3C6BA 3K9GA 1OVGA 5IBCA 3ZE1B 3D64A 3AGPA 2Q27A 3K8YA 3ZVMA 1FXWA 3GLFA 4IHAA 1DEAA 3HRKA 3DEIA 5BV1A 3JAMA 3RVSA 3SAJA 4RX1A 3V1TC 3OG9A 3U1BA 2JLUA 5B3AA 3T35A 3TQCA 1A5TA 4HDRA 4ZC1A 2VSOA 3PPXA 1S8AA 4TLLB 2VSQA 5JUWA 4QBIA 4JH0A 5FWDA 5IN4A 3AIIA 3ZUPA 3WISA 3WHPA 1TGYA 1C4WA 1UDWA 5KYXA 4Q37A 3RS8A 4AIRA 4EA8A 3GN1A 3CZCA 1JWBB 1WP9A 1XTTA 2ZB4A 3ASZA 5B2FA 4EK9A 3AYZB 2B1GA 4KBGA 4TS3A 4K26A 3OKCA 2J9YB 5E8RA 4E2ZA 3ITDA 4BMYA 5LSAA 1CJTC 1E5DA 2FTKE 2I71A 1LPPA 3OIVA 2ZWAA 4E0BA 4IIJF 2X6TA 4A3SA 2OUKA 2IWHA 1CE8B 3K0KA 5AOVA 5E9JA 4F21A 4PHGA 4QOSA 3E0XA 3HP4A 1RI3A 1P33A 3PWTA 1BQEA 1M2VB 2HXGA 2PJUA 2WTEA 1F06A 4J1SA 1CNEA 2CLHB 2FP4A 1QYDA 4FHCA 3QVMA 4TKUB 2NV6A 3HQ4O 3UZUA 2XVAA 3W3AH 2KLBA 1IOWA 1DXHA 4GKBA 3WLJA 4CV1A 1UADA 2P0YA 2V45A 4Z4IA 1PF7E 3DE2X 5LLDA 4ZV7A 1QHHA 1I1OA 3TLGB 1WQ4A 2A9QA 4I5GA 2AWOA 3TFOA 2X0NA 3OC0A 3T5MA 3HVKA 1DFGA 2VHJA 4D6PA 1KYVA 4ZT5A 4TLEA 1M0EA 1NXPA 3GEMA 3QQ5A 5TC4A 3MWDB 1HA3A 5TJHA 2VJAA 3VVBA 3GGCA 1NTRA 3PDHA 1Z45A 2I2WA 1WZ2A 4PX9A 3JQFC 3LBNA 1I2MA 2FLVA 2YFQA 4HMPA 4B3HA 4KUHA 3G85A 1JMKC 4Q4AB 2QTBA 2VUUA 4N5LA 2IXEA 1XCPA 3M5DA 3I1JA 2VH1A 3HEAA 2EGGA 4ZOCA 4ALMA 2Y67A 3GLGE 1NKTA 4QNRA 3TVDA 4HQKA 2H8GA 3NYRA 2B94A 1G8JA 5T8KC 5E3HA 1DT3A 5FBLB 3DLIA 1Y3IA 4U8GA 3RUIA 3WLFA 4C88A 4R1PA 3TLJA 4XD2A 4H7PA 4AD8A 1K4YA 1JKMA 4FQ8A 4B3BA 4P5EA 1RYZA 2YXBA 3LDHA 3ORHA 3OSZA 2WVGA 3KCNA 4I4TB 2QX7A 4PG5A 5LBTA 1H3EA 2VK2A 3E03A 3C3BA 4L74A 5HPYB 3CF6R 1U2PA 3NTVA 2ZJFA 2ZITA 4EKDA 4P4GA 1IBCA 2XODA 3G2NA 2CVHA 3KSUA 3ROMA 1R0KA 1HSOA 2CYBA 3AYXB 3GWZA 2A92A 3L0BA 4LX0A 4G5SA 1NYTA 4NAVA 3C7KA 4CM6A 2Q62A 4DSAA 2H0AA 3B1VA 1ILWA 1K0UA 3IT1A 1PGJA 4YAJA 4YRSA 1ZJJA 4G0NA 3HZZA 5P21A 4L57A 5IC5A 2VDLB 2J5KA 2AS0A 4I1OA 1KFKB 4LQCA 1XNGA 3V9PA 3EXEA 3KT3A 3P9RA 2PRYA 4Y1GA 3W5JA 3EXHC 5FB3A 5JI2E 3GX1A 4FZRA 4IDGA 2C7VA 3RHTA 9MHTA 3CYFA 1IFXA 1NW6A 1FX0B 2FETA 1IY8A 3IUQA 2OZEA 4HJXA 4CKBA 2WD7B 1KY3A 3HB7A 1XZJA 3OZUA 1GAQA 3COWA 1QHYA 2XUFA 4RM2A 5HS4A 3K5WA 1G21E 4NFSA 4RY2A 5H80A 2PJDA 1C9EA 5JMTA 5DM0A 2IZZA 5A6VA 2WVAA 1H1DA 4K7JA 4IDOA 4GGMX 3A9SA 9GPBA 4WLFA 1LK5A 1N8TA 3UGQA 3EYWA 3GRZA 4LDNA 5TT0A 1VE5A 2O0JA 3I37X 3DO5A 4LJAA 3HM9A 4YXFA 3KBOA 3O2JA 3GUZA 1KJZA 1YHYA 3QVLA 1TM5E 4A2CA 1VKHA 2X41A 1W8DA 3FW1A 3DF7A 1NOIA 2C5AA 2VDUE 3AI7A 4BXOB 2HMUA 2C5HA 3VV3A 2GAOA 1EXVA 2BMVA 4B48A 2BOVA 1A82A 2YOFA 4MV8A 3RC7A 4BMNA 3D4BA 1M1NB 1PW7A 3IBGA 3WXBA 3PUVA 1KPHA 1PI3A 1Z0JA 2H48A 3LWDA 4F84A 5CXSA 4CW7A 2DBRA 1IN8A 3IHLA 4RYDA 1SXJC 4EKIA 3DMGA 5F35A 1YF3A 1M73E 3B2EA 3CU5A 4H1HA 1Z5NA 3HN2A 3OESA 4ISBA 4WTOA 4G65A 5KHOC 4RSMA 2R62A 3PPWA 4FEEA 3A4TA 3I5UA 4H31A 1NBME 4UNPA 3H4IA 3ZI7A 2HSZA 5JQGB 1G5QA 4X6XA 4F4CA 5AVUA 2W22A 1OIWA 2BDEA 3SX0A 3KC2A 4DMKA 3E9QA 3AEXA 4GPAA 4RKQA 2OVFA 1DQZA 1JP7A 2K2WA 5AW8A 1SHZA 4ISCA 4K9OA 1K1EA 1M6HA 1OAKA 1T6BY 2L2QA 4GYKA 5CIWA 3DMTA 4EF5A 4NBWA 1URPA 4DCNA 4UARA 2NP7A 1R5NA 2FJUA 3HKEB 3PHLA 4KO4S 2O2IA 3E53A 4PSCA 5AXAA 1PT8A 2OBFA 1GZ5A 4RHTA 3MLBA 4Y6OA 4IMJB 4QXPA 5FPYA 3UMRA 4WCDA 3TNFA 1E58A 1X92A 1G5TA 1ONBA 1LDGA 1RWNA 1Q1BA 2DU8A 2LIPA 3C7TA 2QIOA 1DWUA 4MV1A 3FI0A 3OLVA 5T57A 4CMGA 3LGAA 4YAKA 4A8HA 5I4KA 2IHTA 2XTAA 1S4QA 1HRDA 3R1IA 1AQLA 1XZEA 1E79D 2WTBA 3CKKA 1U90A 1QH8A 4BQQA 1XVUA 1WDWB 7MHTA 1V6CA 1Z08A 4G1CA 2JJ2D 2QRVB 2TYSB 3LP5A 4XR4A 3DFMA 2VNHA 4K9NA 5K3DA 3ME5A 1DV2A 1R1DA 4FFRA 4JOSA 1KQOA 4Y2YA 3NHUA 3NMUF 3C5EA 5HQ3B 1Q1NA 4FINA 1CUVA 3QEAZ 2G70A 3E1GA 3V55A 3ICWA 4M3NA 4DW8A 3TPFA 3TQOA 4D3SA 3OTQA 3C74A 3K2BA 3T7SA 4JJIA 4F4UA 2WOJA 4JDUA 2JCGA 2OYSA 4WH0A 5A3JA 2QJTA 5AI4A 5HSGA 5IJ9B 2EX1A 3AEUB 1Z8HA 4QRDA 3U3MA 4A5OA 2IYVA 3SF0A 2OHJA 2PX4A 3KFXA 2WMNB 1P91A 3C70A 4J16C 1VHDA 2W70A 3VKUA 4OKIA 1DKNA 1DLJA 2EZ4A 4YP0A 1NKSA 4LOJA 3F6SA 4ZT3A 4ENUA 5JJKA 3AJAA 2JFYA 4HAYA 1FDWA 3DKVA 2CYAA 2A67A 3QWFA 4W5QA 1JEYB 1EINA 1WB4A 4PC7A 5DEIA 1T8RA 5BT8A 1RQRA 2GFQA 4ARBA 1JDUA 4GOLD 5KOJA 5L4LA 2VA8A 4TN5A 4RFLA 3H9JA 2BI4A 3AFHA 3DQQA 1LBHA 2C2WA 2OCGA 4OTZA 1E9SA 4S1VA 3WGJA 5ALWA 4Q1AA 5ENVA 3PICA 4PPNA 2Q5QA 3RJTA 5ITSA 2JL1A 4LHZA 3IA7A 1G59A 4C4TA 3F9IA 8OHMA 3W6PA 1GR0A 3EQ9A 1WNTA 4MJ7A 3LP8A 4QUAA 3ZKAA 1SR8A 1Y9EA 2WYIA 2IPAB 1Z18A 3AUYA 3UCFA 2HWKA 1J7KA 2BEVB 2QM7A 3DKPA 4R05A 1RAIA 1ZSVA 2QD5A 2IJGX 3W2TA 1O5IA 3PHHA 4II2A 4Z0HO 5EY5B 1S8FA 2F3SA 3BA6A 3GGGA 1GAWA 1UZUA 3ELYA 4GL4A 1P5ZB 5C4IA 2ZU0C 1ORHA 4IQ4A 1JR3E 1QYWA 1QGYA 3KJGA 5HK9A 1J33A 4UD6A 5KNBD 1U0RA 2AE2A 2GK7A 3FWPA 1F51E 1SIWA 3WKBA 5JCPA 3GPDG 5EN4A 4UM9D 5C8XA 2GDZA 1OH8A 3ER8A 4L5CA 1F4LA 1B0PA 1JDVA 4ZKEA 1JW9B 1TZMA 4GM4A 2AT1A 2ZG6A 3D8HA 1N5RA 1P77A 2MSWA 2XECA 4FN4A 2XJ9A 4IMPA 2YRXA 2WIBA 2DHCA 1AV7A 1U4OA 2FEXA 3R7WA 2EKQA 4OQQA 3VNUA 2B6NA 2VAVA 3SR4A 1FTGA 2OXTA 3VZBA 3B53X 3AESA 4H1WA 5KEIA 5AW6A 4G07A 3MTDA 4S35A 4I9HA 1RHMA 1JB1A 2XLCA 2I7TA 1E6CA 1TJ5A 3LKDA 3MWEB 4LGCA 4NIMA 4ACAA 4ZJZA 3F7NA 3HVHA 1ZZGA 3DE0X 3L4SO 4OHPA 4OQFA 3NDRA 3IAXA 3OZVA 1SWWA 3IUNA 4RNCA 1IBMB 4FNGA 1U6JA 2Z95A 1X7HA 4ZHQB 2W93A 3LH5A 1VCHA 4YJGA 4YRTA 1HUQA 1X8LA 3IGFA 4J4TA 3W3ZB 3COJA 3X1WA 2C99A 2FE1A 4BMVA 1DPFA 2YZ2A 3CVOA 4H6WA 4CIDA 5ER9A 2Z5VA 2ZUWA 2ZP1A 3AUXA 3C16C 2FPOA 3R9KA 3B6ZA 2JDIA 3BH6A 1N5IA 4QGSA 5EJEA 4E22A 4HNTA 4QT0A 1NWCA 2CN1A 4Q1FA 3F74A 4FFPA 4MYSA 2ZDGA 5JY6A 2DGDA 1ENPA 3ROTA 2LD4A 2RHGB 4JGIA 3NW9A 4FM9A 3NHLA 1IXZA 4UM7A 4OAQA 3PZRA 4MYHA 4RA6A 1GTVA 3CB4A 8MHTA 1YBFA 1ZXLA 2VAPA 5IUJC 2E5WA 2LCFA 5BSKA 1EM6A 1KO4A 2YQ4A 5A3SA 4BAUA 2WSLA 3BCSA 2VK4A 3D6MA 4OOFA 3WQBA 5LQDA 3VSBA 4HI0E 1XK6A 3BHJA 4JQSA 1CUCA 3Q0IA 4UCWA 1N75A 2LCQA 5IF9A 5BSUA 1Z2AA 2E0IA 4FI3F 3WKDA 5FLEX 3HGMA 1NUUA 1FFAA 3ZOKA 4XH9B 3LXMA 2XRFA 2O6HA 1AKRA 3ZWVA 2FAXA 4UFOA 5AVWA 4MUHA 3AOEC 3U37A 2IBSA 1P6XA 3HADA 2AL7A 2E2WA 4JP3A 3VOAA 4WNYA 3IKTA 3AUTA 5LP6F 1CVIA 4QA9A 4Q9JA 3WLPA 1J2YA 4BNWA 3W9YA 4HQ6A 2XUDA 1CJVC 5DZSA 4WWHA 4CLDA 3QUTA 4TVSA 3TRKA 4W63A 4R2IA 3EIXA 2Q9UA 2HGZA 3WK9A 2F43A 1FXSA 3CNLA 1YT5A 3PFBA 4GXTA 1VCOA 2F4VB 1G5RA 3SCZA 3OIDA 1XLTC 2PXHA 4PXSA 4UJ3A 1ATZA 1Z88A 3T9BA 4HMQA 2QQGA 4ON9A 1PNTA 3UICA 5IKEA 3O26A 5BVHB 3GROA 2NQTA 1K2WA 4N1AA 4AQDA 3L6EA 1W94A 2HCJB 2ON6A 4L2IB 1DKPA 3HCCA 1W0KD 3N8IA 1O97C 2PS1A 4L7QA 2P5UA 5EVCA 3KQLA 2OBMA 2JHGA 4V3CA 4EYGA 4Q7QA 4EJSC 3TLXA 4WEQA 5F3DA 4MR8B 4JLBA 1COZA 1L7AA 4Q1BA 4WGFA 1DINA 3KTAA 2XA1A 3O6VA 1PEDA 1NZFA 1JDPA 4RABA 3E23A 5T8KA 3ZHOA 3JAKA 1HLGA 1JZTA 1JMVA 1BAPA 5DX1A 2X86A 1D2EA 3DVQX 2VT3A 1WVGA 2PCLA 2V0NA 3L0DA 3QJGA 3STVA 1EJ2A 2W2TA 3NGXA 4RW0A 2FRDA 2VEOA 2QG9A 3CRVA 3MT9A 3NONA 2LKCA 2ZAMA 3MTAA 1H4SA 4WT7A 1BS9A 3C6YA 3PC8C 3WGUA 5C8DA 1ZRSA 2ZZKA 3IVMA 5JMPA 4F9TA 1A95A 5BQ3A 2HA3A 1H5UA 1L5ZA 4YMIA 4PCAA 4F6CA 4MUEA 1FJXA 4FQ5A 3WK5A 4OXKA 4N82A 1OH7A 3V4RA 1IXRC 2REQA 3MTJA 3HCFA 4P7GA 1SA0B 3JQPA 5EXSA 3BE6A 2Y1FA 1FU4A 1VSBA 4BNVA 3BFXA 4EM6A 1U2DA 2EEPA 1Q14A 4DDKA 3VPSA 2AR9A 4EG7A 2CNBA 3RKRA 4LF5B 4REQA 3BIXA 1TKBA 3SBDA 3QEOA 3CB2A 5SY6A 4HB0A 3SIXA 5AUPB 1XF1A 3EXHA 4FUTA 4UXHA 3AF3A 4ARIA 2ZWOA 3PR2B 4HWSA 2J8ZA 2D2FA 2H1IA 2PZBA 4CN9A 1T1EA 3OE7A 4BFWA 4ESVA 2ZIFA 1RJ9B 1G1MA 1NN5A 1UAYA 4CG2A 5BSEA 3C0KA 4B5KA 1TJ3A 1BH6A 1N32B 1E2EA 3A1EA 3GFVA 2V03A 2J9RA 3AM3A 4F4FA 4WKCA 4LBYA 4KFCA 5L4SA 1L4HA 3AJ9A 3CGWA 2QG6A 1QRRA 2E49A 4R69A 5C1PA 3PGA1 1VKNA 1ZESA 4MRMA 2CHGA 3HDJA 4Y6RA 3KXPA 1B6TA 4GQIA 1F1BA 1FP4B 5JASA 2A5DA 2H5LA 1KKLA 3H17A 1DIOB 4HFJA 1ETHA 1W581 3KPYA 4HJRA 2ZXFA 2BR5A 3DH0A 5M2QA 3VR4A 3UGTA 2CLDX 3UTDA 1J5EB 3GLHA 4LRQA 1KEEB 5KKAA 1V7ZA 2FEOA 4OP2A 1YE8A 5JPCA 2P2NA 5HJ2A 4G0VA 3D1VA 1VHLA 3Q0TA 4HBZA 3WWEA 2ZZMA 1XPRA 4H6XA 1KO7A 1P45A 3ZHVA 3G49A 2J3EA 3LT5A 5DHRA 1QNFA 4CL3A 1OF1A 1ONSA 1R0WA 4V0QA 1EG2A 1MB2A 1IXYA 4Q9IA 2HLDA 1QIEA 5HUQA 1CRQA 1RPTA 3WLEA 2DFNA 3I9JA 2AJTA 5ECWA 3HR4A 5TPWB 5KYWB 1AUOA 1YDFA 3D6UA 1GN9A 1GG2A 2JIZA 3B52X 3GW8A 3P5SA 4ZO6A 3SOZA 4GWLA 5DSTA 1IXSB 2QTFA 1IBLB 1GVHA 2FX5A 5ANRB 5GOZA 2GJSA 1ZJZA 3KE8A 8AT1A 5G2OA 3K0BA 2QM3A 5G3ZA 3STTA 5FOXA 2CNOA 4BGEA 1GG9A 3PJRA 2BKAA 2IOFK 5A5FA 4DMCA 3MJVA 1G4HA 3U4MA 4P4LA 4WHMA 1MX9A 1OQAA 2BWJA 3H6KA 4BLPA 3A4YA 4QDTA 4K0RA 5I7OA 5D3QA 5K20A 5JS2A 2ZIXB 4LRUA 3OZTA 5BY2A 4AP9A 3JSAA 1YB1A 1ZD2P 3I8SA 1EK2A 2XYGA 3M33A 4G36A 3W5HA 2L69A 3M4JA 3OPXA 1CTQA 1M8FA 4IX9A 1M8PA 1RRMA 4OQ4A 5B4TA 2UYHA 2ZQ5A 4IRXA 3CUYA 2PLWA 2BIFA 1ADCA 2ATIA 2ZB7A 3PUZA 4E46A 5C18A 3H1TA 5FUBA 1H85A 5F76A 1O4WA 3AB8A 4EGJA 1LA2A 4WY2A 1EGQA 2ROQA 3GJ4A 3OX3A 3U40A 3NOVA 4I1RA 4J0EA 3DWGA 5U4QA 4F85A 4FONA 5I7VA 1OWNA 2X3FA 4FDUA 5EINA 2HF7A 3IYLW 5JNWA 2FPPB 2P65A 1W0JD 3UY4A 4JOBA 2C3UA 4CETA 3C1AA 5D3KA 5GJWC 4C0SA 2P67A 4YQEA 2J1LA 2R86A 3NWEA 4ZEVA 5KYYB 2C2GA 1L7OA 3P71T 1CC1S 3OJFA 4NAHA 1A2OA 2BISA 1Z5UA 2EEZA 2HNAA 3BWMA 4G5QA 2QENA 5T64A 2EP7A 3OKAA 3VDXA 1N5LA 3HVRA 1P4AA 3KT6A 1QP7A 1QYXA 1MQ9A 4J7UA 4UXJA 1ZD1A 2EJCA 4WNAA 4AZ3B 4GMXA 2X4LA 4EPWA 1NUHA 1SKYB 2H5JA 3UMMA 2BEWB 1RBMA 3MJDA 2VPZA 3I42A 1KI3A 3WL3A 1SBHA 1XGKA 3B8EA 4J16A 4G89A 4BCBA 3BF7A 3EGOA 2XF8A 3BYZA 4L3VA 4Q18A 1W44A 3EVEA 4IDDA 2F62A 2DXIA 4I55B 2CDRA 4KJXA 1GRVA 1MGPA 4G5YA 4B6JA 2ALJA 3I9KA 1L7DA 1I01A 1KI6A 3SHTA 1VOTA 3D3JA 2O1XA 5THQA 3EH1A 3DFZA 1NFFA 2FPIA 1JIVA 1M2EA 1ZIYA 1GQQA 1RBYA 2J31A 2WWXA 3H1EA 1XKLA 2YOHA 3KHSA 4B6FA 1WA5A 2XE7A 1L4FA 2XVMA 4N0PA 4BFLA 4NJEA 3TLZA 1GXSB 1KC1A 3HMKA 2OA0A 3ZLTA 2PH7A 1WZCA 2QXYA 1K3TA 3OX1A 1D09A 1Z33A 1QDUA 3D4LA 3K16A 2XRMA 3PL1A 3QUBA 3PDIA 1F0YA 2OV6A 1V48A 3UJHA 2P6OA 1Z4OA 3KOUA 1SCIA 3H9EO 2LZ0A 1WLYA 2PN1A 3D2BA 3F67A 2ZT5A 3QPDA 4RNDB 1P1FA 3W1EA 2FMTA 1RHUA 4J4BA 2BF7A 2OZPA 5TF4A 3ZZ0A 5C52B 4HDAA 3CUEF 2Y68A 5AK6A 4G4GA 4URXR 4MR9A 4CIBA 5ALHA 5FOQA 3TL6A 1ESEA 1WBJB 2OCYC 2YZMA 3G59A 4MITA 5EYPB 2YV1A 2A86A 1KHHA 2WUDA 1W73A 4PFSA 2YVAA 4RQBA 2V7QD 4DYVA 3UG6A 4G1MB 3I3OA 5CHYA 1T8YA 2RIRA 4CV0A 1UKYA 3E2IA 3I64A 2QRQA 4ZQGA 4MVJP 1T9AA 1P0MA 3WP0A 2NXEA 2HA2A 3K70B 1ISGA 2CNWA 2I6QA 3IQWA 3KVVA 3IPCA 4F2WA 3KB8A 3JQGA 1HFKA 3MZ0A 2EW1A 2FPUA 1TMOA 2GFIA 2AB0A 1FBNA 2IUYA 2VRWA 1VBMA 2W6MA 5JH7A 1IY1A 2SNIE 2NUTA 4BAGA 1EDDA 3IUEA 3VNRA 4G37A 3U7HB 3MJEA 4B6PA 3MQFA 5G1NA 4INZA 2PA3A 2AD5A 2HF9A 3EW9A 2CLKB 4JC0A 3ZHSA 5B7NA 3HHPA 4L4YA 4OG2A 5E4FA 4N5MA 1MH9A 5KSWB 1L5NA 1N7GA 2DFKB 4KDEA 4MPDA 3X1JA 2ZSHA 4XVRA 4CT4B 3UATA 4UOZA 1A9QA 4CM5A 4OREX 5TR9A 1AGPA 2AN1A 4IV8A 3WAGA 1U2SA 1OZGA 1P62B 2Y93A 4IR7A 1PYGA 2F8LA 2YNMD 3R74A 4ND3A 1OIXA 1KDZA 3OCYA 1WPRA 1AURA 4MEBA 1TXGA 2JGAA 4HLUC 4XIIA 2D0PB 5GONB 4CDNA 3EGIA 5HF9A 3GA7A 3MXOA 3BILA 1QU2A 3ADPA 1PFKA 4J2HA 3J7TA 1DARA 4KGXA 1MW9X 4LRYA 1S2NA 2B99A 1O6ZA 2PSHA 4H2DA 4PBTA 4S3MA 3ZD9A 3ZE6A 1F3OA 4ZCIA 3OZXA 1X8XA 1CK4A 4ZCTA 4CKZA 5K6RA 5KTSA 2WA2A 4WK0B 3A6FA 5JZSA 3GZNB 4A15A 1SKMA 3DNFA 2IW1A 3MUOA 1Y5LA 1DQNA 3G5AA 4PG7A 5JZOA 3ZGZA 6Q21A 2P9QA 1R6AA 1UM8A 3DUFA 1JALA 2NUAB 1V5WA 1PWYE 3HYNA 1E5LA 4MYUA 4ZOLB 1J6UA 4O4HB 4KPFC 3H1FA 4IGIA 3H83A 4P9NA 3QMWA 1ND6A 4ZRNA 1ZIDA 3DDOA 2EKZA 3N87A 3TRJA 5FOTA 4R0MA 5C46F 1A69A 1XTSA 2NO1A 4PHCA 4DIDA 3FCYA 2UYQA 4MWBA 2OCKA 3NBQA 1ULAA 1WHSA 3G1WA 3R24A 4ZAVA 4JLUA 5HFJA 2XDQB 1VE6A 4NULA 4GOKA 4X84A 1SZDA 4FSDA 4JJGA 5EXPA 4CM9D 4ZT2A 1U0EA 4MS1B 1KC3A 5BR8B 3AOEA 3JQ8B 2PMFA 2Q4OA 4Z9BA 1T2FA 4A6XA 1MC4A 4DIKA 5E7IA 1HORA 2EG5A 2D3WA 2EQBA 2VLBA 4ZYXA 1FRVA 2HA7A 2FDXA 3WYCA 4V0SA 3MTIA 3ZV5A 5TRTA 3UC9A 4F3CA 4NBRA 1XLTA 4Y8VA 4HWOA 5A4IS 2HYIC 2XA2A 3KVNA 1B16A 3OP1A 4WPGA 2FR8A 2KLHA 1RTKA 3AG6A 4TXMA 2Z8YA 3V00A 4Q1VA 3WQSB 1N7JA 1NW3A 1NI4A 5ICGA 3ADDA 5I5GA 4CIAA 4RKRA 1T0PA 1MX5A 2ZWIA 3HB1A 4GM1A 3MB8A 5FF9A 5C3UA 3TAUA 2QPTA 1KJIA 4JC4A 1KI7A 1N2CB 1A7UA 5CFRA 1AM4D 1TTTA 2AFHB 5EWMA 1S2IA 3JARA 5C8ZA 3CE9A 3JD3A 2Z58A 3WTCA 4AO7A 1HKUA 4CLHA 1RHKA 4Z4EA 2Y77A 5HJ7A 4BATA 5J4LA 1IOVA 4GE0A 4O25A 2HA4A 1LLCA 4E11A 2GSWA 2C8VA 1GEGA 3FMVA 4UU1A 1EDOA 4MUBA 1ZJ4A 4RKFA 4ROTA 4Z0NA 5B2EA 2GPBA 4CLXA 1U11A 4XVQA 2OZLA 1HPLA 3ZDXB 4CG3A 4YUYA 1UBTS 3MGGA 4TTRA 2O3TA 4UNIA 3PC8A 5FUQA 3QTBA 3RUPA 2WQ7A 3PTLA 1PBTA 3V7WA 3RRXA 4C6TA 4HUQB 1NG1A 1XXHE 2ZJ8A 2RGCA 3KWJA 3EAQA 3F46A 1O0SA 3TINA 5AICA 3RBZA 3KXKA 2XHEA 1T4CB 2W6CX 3K9FC 2DUMA 1W25A 2GLXA 2JIPA 2QD1A 2R6DA 3AVOA 3EGVA 1VP3A 2R7NA 4FFOA 2PXAA 3S29A 1VLMA 3WRYC 1NJFA 3A37A 4KWIA 4CL0A 5JAMA 2PT6A 4XYGA 1HDEA 3NHBA 2AF4C 3CA8A 4GPEA 3L7JA 4PLWA 5D87A 1PR4A 3PRHA 2Z6UA 5HTOA 4ZU3A 1RXSA 3ZEAA 1RSZA 2L18A 4QNNA 3VGJA 1E99A 2CDNA 1R10A 2EIXA 1AKUA 4MHOA 1M1YA 1H93A 4ZKDA 2KPOA 2QAGB 2TMKA 4BP3A 4DC9A 4GLLA 4X20B 4IWXA 4LWZA 2E37A 1IB0A 3A32A 5DCWA 2O2ZA 4ZQFA 1T8WA 2V98A 3I39X 5EEHA 3S7ZA 1QQ5A 4D02A 3UM9A 4ZCLA 2G9RA 5JCJA 3WGHA 2AFRA 1T3GA 4RFSB 4IH1A 2ZDQA 1EVLA 1O08A 4FXPA 2N46A 3B2NA 3K96A 5TQ0B 3HUDA 1SC3A 4MS4B 4UAJA 1UPUA 3HEMA 3I2JA 3ROGA 4E3WA 1FS5A 3EWAA 1HNXB 4YYZA 4DLUA 2BZ1A 3QH4A 3EUFA 5LPNA 1OUMA 1OZFA 2QN9A 4AWAA 2QRLA 2CVFA 2R84A 3FUUA 4R1LA 1VFPA 3AL3A 3KXIA 2NZXA 4L8LA 4CM8B 2XUAA 3AWIA 4JBIA 4DLTA 1KBQA 3EN0A 4BDTA 3KYCB 3PR1A 2ODTX 4IJ5A 2PGNA 3CRRA 4YJFB 1FYVA 1P2UA 1Z06A 4KZKA 4B1FA 3RYIA 4GU5A 2I6SA 3O3OB 3QVGB 1G98A 5C2JB 3O0DA 4HSGA 4EJFA 2OCBA 1ZCBA 4IFEA 3UO8B 4M1EA 2UUPA 2WOOA 4UNQA 3VHLB 3D1LA 5FFNA 3L6OO 4IWNA 2XYHA 3L9XA 3O0TA 4KMSA 5COBA 4QVGA 3O75A 2O0MA 2ZAOA 4IGEA 4IKEA 2W4IA 4KN9S 1ZRNA 5C7OO 1RYYA 2HBQA 5F7XA 1J9ZA 5JNTA 4ZCQA 4HWPA 3ZZ1A 3KUKA 3KKPA 1SWVA 4X61A 2X5XA 2X6RA 3OZ7A 2D54A 2ONKA 5KJFA 1R0SA 3OLYA 1HDYA 2EJBA 4MVJD 4BO0A 4DCJA 1CLUA 3EMKA 1K75A 2BH2A 2R00A 1GLNA 2P41A 3H3JA 5LJLA 4BWFB 4C5AA 4MQ4A 4RIEA 1G4UR 9ABPA 1QU3A 3QTLA 4DDHA 3HCNA 4U7HA 2A2ZA 5DN9A 4P3NA 2NXNA 2HREA 2DJIA 3W8DA 2RD2A 2FR0A 1B26A 3DTVD 3WYEA 1DAFA 1GCUA 1Z15A 2REBA 3KDSE 2PSJA 4HK4A 4ETWA 4XEHA 5EWLA 1SVLA 3L41A 2YKGA 3N70A 4L4ZA 4K6MA 3G5LA 5BP7A 1RMYA 3ITEA 4G84A 4G9EA 1X0XA 2PVSA 4FLEA 3BTVA 3G6KA 2QM0A 4CMHA 2FN3A 4D80A 2WP0A 2O59A 4UQOA 2AUNA 1DAOA 4UFNA 4EFKA 1E6EA 1N6HA 5GZ3A 1WCXA 2C5SA 5HJEA 1DTEA 1ZHHA 3Q10A 5KAMA 1NQTA 4F2PA 2CFCA 4ZANA 2Q3FA 1ZSNA 2B0CA 1ZK3A 3HUUA 4KSYA 1QKIA 1WRBA 5DCLA 5EIHA 4AU1A 2I3BA 1ZRHA 3O83A 3HV0A 2WPNA 2CVPA 5JBNA 5IRCD 1PJQA 1WW8A 1NMXA 3Q7QA 4XLZA 1SOVA 3BICA 5JISA 1VRCA 2ZIWB 4MCJA 5GTDA 1EHYA 1UJMA 3U4QB 2ZSDA 1PS8A 3EX7C 4XKJA 1MRNA 4NCIA 3TX2A 3UMVA 3EPLA 1N36B 2VH5R 3GUVA 2DUWA 4V39A 2DQZA 4EKGA 2PX2A 1XZCA 1APBA 1WBDA 2E4WA 2HU7A 4JVMA 2OGZA 2RGBA 1OGJA 1UPCA 2VLIA 2GCOA 2ZUSA 3K0CC 3KSDO 4HT3B 1KGSA 1YOVA 3D9QX 4FMBB 5HGJA 1AU9A 1IL0A 1XZ8A 2IXBA 4QUIA 4RF2A 4XQEA 5FTNA 1U5BA 3ANLA 2P11A 3BTUA 4M1MA 2W42A 1AY0A 2QJWA 2WAAA 1KMNA 4UTZA 1MR3F 2HJRA 1QDLB 3GA5A 4OUKX 3VYRB 4YRIA 1UJ4A 3HH8A 4BC1A 3NHPA 2FG7C 1WKVA 2YY5A 4YI3A 2R1VA 4D3YA 3ASVA 5HFNA 3QF4A 1DC3A 5EJ6A 1OXSC 3F5MA 1TW3A 2PZJA 2G67A 3LWBA 4GPD1 2HPZA 3BHMA 2UZIR 2ZEJA 5MGNA 3K4PA 3TWOA 3FTQA 1XUOA 5AI5A 4JLAA 4DKXA 5HYVA 1NUQA 4IIXA 5CTAA 1P2DA 3LVQE 4CLOA 4OFWA 4TUYF 2H2FA 3LHDA 2CB0A 2WF9A 3ETJA 3DZKA 2FHPA 4EGAA 3R20A 2FRVA 1BEZA 4OXNA 3B9QA 3ABOB 4B17A 1NPYA 1TFRA 4KKXB 1XZNA 4B3MB 3NBUA 1UWVA 2YBEA 5KTMA 1JBEA 4RSGA 4KV9A 1HDXA 2OENG 4O0LA 5IJWA 1HYGA 2Q28A 4RVOA 3WJAA 4JKOA 3NX4A 4EF6A 3FY4A 3TD6A 2WP8J 2H9AA 2YWDA 3IHKA 4AJPA 4PLGA 5AH0A 2X19A 1WNFA 3UV3A 3AKDA 1ZA1A 1TUEA 3E9RA 4Z3KA 3O31A 5J1SB 4TT8A 3IQDB 3MCWA 4XYMA 4AN1A 3QW4B 5H16A 4EJMA 3Q8LA 2BBTA 1V8OA 1FB5A 3G5TA 4UD2A 4TV9B 3BVPA 5EJ7A 1ZC4A 5CEJA 4QULA 1K8RA 2A5FA 4YRQA 4WK4B 2R44A 3I9FA 5K6TA 2ZJ3A 4Q0MA 1EVQA 3I34X 3UMFA 3TE7A 5B7GA 3EXIB 3FGOA 1RLOA 3OIYA 3ONWA 2J5QA 1TW2A 1PR9A 3FIJA 2P4HX 3LHFA 5TVKA 1ECGA 5BN4A 5IBQA 1IDOA 1Y9AA 3C8MA 5G0UA 1GCOA 1ULUA 2OLEA 3L4KA 3R75A 1EJBA 1MO3A 1TLTA 2TMGA 4GZMA 3VR1A 3RC3A 4A2QA 5FWYA 4ZI7F 1EM8B 1TRHA 1VI6A 4QHTA 2YBDA 1RLIA 2OXCA 2ZT6A 1UOEA 1PIWA 4J6FA 2H6EA 1TVKB 1V11A 3QOWA 4F2DA 2XGOA 4GI5A 2EBFX 4H77A 3DLHA 2RGYA 1IWPB 1FYFA 2NYRA 3A4LA 4F6RA 1NLZA 4GZ6A 1D2AA 4NMXB 2V6FA 4OGWA 1I8TA 4HLUA 4WBNF 1GZUA 4DQVA 5B6JA 2VDMB 4UEJA 1L5MA 2YHIB 4QODA 1BYIA 4B4KA 2ZYIA 4MYRA 1Q21A 2VZ0A 5LWHA 5A0TA 3EZGA 2A88A 3VI4B 3G8BA 4L08A 2AHRA 3ODGA 2IYPA 1NGSA 3H2BA 5EC8A 4HFNA 4BO4A 1EUDA 2XWJI 3O74A 1NX9A 5CNIA 5AVRA 2X15A 2RHLA 4B3IA 2QUHA 4WY8A 5AHOA 1TZJA 3RCBA 1N3LA 2FSGA 4G23A 4R41A 1HEYA 4PC1A 2C3PA 3MUEA 1W2WB 2AD1A 4NQRA 3I5AA 3C3JA 1M75A 2Y0DA 1AHNA 1J07A 3KKMA 2TECE 3QKUA 4WGGA 1NNUA 1YFJA 3W4IA 5I7SA 4HXEB 4YRJA 2AG6A 1CBUA 4IOLA 5GM1A 1RZRA 4QYWA 2UDPA 2IS4A 4YROA 1U3FA 1BVYF 4D9KA 1QGED 4Z4GA 3PDJA 4B2YA 3L7AA 4PAWA 3RU3A 4BRWA 2Y76A 1CQJA 3JCZA 5AKEA 1PFYA 1U8TA 4B87A 3PPIA 1MH1A 3E81A 3WFIA 1DRJA 3HA7A 1N8SA 1KVSA 2C97A 3E7PA 1MAHA 3R7BA 2H9IA 2CJFA 3MTEA 2G3YA 2JNWA 1XJ0A 2V7XA 3F7OA 1WUIS 2DRIA 3N76A 3EZXA 1C0KA 1XZGA 2GF2A 3OPNA 5TQJA 1GL3A 2EIHA 4N3GA 3FYUA 3O91A 1L4UA 3CSUA 2QNRA 2X8LA 4MYTA 2XV1A 4F97A 3WLRA 3KM0A 4W5OA 5L6MB 1OX4A 3U3DA 3U3JA 3EQ8A 5E4YA 2GCIA 4W5WA 4EW6A 3KELA 2VVTA 1XQ6A 3VPXA 1ZFNA 5HRUA 3BGWA 3IBCA 1R0BA 3GRYA 3TTWA 2BFEB 2VXOA 2XXBA 3RD5A 3KXLA 2C59A 1ZGAA 1O94D 2A9KA 1FL9A 2G1UA 2I29A 3G2LA 3KQMA 3O21A 4RDIA 5DTQA 2WI8A 1OGIA 4AJNA 3HJUA 4Z6KA 5LMCA 3CINA 2GS9A 1UMBA 1WDLA 2CJWB 4FBMA 5EZ5A 5TB5A 3P0JA 4K2HA 4MRRA 3PYLA 3EXG1 3CRZA 4HS4A 4WNCA 3PNSA 4BTEA 2WHQA 1UOPA 1ZS9A 1JAIA 1KJYA 1T6NA 2ATXA 3E5RA 3AQIA 4Q24A 3ZXXA 2MYPA 3PENA 1GRCA 4L6IA 5TS2A 1SD5A 1VIDA 3UAZA 3NORA 4GVXA 1S3FA 1KDTA 1WCV1 2DM6A 1LBIA 2RKOA 3FN4A 3GN2A 3OZCA 4IVNA 5SYNA 1EE9A 2G72A 4MS3B 4YPVA 5J4HA 2OM2A 3Q3EA 4HLNA 1X15A 4EO7A 2G7ZA 2OGSA 2PIAA 5KX5B 3U44B 3FTFA 1JAYA 2X23A 1V4VA 3DHNA 3IV7A 2CVZA 2O7QA 1OH6A 1K7EB 3BKWA 5GY7A 4NXNB 3K0AA 4OOEA 3WZMA 2CK3A 3OY2A 2LKDA 2IQIA 2RHHA 3FZQA 1OZHA 4KFTA 3QHQA 4OCZA 5CNMA 5D3MA 5DKFA 4WZBA 3RB8A 3KR1A 4CKXA 4B35A 3NCTA 3STXA 1PJ3A 3C48A 2D6FA 4YAEA 2VRNA 1SHTX 4GZLA 2REOA 2HI0A 1V8DA 1AN0A 2IFTA 4KITB 2P6NA 5K3SA 2B2CA 3UJBA 4L5IA 1SOMA 7GPBA 1GDDA 1R0RE 2QAJA 2I7XA 4BNXA 1M1XB 3TR6A 2UXCB 4H0NA 4B8WA 3MVEA 3AR9A 3G17A 5FR1A 3ND6A 5DW0A 1Z68A 1PHRA 4LWPA 1QH0A 3S4YA 1EB9A 4M86A 3R7DA 3U5ZB 2FXVA 3OQIA 3EEFA 2NIPA 1SK8A 2PRSA 4OGGA 5CK5A 1X94A 4R8KA 3U17A 4J76A 1LV8A 1CQZA 3QKRA 2NQ8A 2X3UA 3H5NA 1LDYA 5KNCD 3JZAA 3ZD8A 3KFLA 4KN6A 2V4UA 1KYTA 4KIJA 2CHQA 4LSWA 1GZSA 2JAHA 3CFYA 2AE1A 5ICCA 1B1CA 1TX4B 3X1MA 4DM7A 1M0SA 3KIPA 2PUWA 5IC6A 2BM9A 2CHEA 2XB2A 221PA 2J5BA 3W3AA 4HNHA 4W5TA 3ZNNA 9LDTA 5CA1F 4RJIA 1GLVA 2V96A 1YK0A 4IM7A 4LXQA 4Q01A 2W2QA 2MINB 2P9EA 4ZTZB 1W6RA 3E1SA 3BWXA 2IE0A 3KKZA 4JLKA 4JUAA 2FDCA 5JW6A 1QB8A 1SBIA 1BW9B 4BBPA 1GTSA 1VE7A 2AJBA 2C7PA 3FMPB 4X90A 3UMJA 2NO7A 4AJKA 1Z74A 1ZM2A 4AJ4A 3BDIA 3HCPA 4L9AA 4NDNE 4CLRB 4Y1FA 1QTQA 2CLEB 4KXUA 4JI5B 1V16A 4OJTA 2AK2A 2QBYA 3ENNA 3LS2A 4GOMD 1GUZA 4G3XA 3B1JA 1RYNA 2COEA 4V3BA 1C1YA 2FZKA 4WXHA 2GK4A 4RD4A 1JT9A 4X45A 1WKCA 4QJ4A 4TYPA 3LOUA 3UH1A 5J47A 2HW8A 1VIAA 2PBFA 3INRA 3GVHA 1Z5ZA 4AI6A 4XVCA 3DPUA 3LY8A 4BTLA 4U7DA 4RVUA 4X44A 3OICA 2A94A 1G20E 4KXYA 3SSMA 1IUKA 1R0LA 4UNSA 3G7SA 5BUCA 4IDAA 4KRYA 4DV5B 2W6NA 4GZ3A 3JYLA 1C9YA 4PXAA 1W1UA 2XOEA 4JLJA 3SFZA 4IUCS 3ZOZA 4E14A 4FZJA 5ALYA 2FLWA 2YXLA 1B8VA 2QV0A 3N58A 2Q4BA 4F96A 3EG9A 3F4LA 5JRZA 3I61A 2XNJA 3IBYA 4Q5IA 2Q4EA 5T4HA 1HXHA 3B6EA 3GXBA 3PXBA 4Q93A 1R12A 1MVLA 4F0JA 1UBNA 1CT9A 1OXVA 1XCJA 4PZCA 2DPXA 1GWNA 1M7GA 2ZTMA 3DKRA 3DXZA 3N2GA 1R5BA 2WJVA 1SUPA 1XWWA 4S0XA 4K6OA 1UOOA 4KC0A 1N0IA 4P2GA 2IYOA 6ABPA 2CCKA 1S9HA 1SZPA 3IRUA 2R5NA 2XZLA 4HVAA 3PRKE 5LZ4A 3FDZA 5DK6A 3ESXA 3A3YA 4IOJA 2VPTA 2QM8A 3C3PA 1RQNA 4E1AA 2NZ2A 4XE5A 2Z2IA 2Z9BA 2X8AA 3FGZA 3MGAA 1ID8A 3F0TA 4ARSA 4EVQA 2ZCUA 2P27A 3B1XA 4OHYA 1WD7A 4B3CA 5CLJA 1QE5A 2QZ4A 5IT4A 4KPYA 1O9HA 1MEJA 3CH7A 1NUPA 3MINA 2WUGA 3NDJA 3GRPA 4KBFA 3LNCA 4U00A 5LA6F 4A03A 3LIIA 4LCEA 4PZZA 3RIXA 3LUAA 4G0ZA 1TNDA 2QNBA 1GQRA 4BNGA 2RAUA 4E31A 2XGSA 5BYKA 5D84A 5E0KB 1E3WB 3GYGA 3PC4A 1IAQA 1N2BA 2ZRPA 4JL5A 4P3OA 2W58A 4QYIA 3LC1O 4XDHA 1JHQA 5FBKA 3R0XA 5TMEA 1E1CA 1VC2A 7AT1A 4V03A 4Z8XA 4EDFA 4OK5A 4LFAB 1FFCA 3ROZA 4ZZIA 4DSZA 4G5FA 1LWOA 1Y4AE 2C9ZA 2DWPA 2G80A 2R4QA 2WHEA 1JA0A 3KPWA 5CYFA 3EARA 5A3VA 3A6JA 4K9SA 4QFCA 4H4EA 3O2SB 1GG5A 5TEVA 3BPSA 1BCRA 3P45A 4AN4A 3EY9A 1TKRA 2DX7A 3ISTA 5AKZA 3VR3D 2ZZNA 2AOUB 3EAFA 3DT9A 3GT0A 3MAAC 4XD7D 4U7FA 3QU4A 3PL5A 2GUGA 4YAFA 4LC1A 5EQDA 3ZDEA 1WTAA 1UQTA 3ZU2A 4AKTA 2WU1A 5KNCH 1CUEA 4QVKA 3ITKA 1W36D 2AXPA 2JLVA 2EOAA 1YNOA 2JBWA 1NIPA 5LNK6 5JSQA 1XDBA 3PZBA 5DNDA 4ZK2A 3WGKA 4PNZA 2VCEA 1W30A 4AURA 5E9QA 1KY4A 2AOTA 1I4EB 4EI2A 4TM7A 3OPYA 1L3CA 2HFJA 2NZWA 3SKYA 1RHQA 2O6LA 1DBSA 1OZ0A 2OAQ1 4CL8A 4CF5A 4DLNA 3ZQ6A 4UTVA 1KFCB 1F2VA 3GJ6A 4CIXA 1IUOA 4MYCA 1I32A 1NXXA 2GPNA 2PEZA 1YJXA 2G83A 4IKPA 1WVIA 3IBFA 4JB3A 4QATA 4LF4B 5CX1B 1AQNA 1JRLA 1VHQA 1SULA 3O5AA 3QNWA 3WGNA 4MIKA 4ZQBA 2E87A 3RUDA 4MUJA 1E69A 4YMHA 4DQ0A 5A1TA 4UUQA 2X7XA 2V5AA 5FWNA 2EATA 1PZMA 4TQUS 4DXDA 3TUJC 1YZ3A 2H16A 4NMWA 1OLXA 2DUJA 3R77A 4QC2A 3U48A 1H5NA 4F71A 1YS9A 1KL7A 4WVLA 3TGWA 4MTCA 2BPOA 2F55A 1CY0A 1IU9A 4BL5A 1WPQA 2KQUA 2G88A 2VHQA 5CIQA 3OPYI 1DU4A 4YBRA 1JG6A 2PGXA 3ZHTA 2DTXA 1HL7A 4X3OA 5D1NA 4NCBA 4MYDA 3TZBA 3VMMA 3B48A 5EAIA 3MRTA 2PS0A 2W2LD 2EGUA 1USVA 2XE6A 3EGXA 2CDAA 4MV9A 1H2EA 1TO6A 4TMYA 1NQAO 2C20A 4BU0A 3V6LA 2I6UA 4R4JA 1UK7A 3EOZA 2P9ZA 5I9SA 4TKLA 13PKA 1XX6A 2XNDD 1NONA 3BZBA 3KV3O 2JCSA 4XWWA 2FW1A 5K8LA 2GHQA 2LIVA 5ARBA 5CT4A 1CQIB 3QE2A 1G55A 4MB6A 3OUTA 1W47A 2XNHA 3C6KA 2GPWA 3QYAA 4NC9A 1FUEA 2Z57A 4NATA 4R68A 1YS7A 4XQ9A 1FDRA 5FTMA 5BSWA 2VBGA 4DSNA 3OD1A 1LWNA 1WU8A 2Y4OA 4JBXA 3OOWA 5KHAA 4PYKA 2HA6A 4OPMA 1UKVY 1GNPA 3ZWMA 2KBEA 3L9WA 3D2AA 3D3WA 4EYOA 2I55A 1UXHA 1BIFA 2QGNA 4HDNB 4CEHA 4P54A 1MIHA 3PNBA 1D2NA 2RJOA 5TQ2B 1KKUA 1AZLA 2QG4A 1OWPA 2QYHA 2GCNA 3KQYA 3BGDA 1Q0HA 1P0FA 3T3DA 2MYNA 3LDUA 2VBCA 2FZ4A 2Q3HA 2VZ8A 4MQBA 3GLGB 3OHMA 1WQ3A 4B33A 3KETA 5C8YA 2GAAA 2IUUA 2IH2A 3F6EX 2VHYA 5JNLA 3LUDA 4ZU1X 3KZXA 3QVTA 4ND5A 2Z5GA 5FPTA 5TE9A 1LVGA 3HEBA 5HDBB 1MFZA 1LQUA 4OHBA 2FPWA 4E2YA 3OT4A 1GILA 2XVZA 2P1RA 2ZUFA 1U3CA 2C2XA 4A2PA 2PE5A 3EEQA 3TOCA 2DQYA 3BXHA 2JRCA 2ZREA 3IPLA 5DHAA 2ZJ0A 2Q7XA 1AKWA 4OXQA 3UGKA 4RPGA 1YQ9A 2YIMA 4WASA 4XUGB 1V7QA 3H2HA 1G9SA 1XC7A 3RYHA 5DLYA 3VU8A 3BMQB 4X60A 3RADC 2HCBA 3SM9A 4DGQA 1LC0A 1S2MA 4D2IA 4GMFA 4NENB 3V42A 2ZS8A 1CFJA 3QITA 2BUBA 3VBEA 5JWOA 4O8ZA 4AKIA 2QX6A 2CKDA 2DWOA 3EY4A 4J1NA 3VKVA 2BGTA 3PNPA 2AQHA 1REQB 4AF6A 1OXUA 4HKTA 4NHEA 1UPAA 3MA0A 5DIZA 1G1AA 2IOYA 2GHIA 2O2XA 3LW8A 4KRXA 3TDNA 3U26A 4XYLA 1HMPA 3DP9A 1QC5A 1YAHA 2XIQA 3EXG2 1WXWA 5FPKA 1H2RS 4L50A 3GRAA 5EWJA 5L95A 3LO8A 3CE6A 1XL1A 3M81A 2GEKA 2IKQA 1PVOA 3MRVA 1E2QA 1LVHA 4U1RA 1UDBA 2GNOA 2BFFB 4GT1A 1GPMA 3PKIA 3TBFA 4UBNA 1JEDA 2NPOA 4Z1MD 4LV5B 2ZBQA 2VG8A 4B84A 2AUMA 3NATA 2ZRGA 4RJLA 1ZXXA 1I7LA 1PR6A 2IZ1A 2SICE 4M1KA 5GZ6A 3T1NA 4JFAA 3AERB 4BYMA 4ECAA 3HV2A 1JX6A 4NESA 4ODIA 5BWCA 2HPVA 2YW2A 3NBAA 1ST3A 2PANA 3OZWA 2ZXEA 5BN3A 2LTAA 3BBPA 4QUKA 1G63A 2NNLD 1TM7E 1GDHA 2O2JA 2IXDA 1XU9A 2O2DA 3EIUA 4UMVA 3RVMA 3VM6A 4ETMA 4YONB 4EAQA 1FSGA 1O6GA 3TZHA 4ML3A 2ZCVA 3HI6A 1MNAA 4KO1S 3Q8XB 1XQYA 3NETA 5FUWA 4B46A 3C6ZA 3ZQKA 1E79A 3PGKA 3W2GA 2DB3A 3MC1A 1YL6A 4HN9A 4NQZA 4MGIR 4ZJPA 3M6UA 4GYJA 1UOQA 2X77A 3HB9A 4HEA1 4L0MA 5FHQA 2RG1A 2B34A 2JFPA 2NO4A 3BZUA 3LA6A 3F6YA 1C7IA 1DELA 4CN8A 3UFXB 1U7DA 3QOFA 2JANA 3RIGA 2B6HA 2VHZA 2ZBDA 2WKPA 3FYHA 4AUMA 2AWNA 2GASA 3BXGA 4FNMA 5YASA 4D43A 3EAGA 2I3DA 4RHXA 3LZCA 4G09A 4HGPA 4I5IA 1R3UA 4DA6A 2Q2QA 5AW7A 2ZE6A 3ID6C 3DEHA 3UCEA 1MJNA 1EFKA 2CUKA 5F33A 5F7OA 2Q0XA 1Q22A 3AM4A 1KK2A 2Q49A 1U65A 1OT3A 3P2YA 3PEEA 5CITA 1YUBA 5BPHA 3ANMA 1YMUA 3I23A 3EMBA 4IIEA 2FSPA 2VKQA 2GA8A 2CMKA 2QVCA 2YWEA 1UT5A 3DMDA 5JRJA 1K7YA 4DQUA 1Z4JA 1FFGA 4P32A 3O4IA 4V0KA 3SJZA 1SUCA 4MGZR 2QXUA 3UW1A 5HKBA 2OGTA 3C5VA 1B8OA 1F2UB 2VP9A 4CQMD 1CJMA 2VL7A 3AV0B 4UKDA 5KCMA 3VZRA 1WZIA 3BIFA 3TW0A 4AG6A 2HMWA 3ADKA 4I36A 4DEXA 2YCLA 1RWBA 3I0NA 5LYYA 1SN7A 1UXOA 4YR9A 2QGFA 1SVWA 2XH8A 3IUPA 4XGNA