1ICNA

Escherichia coli-derived rat intestinal fatty acid binding protein with bound myristate at 1.5 a resolution and i-fabparg106-->gln with bound oleate at 1.74 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
b'AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVQEISGNELIQTYTYEGVEAKRIFKKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTESTINAL FATTY ACID BINDING PROTEIN
publication title Escherichia coli-derived rat intestinal fatty acid binding protein with bound myristate at 1.5 A resolution and I-FABPArg106-->Gln with bound oleate at 1.74 A resolution.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Binding protein(fatty acid)
total genus 34
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 1993-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1icnA00
3FW5A 5EDBA 5FENA 3FEPA 1EQDA 1GT1A 1RLBE 1EIIA 1X89A 3FR5A 3PP6A 3CBCA 2ANSA 2FWVA 1IIUA 1R0UA 3HWDA 4QAEA 2WQAE 1KZWA 1BM5A 4TJZA 1ZNEA 5HZ5A 3D97A 2GC9A 5EDCA 5LJCA 1AB0A 1ALBA 1FELA 1LF7A 4EFGA 2FS7A 1ERXA 2XKLA 2MJIA 4I3BA 4I9RA 3U9PC 3RSWA 2NNQA 1LIDA 4QGXA 2OZQA 1T0VA 4D6BA 2Q4NA 2HYSA 2WWPA 1TW4A 3BX8A 3NADA 2G78A 1NP1A 4UU2A 1SXUA 4XMEA 2MM3A 1KT7A 4ZHDA 1CBQA 2BLGA 1B0OA 4ORUA 4KIIA 2FS6A 1LNMA 1B8EA 5BVQA 1X8NA 4ZHFA 2LFOA 1KT5A 1G74A 5LJGA 3ZUOA 2CM9A 4CK4A 1E06A 3B2IA 1YP7A 3TGAA 1B4MA 1E5PA 1FDQA 4O9SA 1JJXA 3NR3A 2WUTA 4YDBA 1BBPA 1MX8A 2QO5A 3ZUIA 3EYCA 5LJHA 3CMPA 2CZTA 2O62A 4YGGA 2K23A 1EALA 5K06A 4ORWA 2HMBA 5HCDC 5D45A 3U03A 5FAZA 1PEEA 1HN2A 5H9AA 3NQ9A 1CBSA 3P6EA 3SAOA 3VG3A 3CWKA 3TGBA 3STKA 2KTDA 2GTFX 1H91A 3EBKA 1QABE 3G7XA 1PM1X 3KFHA 4BQUA 3AKNA 1O1UA 1I06A 1DC9A 2G79A 4AW8A 2IFBA 1BRPA 4EDEA 4IB6A 3KFGA 4IB9A 3FMZA 1PBOA 4IMOA 2L67A 4AYHA 4YMYA 3O22A 2OFMX 1SY2A 3BY0A 5HTDA 2CM4A 5H9LA 1FTPA 1DZKA 1OPAA 2JU7A 1KQXA 2AT8X 5HWZA 4NNTA 3NX2A 2PY1A 2R56A 3UEVA 1SXWA 1AQBA 4PSQA 1HBPA 5HTEA 1BWYA 4TKHA 4IMNA 3IFBA 2Q2MA 4ALOA 4YBPA 2RD7C 1KT3A 4NLIA 3O19A 4I3CA 4YFPA 1EW3A 3WJDA 1KGLA 2OVEA 1ZRYA 2ALLX 2JOZA 4ORYA 3JS1A 2N93A 2A0AA 1GKAB 2AL0X 3PPTA 4D6AA 4NYQA 3UEXA 1TOWA 4MVLA 5B29A 5IO5A 3FA8A 1ZNDA 2FLJA 4ALBA 4QZTA 1FENA 4UU3A 5B27A 1A2DA 5D4AA 1UREA 3WJGA 1A3YA 3F8AA 1T8VA 1MX7A 3BU9A 1JJJA 3UEUA 3EM0A 3NX1A 1YWBA 1LICA 4BOEA 3APVA 2NP1A 4GH7A 2HLVA 3WBGA 4ZGUA 5C0NA 4OMWA 4Y0QA 2Q2PA 1DFVA 1KQWA 5DPQA 3WXQA 4GRJA 3PEDA 1NGLA 1LKEA 4IAXA 4OS8A 3C77X 4ZHHA 4AZNA 4QYNA 5F1EA 5DG4A 1QWDA 3FENA 1QQSA 3FA7A 1X8PA 4NLJA 1JV4A 3KZAA 4GNYA 4YCEA 1OBUA 2FRSA 3P6DA 2L9CA 1BSOA 2JN3A 4BVMA 4TLJA 3APWA 3B2JA 1IFBA 1IW2A 2XSTA 2E4JA 1KZXA 1QY1A 5F7GA 5FFHA 2AT0X 5D48A 1DF3A 2G7BA 2WQ9A 4OMXA 4YGHA 5EPQA 5HCEC 5LJEA 1QY2A 2NNEA 1GT4A 3C76X 4AZPA 4A8ZA 2L5PA 3I0AA 1HQPA 3IA8A 3MVFA 4AZQA 1TVQA 5L8OA 5KIDA 4HPDA 1I04A 4N7CA 1UZ2X 1A57A 1S2PA 3HWEA 5H9NA 4IBAA 1BLRA 3EBWA 3BX7A 1PMPA 3F9DA 5CE4A 3APXA 2ACPX 2QM9A 1ZNKA 3VG2A 1GGLA 1JYDA 1QG5A 1YWDA 1VPRA 1U0XA 1E00A 5KHPA 5EEEA 1SA8A 5LKFA 1LIFA 2AH7X 1CJ5A 3HWFA 1MDCA 1JZUA 1EXSA 1IKEA 1DZMA 3UEWA 1OEJA 3FA9A 4ZH6A 3TZSA 4Y0SA 4XMGA 5HA0A 5EEDA 4XMFA 1KOIA 1U17A 1ICMA 4QGWA 3TF6A 2X46A 3CR6A 5BVSA 1MUPA 1SY0A 5LJBA 5HZ9A 1B56A 2A2GA 1EPBA 3FEKA 4HPCA 2AKQA 3APUA 3PH5A 4A60A 1OPBA 4TQ2A 1YIVA 3NP1A 4K19A 1OBPA 4GETA 3BDRA 1X8OA 4QYPA 2ACOA 4ES7A 4MVKA 2QOSC 5L8IA 4LZVA 5IO6A 1GXAA 4ZJ0A 1ZNLA 4I9SA 1G7NA 1DZJA 1CRBA 4XMCA 4NP1A 2FR2A 4IAWA 4WBKA 4YFQA 5HZ8A 1ACDA 2DM5A 2RA6A 3T1DA 5HZQA 3P6FA 4HPBA 4A1HA 1LIEA 4RUUA 3ELZA 4LKPA 2A2UA 5HCCC 3WJFA 4XMHA 1ZNHA 2AT5X 4YH0A 1SY1A 3NQ3A 2QO4A 4OS3A 4IB7A 4GE1A 2RCTA 2RQ0A 2OVAA 5F6ZA 1XCAA 1SXXA 3WJEA 1HBQA 1T68X 4IB8A 4TKJA 2WEWA 3VG6A 1DV9A 2P8GA 1SY3A 2Q39A 2OFRX 4AZRA 2AMMX 3QKGA 1ZNGA 2LB6A 1HMRA 2W2FA 3KFFA 3AKMA 2R73A 1YWAA 3MBTA 3VG7A 3TGCA 1D3SA 1QY0A 3P6CA 4WFVA 5H8TA 2MO5A 3L4RA 1KT4A 1HMTA 3BU1A 1FE3A 3FR4A 1NP4A 2YG2A 2WEXA 3D95A 1X71A 1YP6A 4YGZA 5F6BA 2HZQA 2WR6A 3BS2A 3U0DA 1BJ7A 3ZQ3A 2HZRA 2EU7X 1VYFA 3S26A 3VG4A 4ZHGA 3FR2A 2W2AA 3VG5A 2FR3A 4LKTA 3HK1A 1ICNA 3FA6A 2POAA 2A13A 2L68A 1IKJA 5BVTA 3FLLA 4YBUA 1OEEA 1S44A 1TOUA 2AT6X 2WSJA 4TKBA 2AT3X 4ZHCA 4TNNA 4M7MA 2GJ5A 1AVGI 1X8UA 1X8QA 4QGVA 4QZUA 2F73A 3RZYA 4WFUA 4EEJA 1E02A 4DQ4A 3DSZA 4MVIA 3WJBA 2JU3A 4ODDA 1FEMA 1HMSA 2RCQA 3STMX 4RUNA 5D8JA 1P6PA 5H9KA 5AQ6A 1SXYA 4GNWA 1N0SA 4ARHA 5HBSA 1EUOA 1GX9A 1A18A 1I4UA 1RBPA 2JU8A 1U18A 5LJDA 2LBVA 2FTBA 3CQNA 1BEBA 2KT4B 1DZPA 5KICA 3KFIA 1LIBA 1KXOA 1ML7A 3CBSA 4NYRA 3D96A 4I3DA 1IFCA 3CQRA 1YWCA 2CBRA 3PH6A 4DQ3A 4YDAA 3FELA 5D47A 1OEKA 4N7DA 4ZFXA 4ZCBA 1QFTA 1G85A 1MVGA 1LFOA 4HFOA 1O8VA 1Z24A 3B2HA 3FW4A 1GT5A 3HWGA 3GAQA 2Q9SA 4HPAA 4ZR2A 2LBAA 3JSQA 4YFRA 3K3LA 1QFVA 1GX8A 2X45A 4ZH9A 2CBSA 4NNSA 4YKMA 2K62A 4ORSA 3WJCA 3BRNA 3NPOA 4A1YA 5JR8A 1CBRA 4LZUA 1EPAA 1BRQA 1LPJA 1EIOA 2QO6A 1KT6A 3STNA 4Y0PA 1ADLA 2LKKA 1S7DA 1BSYA 4GKCA 2A3FX 1JYJA 1BSQA 1VYGA 1CBIA 4ORRA 5LKEA 5LJKA 5F58A 2HNXA 5HAEA 4AZOA 1ERBA 1D2UA 1O1VA 1GKAA 5EZ2A 3OJYC 3I17A 4EXZA 3C78X 4AZMA 1GM6A 3BSZE 4YKOA 1TXLA 5L8NA 3Q6LA 4OS0A 1YUPA 3DTQA 4R0BA 1GT3A 4ORXA 2CZUA 2NNDA 1I05A 3B2KA 3BLGA 4M6SA 1G5WA 4XMDA 4Y0RA 2FT9A 4YCHA 3P6GA 1XKIA 5HZ6A 3O2YA 2ASNX 2R74A 3WVMA 3FIQA 1AELA 3ELXA 3P6HA 1JBHA 1L6MA 3B2LA 2OVDA 5HA1A 2W2BA 3KQ0A 3EMMA 1OBQA 5IO7A 3PECA
chains in the Genus database with same CATH superfamily
3FW5A 2IZEB 3WYPA 5EDBA 5FENA 3FEPA 2KTSA 1EQDA 1GT1A 1I9HA 1RLBE 1X89A 3ZW0B 1EIIA 1JJUA 3FR5A 3PP6A 1VWHB 3CBCA 3SZHA 2ANSA 2FWVA 1IIUA 1R0UA 3HWDA 4QAEA 4Z28A 1JIWI 1VWDB 1VWNB 2WQAE 4TJZA 1ZNEA 5HZ5A 3D97A 1N7YA 2GC9A 5EDCA 5LJCA 1SRFA 1AB0A 1ALBA 1FELA 1LF7A 4EFGA 5B2AO 2FS7A 1ERXA 2FHLA 2MJIA 1LCWA 2XKLA 2A5BA 1DF8A 4I3BA 4I9RA 5AJCA 4GUZA 1MM9A 3U9PC 3RSWA 1SWTA 2NNQA 1LUQA 1LIDA 1SWGA 4QGXA 2OZQA 3LV4A 1T0VA 5IRUA 3RDUA 4D6BA 2Q4NA 2HYSA 2WWPA 4ML7B 1TW4A 3BX8A 3NADA 2G78A 4U3QA 1NP1A 4UU2A 1SXUA 4XMEA 2OY5O 2MM3A 1KT7A 1AVEA 4ZHDA 1KZWA 1CBQA 1N43A 1B0OA 2BLGA 2MF6A 4ORUA 4CDCA 4KIIA 2FS6A 1LNMA 2RTCB 1B8EA 4B55A 2OF9A 5BVQA 1X8NA 4ZHFA 2LFOA 3WZNA 3CKGA 4HWMA 4L1NA 4EQAC 1KT5A 1G74A 1W5RA 3MM0A 5LJGA 3ZUOA 3RDQA 2CM9A 2ZSCA 4CK4A 3FDCA 4L3RA 3PK2A 1E06A 3B2IA 1YP7A 3TGAA 2MHDA 2OFAA 4O3ZA 1HXLA 2GH7A 1B4MA 1OSPO 1SWFA 1E5PA 1FDQA 3EW2A 3WZPA 4O9SA 1JJXA 2YMSA 1VWBB 3NR3A 2WUTA 4YDBA 3NBXX 1BBPA 1MX8A 1VWOB 2QO5A 2RTLA 3ZUIA 3EYCA 3ZW2A 4GGZA 1RSTB 5LJHA 1KL5A 4IABA 3CMPA 2CZTA 2O62A 1STRB 1W4TA 4BX5A 4YGGA 2K23A 3VGWA 5K06A 3SZJA 1EALA 4ORWA 2HMBA 3H3IA 5HCDC 5D45A 3U03A 2X4MA 4JO6A 2RTQB 1HN2A 1Y52X 5FAZA 1PEEA 4BCSA 1NQNA 5H9AA 3NQ9A 1CBSA 3P6EA 3SAOA 3VG3A 3ZW1A 2VDFA 3CWKA 3TGBA 5IRWA 1VWLB 4GDAA 3STKA 2KTDA 2GTFX 3P24A 1H91A 4FBRA 3EBKA 2A8GA 1QABE 1MEPA 3G7XA 1PM1X 3KFHA 4BQUA 3RDSA 3AKNA 4ID2A 2RTRB 1O1UA 1RAVA 3ZI8A 1I06A 1DC9A 1SLEB 4I60A 2G79A 4O3XB 3T2XA 4AW8A 4BX5B 4QQ1A 4CPHA 2IFBA 3E3CA 4GDZA 3SOTA 2OY8A 1BRPA 3Q34A 4LQZA 4EDEA 4IB6A 3KFGA 4IB9A 2RTFB 3FMZA 4CV7A 2ZAIA 1PBOA 4IMOA 1VWEB 2QOMA 2L67A 4AYHA 2Y3FA 4U8UN 3HTYA 4YMYA 3O22A 2OFMX 1SY2A 3BY0A 3PDFA 1RXJA 2CM4A 1JMXA 1FTPA 5H9LA 3VHMA 5HTDA 1DZKA 1OPAA 2JU7A 1KQXA 2AT8X 2IZIA 3AEHA 5HWZA 4NNTA 3SLJA 4CPHB 3NX2A 2PY1A 2R56A 3UEVA 4U46A 1SXWA 1AQBA 4PSQA 1HBPA 5HTEA 1BWYA 2G8CO 4TKHA 4IMNA 3IFBA 2Q2MA 5B11O 4ALOA 3GE2A 4YBPA 2RD7C 4BX6A 1KT3A 4NLIA 3O19A 4I3CA 4YFPA 4Z2VA 4KT5A 1SRGA 4KH8A 1EW3A 3CKFA 3WJDA 4U8UO 3VPJE 2A5CA 2JW1A 1KGLA 2OVEA 1ZRYA 2IZFB 2ALLX 2JOZA 4ORYA 2WPUA 3JS1A 2RTOB 2N93A 4CDFA 2A0AA 3RE6A 1GKAB 2AL0X 3PPTA 5B5GA 2GTLM 4D6AA 4NYQA 3UEXA 1TOWA 2IZLB 4MVLA 3MX7A 2OL6O 3AUMO 3EW1A 5B29A 2OVSA 3RDOA 3FA8A 5IO5A 1ZNDA 2FLJA 4ALBA 4QZTA 1FENA 4UU3A 5B27A 1WBIA 1A2DA 5D4AA 1UREA 3SLOA 3WJGA 2Z4IA 1A3YA 1LCVA 1NC9A 3F8AA 2Z4HA 1SWRA 1NDJA 1T8VA 1MX7A 2IZDB 3BU9A 4NV7A 3HPEA 1JJJA 3UEUA 3EM0A 3NX1A 1YWBA 1LICA 4BOEA 3APVA 2NP1A 4GH7A 2HLVA 4CPEA 2RTBB 3WBGA 2F09A 3OBLA 4ZGUA 5C0NA 4OMWA 4Y0QA 2Q2PA 1DFVA 1KQWA 1SWPA 5AJBA 5DPQA 3WXQA 4GRJA 4O4SA 4GU8A 1MK5A 3PEDA 1NGLA 1LKEA 4IAXA 4OS8A 4QRLA 3C77X 4ZHHA 4AZNA 4NV8A 1SWCA 4QYNA 3ZZVA 2FKGA 5F1EA 1HXZA 1RXHA 5DG4A 5AEOA 1QWDA 3FENA 2OY1O 1QQSA 3FA7A 2ZAGA 1X8PA 4NW4A 4NLJA 3RDXA 1JV4A 2IZGB 3KZAA 1FJ1E 4C5PA 2KD2A 4GNYA 1NBXA 2FHNX 4YCEA 1OBUA 2FRSA 3P6DA 2L9CA 1BSOA 2JN3A 4BVMA 4TLJA 3APWA 3B2JA 3N91A 1VWRB 2IZCB 4KC8A 1IFBA 4JNJA 1SLGB 1VWFB 1IW2A 2FGSA 4GJVA 2XSTA 2E4JA 1KZXA 1QY1A 5F7GA 5FFHA 2AT0X 1SWDA 2RTNB 5D48A 1DF3A 4GGTA 1K24A 2G7BA 2WQ9A 4OMXA 2BC3A 4O49A 4YGHA 4ON1A 4GK9A 5EPQA 5HCEC 3WOVA 5LJEA 2PI3O 1QY2A 2NNEA 1GT4A 2C1SA 3C76X 4AZPA 4A8ZA 4OEMA 4OKAA 2L5PA 3I0AA 1HQPA 3IA8A 3MVFA 4AZQA 1TVQA 3V8UA 1JQPA 5JD2A 2DJFA 5L8OA 1MOYA 4HPDA 4CDEA 5KIDA 1VWQB 1VWPB 1I04A 4N7CA 2DJGA 1UZ2X 1A57A 1S2PA 3HWEA 5H9NA 4IBAA 4O3YA 1BLRA 1VWMB 3EBWA 3BX7A 3S60A 1PMPA 4Z6JA 4FQBB 3F9DA 5CE4A 3APXA 4O4UA 2ACPX 2IZJA 4O3WA 1KL4A 1SREA 2QM9A 3RY1A 1ZNKA 2I5VO 3VG2A 1GGLA 1JYDA 1QG5A 3SZIA 2AVIA 1YWDA 1RSUB 1VPRA 2OL7A 1U0XA 1E00A 4O4XA 5KHPA 1VWAB 2I5ZO 2RTAA 5EEEA 1N4JA 1SA8A 5LKFA 1LIFA 2AH7X 1CJ5A 3HWFA 3ZW1B 4CSBA 1MDCA 1JZUA 1EXSA 4FBVA 1IKEA 1DZMA 3RDMA 1OEJA 3FA9A 4JGLA 4ZH6A 3KVNA 3UEWA 3TZSA 2CAMA 4Y0SA 4XMGA 5HA0A 3SLTA 2OF8A 1SRIA 2Y3EA 4XMFA 5EEDA 4CDDA 3P02A 2MWHA 1KOIA 1U17A 1ICMA 1SWAA 4QGWA 2X46A 3TF6A 3WZOA 1UYOX 1VWCB 4YVBA 3CR6A 2RTMA 4Z27A 2BHVA 1MUPA 1SY0A 5CYBA 5BVSA 5HZ9A 5LJBA 5CSEA 1B56A 2A2GA 1EPBA 3FEKA 4HPCA 2AKQA 3APUA 3PH5A 4A60A 1OPBA 4TQ2A 1YIVA 5L3YA 3NP1A 1EI5A 4K19A 1OBPA 4GETA 3BDRA 1X8OA 4MVEA 1BM5A 4QYPA 3VE2A 2X56A 1W6FA 1SWQA 2ACOA 2RTHB 4ES7A 2JGSA 2QOSC 3PQUA 4GJSA 4GZVA 4LZVA 4MISA 4MVKA 5L8IA 4EKVA 1GXAA 5IO6A 4ZJ0A 1Y0GA 1ZNLA 1HY2A 4I9SA 1G7NA 1DZJA 1CRBA 4XMCA 4NP1A 2KW1A 1SMPI 2FR2A 2IZKA 1SWHA 4IAWA 4WBKA 4YFQA 2C1QA 5HZ8A 1ACDA 1SRJA 1SWNA 3QQ2A 2DM5A 2RA6A 3S5XA 4Y5DA 3T1DA 4MEEA 5HZQA 3P6FA 2OFBA 4HPBA 4A1HA 4Z2PA 1LIEA 4RUUA 1NQMA 4DCBA 3ELZA 4LKPA 1SWSA 2A2UA 2RTPB 5HCCC 3WJFA 4XMHA 1ZNHA 1SWEA 1Y55X 2AT5X 4YH0A 3LTWA 1SY1A 2RTKA 1VWKB 2GTLN 1LELA 2QO4A 3NQ3A 4OS3A 3RBYA 1VWGB 5CHKA 3D9WA 4I95A 3WYQA 4IB7A 4GE1A 2RCTA 2RQ0A 1SWLA 2OVAA 5F6ZA 2OY7A 1K3BA 1XCAA 3OE3A 1SXXA 3JQOA 4JHQA 5IRAA 1HBQA 3WJEA 4COTA 1T68X 3ZW0A 1KL3A 4IB8A 2BSZA 4CPFA 3EC5A 4TKJA 2WEWA 3VG6A 1DV9A 2P8GA 1SY3A 4BGFA 1AVDA 2OFRX 2Q39A 4AZRA 2AMMX 3QKGA 3UAQA 2C4IA 1ZNGA 2RTIB 2X34A 5K68A 2LB6A 1SLDB 2HKDA 1HMRA 1E2TA 2W2FA 3KFFA 3AKMA 2R73A 1YWAA 3MBTA 3VG7A 3TGCA 1D3SA 1QY0A 2GTLO 1WUBA 3T6LA 3P6CA 4WFVA 5H8TA 2MO5A 1N9MA 1Y9TA 3L4RA 1KT4A 1HMTA 5IXGA 3BU1A 1FE3A 3FR4A 1NP4A 3NQKA 2YG2A 2WEXA 3D95A 1X71A 1YP6A 3RKGA 4YGZA 4KC7A 5F6BA 2HZQA 2WR6A 3BS2A 5K67A 3U0DA 1BJ7A 3ZQ3A 2HZRA 2EU7X 1VYFA 3S26A 3VG4A 4ZHGA 2UYWA 3FR2A 2W2AA 3VG5A 4QNIA 3X00A 2FR3A 4LKTA 1PTSA 2RTDB 3HK1A 2M4LA 1ICNA 4IRWA 3FA6A 2POAA 2A13A 2L68A 1IKJA 2RN4A 5BVTA 3FLLA 4YBUA 1VWIB 1OEEA 5F2BA 1S44A 1TOUA 2AT6X 2IZAA 2WSJA 2UZ2A 1VYOA 3LHNA 4TKBA 3D4RA 1Y53X 3FIDA 3OD9A 2AT3X 2BS5A 2BT9A 4BJ8A 1Y9LA 4TNNA 4M7MA 4ZHCA 2GJ5A 1AVGI 1X8UA 1X8QA 3VU1A 4QGVA 2RTEB 4QZUA 2F73A 3RZYA 4WFUA 4EEJA 1E02A 4DQ4A 3DSZA 4Z2OA 4GGRA 4MVIA 1VWJB 2JU3A 2X8TA 3WJBA 2X8SA 4ODDA 4DNEA 1FEMA 1HMSA 2RCQA 5BYPA 3STMX 4RUNA 5D8JA 1P6PA 3MG5A 5H9KA 5AQ6A 1SXYA 3T6FA 2F01A 4GNWA 1N0SA 4ARHA 5HBSA 1EUOA 4FGIB 4BX7A 1GX9A 4U9CA 1IJ8A 1A18A 1I4UA 5B10O 2IZBA 1RBPA 2JU8A 1U18A 3PQSA 5LJDA 1PBYA 1SWKA 2FTBA 1GX3A 3CQNA 2LBVA 1BEBA 2KT4B 4PJ2A 1DZPA 4BBOA 3RWXA 4INNA 2LA7A 3HOEA 3RE5A 5KICA 2RTGB 3KFIA 1LIBA 1KXOA 1ML7A 3CBSA 4NYRA 3D96A 4I3DA 1IFCA 4ZGFA 3CQRA 1LCZA 1YWCA 2CBRA 3PH6A 4O4OA 4YDAA 4DQ3A 3FELA 2X55A 5D47A 1OEKA 4N7DA 4BX7B 4ZCBA 4ZFXA 1QFTA 1G85A 1MVGA 1LFOA 1SWJA 4HFOA 3S5VA 3WZQA 1O8VA 1Z24A 3FYFA 3B2HA 3FW4A 4U8UM 2FKJA 1GT5A 1SLFB 3HWGA 3GAQA 2Q9SA 4HPAA 4ZR2A 2LBAA 3JSQA 2OYBO 4YFRA 3K3LA 1SWBA 1QFVA 1GX8A 4CPIA 4FBOA 5B3MO 2X45A 2G5LA 1SWUA 4ZH9A 2CBSA 4NNSA 4YKMA 2K62A 4ORSA 3VHIA 2Y32A 1STSB 1N9YA 3BRNA 3WJCA 3NPOA 4A1YA 4OELA 5JR8A 1CBRA 1LDOA 4LZUA 5FQ7E 1EPAA 1BRQA 1LPJA 1KFFA 1EIOA 2QO6A 1KT6A 2QCBA 3STNA 4Y0PA 3RY2A 1ADLA 2AF5A 2LKKA 1S7DA 1BSYA 1STPA 4GKCA 1HQQA 1JYJA 1BSQA 1VYGA 1CBIA 2A3FX 2JMBA 2OL8O 4I6SA 4ORRA 3ZWEA 2BS6A 5LJKA 5F58A 2HNXA 3VHHA 5HAEA 5LKEA 4AZOA 1ERBA 1D2UA 1O1VA 1GKAA 5EZ2A 3OJYC 3I17A 3VE1A 4EXZA 3C78X 4Y59A 2IZHB 4AZMA 3T2WA 1GM6A 3BSZE 1I78A 1SRHA 4YKOA 3HOLA 1TXLA 5FQ8E 5L8NA 3Q6LA 4OS0A 1YUPA 3DTQA 4R0BA 5FQ6E 1GT3A 4ORXA 2CZUA 2QMIA 2NNDA 1I05A 3B2KA 3BLGA 4GD9A 4BX6B 4M6SA 1G5WA 4XMDA 1UYNX 2FT9A 2VFBA 3F6ZB 4WHIA 2X32A 3P6GA 4Y0RA 1XKIA 2X8FA 4YCHA 5HZ6A 3O2YA 1LDQA 2ASNX 2R74A 3WVMA 1SWOA 3FIQA 4KCAA 5B5FA 1AELA 1RXKA 3ELXA 4MIRA 3P6HA 1JBHA 1L6MA 3B2LA 2RTJA 2OVDA 5HA1A 2VFCA 2W2BA 3KQ0A 3EMMA 1OBQA 5IO7A 1JMZA 3PECA
chains in the Genus database with same CATH topology
3FW5A 5EDBA 5FENA 3FEPA 2KTSA 1EQDA 1GT1A 1RLBE 3ZW0B 1X89A 1EIIA 3FR5A 3PP6A 3CBCA 2ANSA 2FWVA 1IIUA 1R0UA 3HWDA 4QAEA 1JIWI 2WQAE 1BM5A 4TJZA 1KZWA 1ZNEA 5HZ5A 3D97A 2GC9A 5EDCA 5LJCA 1AB0A 1ALBA 1FELA 1LF7A 4EFGA 2FS7A 1ERXA 2XKLA 2MJIA 4I3BA 4I9RA 5AJCA 3U9PC 3RSWA 2NNQA 1LIDA 4QGXA 2OZQA 3LV4A 1T0VA 4D6BA 2Q4NA 2HYSA 2WWPA 4ML7B 1TW4A 3BX8A 3NADA 2G78A 4U3QA 1NP1A 4UU2A 1SXUA 4XMEA 2MM3A 1KT7A 4ZHDA 1CBQA 2BLGA 1B0OA 4ORUA 4KIIA 2FS6A 1LNMA 1B8EA 5BVQA 1X8NA 4ZHFA 2LFOA 4HWMA 4L1NA 1KT5A 1G74A 5LJGA 3ZUOA 2CM9A 4CK4A 4L3RA 1E06A 3B2IA 1YP7A 3TGAA 2MHDA 4O3ZA 1B4MA 1E5PA 1FDQA 4O9SA 1JJXA 2YMSA 3NR3A 2WUTA 4YDBA 3NBXX 1BBPA 1MX8A 2QO5A 3ZUIA 3EYCA 3ZW2A 5LJHA 4IABA 3CMPA 2CZTA 2O62A 4YGGA 2K23A 1EALA 5K06A 4ORWA 2HMBA 3H3IA 5HCDC 5D45A 3U03A 5FAZA 1PEEA 1HN2A 5H9AA 3NQ9A 1CBSA 3P6EA 3SAOA 3VG3A 3ZW1A 3CWKA 3TGBA 3STKA 2KTDA 2GTFX 3P24A 1H91A 4FBRA 3EBKA 1QABE 3G7XA 1PM1X 3KFHA 4BQUA 3AKNA 4ID2A 1O1UA 3ZI8A 1I06A 1DC9A 2G79A 4O3XB 4AW8A 4QQ1A 2IFBA 3E3CA 4GDZA 3SOTA 1BRPA 4LQZA 4EDEA 4IB6A 3KFGA 4IB9A 3FMZA 4CV7A 2ZAIA 1PBOA 4IMOA 2L67A 4AYHA 4U8UN 3HTYA 4YMYA 3O22A 2OFMX 1SY2A 3BY0A 5HTDA 2CM4A 5H9LA 1FTPA 1DZKA 1OPAA 2JU7A 1KQXA 2AT8X 5HWZA 4NNTA 3NX2A 2PY1A 2R56A 3UEVA 1SXWA 1AQBA 4PSQA 1HBPA 5HTEA 1BWYA 4TKHA 4IMNA 3IFBA 2Q2MA 4ALOA 3GE2A 4YBPA 2RD7C 1KT3A 4NLIA 3O19A 4I3CA 4YFPA 4KT5A 4KH8A 1EW3A 3WJDA 4U8UO 3VPJE 2JW1A 1KGLA 2OVEA 1ZRYA 2ALLX 2JOZA 4ORYA 3JS1A 2N93A 2A0AA 1GKAB 2AL0X 3PPTA 2GTLM 4D6AA 4NYQA 3UEXA 1TOWA 4MVLA 3MX7A 5B29A 5IO5A 2OVSA 3FA8A 1ZNDA 2FLJA 4ALBA 4QZTA 1FENA 4UU3A 5B27A 1A2DA 5D4AA 1UREA 3WJGA 2Z4IA 1A3YA 3F8AA 2Z4HA 1T8VA 1MX7A 3BU9A 1JJJA 3UEUA 3EM0A 3NX1A 1YWBA 1LICA 4BOEA 3APVA 2NP1A 4GH7A 2HLVA 3WBGA 2F09A 3OBLA 4ZGUA 5C0NA 4OMWA 4Y0QA 2Q2PA 1DFVA 1KQWA 5AJBA 5DPQA 3WXQA 4GRJA 4O4SA 4GU8A 3PEDA 1NGLA 1LKEA 4IAXA 4OS8A 4QRLA 3C77X 4ZHHA 4AZNA 4QYNA 3ZZVA 5F1EA 5DG4A 5AEOA 1QWDA 3FENA 1QQSA 3FA7A 2ZAGA 1X8PA 4NW4A 4NLJA 1JV4A 3KZAA 2KD2A 4GNYA 4YCEA 1OBUA 2FRSA 3P6DA 2L9CA 1BSOA 2JN3A 4BVMA 4TLJA 3APWA 3B2JA 3N91A 5CYBA 4EQAC 4KC8A 1IFBA 1IW2A 2XSTA 2E4JA 1KZXA 1QY1A 5F7GA 5FFHA 2AT0X 5D48A 1DF3A 2G7BA 2WQ9A 4OMXA 4YGHA 4O49A 5EPQA 4ON1A 4GK9A 5HCEC 3WOVA 5LJEA 1QY2A 2NNEA 1GT4A 3C76X 4AZPA 4A8ZA 2L5PA 3I0AA 1HQPA 3IA8A 3MVFA 4AZQA 1TVQA 3V8UA 5L8OA 5KIDA 4HPDA 1I04A 4N7CA 1UZ2X 1A57A 1S2PA 3HWEA 5H9NA 4IBAA 4O3YA 1BLRA 3EBWA 3S60A 3BX7A 1PMPA 4FQBB 3F9DA 5CE4A 3APXA 4O4UA 2ACPX 4O3WA 2QM9A 1ZNKA 3VG2A 1GGLA 1JYDA 1QG5A 1YWDA 1VPRA 1U0XA 1E00A 4O4XA 5KHPA 5EEEA 1SA8A 5LKFA 1LIFA 2AH7X 1CJ5A 3HWFA 3ZW1B 4CSBA 1MDCA 1JZUA 1EXSA 4FBVA 1IKEA 1DZMA 3UEWA 1OEJA 3FA9A 4JGLA 4ZH6A 3TZSA 4Y0SA 4XMGA 5HA0A 5EEDA 4XMFA 3P02A 2MWHA 1KOIA 1U17A 1ICMA 4QGWA 3TF6A 2X46A 3CR6A 2BHVA 1MUPA 1SY0A 5BVSA 5LJBA 5HZ9A 1B56A 2A2GA 1EPBA 3FEKA 4HPCA 2AKQA 3APUA 3PH5A 4A60A 1OPBA 4TQ2A 1YIVA 3NP1A 1EI5A 4K19A 1OBPA 4GETA 3BDRA 1X8OA 4MVEA 4QYPA 3VE2A 2ACOA 4ES7A 4MISA 2QOSC 3PQUA 4GZVA 4LZVA 4MVKA 5L8IA 5IO6A 1GXAA 4ZJ0A 1ZNLA 4I9SA 1G7NA 1DZJA 1CRBA 4XMCA 4NP1A 2KW1A 1SMPI 2FR2A 4IAWA 4WBKA 4YFQA 5HZ8A 1ACDA 2DM5A 2RA6A 3S5XA 3T1DA 5HZQA 3P6FA 4HPBA 4A1HA 1LIEA 4RUUA 3ELZA 4LKPA 2A2UA 5HCCC 3WJFA 4XMHA 1ZNHA 2AT5X 4YH0A 1SY1A 2GTLN 3NQ3A 2QO4A 4OS3A 3RBYA 4I95A 4IB7A 4GE1A 2RCTA 2RQ0A 2OVAA 5F6ZA 1XCAA 3OE3A 1SXXA 3JQOA 4COTA 3WJEA 1HBQA 1T68X 3ZW0A 4IB8A 4TKJA 2WEWA 3VG6A 1DV9A 2P8GA 1SY3A 2Q39A 2OFRX 4AZRA 2AMMX 3QKGA 3UAQA 1ZNGA 2LB6A 1HMRA 2W2FA 3KFFA 3AKMA 2R73A 1YWAA 3MBTA 3VG7A 3TGCA 1D3SA 1QY0A 2GTLO 3P6CA 4WFVA 5H8TA 2MO5A 1Y9TA 3L4RA 1KT4A 1HMTA 3BU1A 1FE3A 3FR4A 1NP4A 3NQKA 2YG2A 2WEXA 3D95A 1X71A 1YP6A 3RKGA 4YGZA 4KC7A 5F6BA 2HZQA 2WR6A 3BS2A 3U0DA 1BJ7A 3ZQ3A 2HZRA 2EU7X 1VYFA 3S26A 3VG4A 4ZHGA 3FR2A 2W2AA 3VG5A 4QNIA 2FR3A 4LKTA 3HK1A 2M4LA 1ICNA 3FA6A 2POAA 2A13A 2L68A 1IKJA 2RN4A 5BVTA 3FLLA 4YBUA 1OEEA 1S44A 1TOUA 2AT6X 2WSJA 3LHNA 4TKBA 3D4RA 3OD9A 2AT3X 2BS5A 2BT9A 4ZHCA 1Y9LA 4TNNA 4M7MA 2GJ5A 1AVGI 1X8UA 1X8QA 3VU1A 4QGVA 4QZUA 2F73A 3RZYA 4WFUA 4EEJA 1E02A 4DQ4A 3DSZA 4MVIA 2X8TA 2JU3A 3WJBA 2X8SA 4ODDA 1FEMA 1HMSA 2RCQA 5BYPA 3STMX 4RUNA 5D8JA 1P6PA 5H9KA 5AQ6A 1SXYA 4GNWA 1N0SA 4ARHA 5HBSA 1EUOA 4FGIB 1GX9A 4U9CA 1A18A 1I4UA 1RBPA 2JU8A 1U18A 3PQSA 5LJDA 2LBVA 2FTBA 3CQNA 1BEBA 2KT4B 4PJ2A 1DZPA 3RWXA 4INNA 2LA7A 3HOEA 5KICA 3KFIA 1LIBA 1KXOA 1ML7A 3CBSA 4NYRA 3D96A 4I3DA 1IFCA 4ZGFA 3CQRA 1YWCA 2CBRA 3PH6A 4O4OA 4DQ3A 4YDAA 3FELA 5D47A 1OEKA 4N7DA 4ZFXA 4ZCBA 1QFTA 1G85A 1MVGA 1LFOA 4HFOA 3S5VA 1O8VA 1Z24A 3FYFA 3B2HA 3FW4A 4U8UM 1GT5A 3HWGA 3GAQA 2Q9SA 4HPAA 4ZR2A 2LBAA 3JSQA 4YFRA 3K3LA 1QFVA 1GX8A 4FBOA 2X45A 4ZH9A 2CBSA 4NNSA 4YKMA 2K62A 4ORSA 3WJCA 3BRNA 3NPOA 4A1YA 5JR8A 1CBRA 4LZUA 5FQ7E 1EPAA 1BRQA 1LPJA 1EIOA 2QO6A 1KT6A 3STNA 4Y0PA 1ADLA 2LKKA 1S7DA 1BSYA 4GKCA 2JMBA 2A3FX 1JYJA 1BSQA 1CBIA 1VYGA 4I6SA 4ORRA 3ZWEA 5LKEA 5LJKA 2BS6A 5F58A 2HNXA 5HAEA 4AZOA 1ERBA 1D2UA 1O1VA 1GKAA 5EZ2A 3OJYC 3I17A 3VE1A 4EXZA 3C78X 4AZMA 1GM6A 3BSZE 4YKOA 3HOLA 1TXLA 5FQ8E 5L8NA 3Q6LA 4OS0A 1YUPA 3DTQA 4R0BA 5FQ6E 1GT3A 4ORXA 2CZUA 2QMIA 2NNDA 1I05A 3B2KA 3BLGA 4M6SA 1G5WA 4XMDA 3F6ZB 2FT9A 4Y0RA 4YCHA 4WHIA 3P6GA 1XKIA 2X8FA 5HZ6A 3O2YA 2ASNX 2R74A 3WVMA 3FIQA 1AELA 4KCAA 3ELXA 4MIRA 3P6HA 1JBHA 1L6MA 3B2LA 2OVDA 5HA1A 2W2BA 3KQ0A 3EMMA 1OBQA 5IO7A 3PECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FW5 A;  5EDB A;  5FEN A;  3FEP A;  1EQD A;  1GT1 A;  1RLB E;  1EII A;  1X89 A;  3FR5 A;  3PP6 A;  3CBC A;  2ANS A;  2FWV A;  1IIU A;  1R0U A;  3HWD A;  4QAE A;  2WQA E;  1KZW A;  1BM5 A;  4TJZ A;  1ZNE A;  5HZ5 A;  3D97 A;  2GC9 A;  5EDC A;  5LJC A;  1AB0 A;  1ALB A;  1FEL A;  1LF7 A;  4EFG A;  2FS7 A;  1ERX A;  2XKL A;  2MJI A;  4I3B A;  4I9R A;  3U9P C;  3RSW A;  2NNQ A;  1LID A;  4QGX A;  2OZQ A;  1T0V A;  4D6B A;  2Q4N A;  2HYS A;  2WWP A;  1TW4 A;  3BX8 A;  3NAD A;  2G78 A;  1NP1 A;  4UU2 A;  1SXU A;  4XME A;  2MM3 A;  1KT7 A;  4ZHD A;  1CBQ A;  2BLG A;  1B0O A;  4ORU A;  4KII A;  2FS6 A;  1LNM A;  1B8E A;  5BVQ A;  1X8N A;  4ZHF A;  2LFO A;  1KT5 A;  1G74 A;  5LJG A;  3ZUO A;  2CM9 A;  4CK4 A;  1E06 A;  3B2I A;  1YP7 A;  3TGA A;  1B4M A;  1E5P A;  1FDQ A;  4O9S A;  1JJX A;  3NR3 A;  2WUT A;  4YDB A;  1BBP A;  1MX8 A;  2QO5 A;  3ZUI A;  3EYC A;  5LJH A;  3CMP A;  2CZT A;  2O62 A;  4YGG A;  2K23 A;  1EAL A;  5K06 A;  4ORW A;  2HMB A;  5HCD C;  5D45 A;  3U03 A;  5FAZ A;  1PEE A;  1HN2 A;  5H9A A;  3NQ9 A;  1CBS A;  3P6E A;  3SAO A;  3VG3 A;  3CWK A;  3TGB A;  3STK A;  2KTD A;  2GTF X;  1H91 A;  3EBK A;  1QAB E;  3G7X A;  1PM1 X;  3KFH A;  4BQU A;  3AKN A;  1O1U A;  1I06 A;  1DC9 A;  2G79 A;  4AW8 A;  2IFB A;  1BRP A;  4EDE A;  4IB6 A;  3KFG A;  4IB9 A;  3FMZ A;  1PBO A;  4IMO A;  2L67 A;  4AYH A;  4YMY A;  3O22 A;  2OFM X;  1SY2 A;  3BY0 A;  5HTD A;  2CM4 A;  5H9L A;  1FTP A;  1DZK A;  1OPA A;  2JU7 A;  1KQX A;  2AT8 X;  5HWZ A;  4NNT A;  3NX2 A;  2PY1 A;  2R56 A;  3UEV A;  1SXW A;  1AQB A;  4PSQ A;  1HBP A;  5HTE A;  1BWY A;  4TKH A;  4IMN A;  3IFB A;  2Q2M A;  4ALO A;  4YBP A;  2RD7 C;  1KT3 A;  4NLI A;  3O19 A;  4I3C A;  4YFP A;  1EW3 A;  3WJD A;  1KGL A;  2OVE A;  1ZRY A;  2ALL X;  2JOZ A;  4ORY A;  3JS1 A;  2N93 A;  2A0A A;  1GKA B;  2AL0 X;  3PPT A;  4D6A A;  4NYQ A;  3UEX A;  1TOW A;  4MVL A;  5B29 A;  5IO5 A;  3FA8 A;  1ZND A;  2FLJ A;  4ALB A;  4QZT A;  1FEN A;  4UU3 A;  5B27 A;  1A2D A;  5D4A A;  1URE A;  3WJG A;  1A3Y A;  3F8A A;  1T8V A;  1MX7 A;  3BU9 A;  1JJJ A;  3UEU A;  3EM0 A;  3NX1 A;  1YWB A;  1LIC A;  4BOE A;  3APV A;  2NP1 A;  4GH7 A;  2HLV A;  3WBG A;  4ZGU A;  5C0N A;  4OMW A;  4Y0Q A;  2Q2P A;  1DFV A;  1KQW A;  5DPQ A;  3WXQ A;  4GRJ A;  3PED A;  1NGL A;  1LKE A;  4IAX A;  4OS8 A;  3C77 X;  4ZHH A;  4AZN A;  4QYN A;  5F1E A;  5DG4 A;  1QWD A;  3FEN A;  1QQS A;  3FA7 A;  1X8P A;  4NLJ A;  1JV4 A;  3KZA A;  4GNY A;  4YCE A;  1OBU A;  2FRS A;  3P6D A;  2L9C A;  1BSO A;  2JN3 A;  4BVM A;  4TLJ A;  3APW A;  3B2J A;  1IFB A;  1IW2 A;  2XST A;  2E4J A;  1KZX A;  1QY1 A;  5F7G A;  5FFH A;  2AT0 X;  5D48 A;  1DF3 A;  2G7B A;  2WQ9 A;  4OMX A;  4YGH A;  5EPQ A;  5HCE C;  5LJE A;  1QY2 A;  2NNE A;  1GT4 A;  3C76 X;  4AZP A;  4A8Z A;  2L5P A;  3I0A A;  1HQP A;  3IA8 A;  3MVF A;  4AZQ A;  1TVQ A;  5L8O A;  5KID A;  4HPD A;  1I04 A;  4N7C A;  1UZ2 X;  1A57 A;  1S2P A;  3HWE A;  5H9N A;  4IBA A;  1BLR A;  3EBW A;  3BX7 A;  1PMP A;  3F9D A;  5CE4 A;  3APX A;  2ACP X;  2QM9 A;  1ZNK A;  3VG2 A;  1GGL A;  1JYD A;  1QG5 A;  1YWD A;  1VPR A;  1U0X A;  1E00 A;  5KHP A;  5EEE A;  1SA8 A;  5LKF A;  1LIF A;  2AH7 X;  1CJ5 A;  3HWF A;  1MDC A;  1JZU A;  1EXS A;  1IKE A;  1DZM A;  3UEW A;  1OEJ A;  3FA9 A;  4ZH6 A;  3TZS A;  4Y0S A;  4XMG A;  5HA0 A;  5EED A;  4XMF A;  1KOI A;  1U17 A;  1ICM A;  4QGW A;  3TF6 A;  2X46 A;  3CR6 A;  5BVS A;  1MUP A;  1SY0 A;  5LJB A;  5HZ9 A;  1B56 A;  2A2G A;  1EPB A;  3FEK A;  4HPC A;  2AKQ A;  3APU A;  3PH5 A;  4A60 A;  1OPB A;  4TQ2 A;  1YIV A;  3NP1 A;  4K19 A;  1OBP A;  4GET A;  3BDR A;  1X8O A;  4QYP A;  2ACO A;  4ES7 A;  4MVK A;  2QOS C;  5L8I A;  4LZV A;  5IO6 A;  1GXA A;  4ZJ0 A;  1ZNL A;  4I9S A;  1G7N A;  1DZJ A;  1CRB A;  4XMC A;  4NP1 A;  2FR2 A;  4IAW A;  4WBK A;  4YFQ A;  5HZ8 A;  1ACD A;  2DM5 A;  2RA6 A;  3T1D A;  5HZQ A;  3P6F A;  4HPB A;  4A1H A;  1LIE A;  4RUU A;  3ELZ A;  4LKP A;  2A2U A;  5HCC C;  3WJF A;  4XMH A;  1ZNH A;  2AT5 X;  4YH0 A;  1SY1 A;  3NQ3 A;  2QO4 A;  4OS3 A;  4IB7 A;  4GE1 A;  2RCT A;  2RQ0 A;  2OVA A;  5F6Z A;  1XCA A;  1SXX A;  3WJE A;  1HBQ A;  1T68 X;  4IB8 A;  4TKJ A;  2WEW A;  3VG6 A;  1DV9 A;  2P8G A;  1SY3 A;  2Q39 A;  2OFR X;  4AZR A;  2AMM X;  3QKG A;  1ZNG A;  2LB6 A;  1HMR A;  2W2F A;  3KFF A;  3AKM A;  2R73 A;  1YWA A;  3MBT A;  3VG7 A;  3TGC A;  1D3S A;  1QY0 A;  3P6C A;  4WFV A;  5H8T A;  2MO5 A;  3L4R A;  1KT4 A;  1HMT A;  3BU1 A;  1FE3 A;  3FR4 A;  1NP4 A;  2YG2 A;  2WEX A;  3D95 A;  1X71 A;  1YP6 A;  4YGZ A;  5F6B A;  2HZQ A;  2WR6 A;  3BS2 A;  3U0D A;  1BJ7 A;  3ZQ3 A;  2HZR A;  2EU7 X;  1VYF A;  3S26 A;  3VG4 A;  4ZHG A;  3FR2 A;  2W2A A;  3VG5 A;  2FR3 A;  4LKT A;  3HK1 A;  1ICN A;  3FA6 A;  2POA A;  2A13 A;  2L68 A;  1IKJ A;  5BVT A;  3FLL A;  4YBU A;  1OEE A;  1S44 A;  1TOU A;  2AT6 X;  2WSJ A;  4TKB A;  2AT3 X;  4ZHC A;  4TNN A;  4M7M A;  2GJ5 A;  1AVG I;  1X8U A;  1X8Q A;  4QGV A;  4QZU A;  2F73 A;  3RZY A;  4WFU A;  4EEJ A;  1E02 A;  4DQ4 A;  3DSZ A;  4MVI A;  3WJB A;  2JU3 A;  4ODD A;  1FEM A;  1HMS A;  2RCQ A;  3STM X;  4RUN A;  5D8J A;  1P6P A;  5H9K A;  5AQ6 A;  1SXY A;  4GNW A;  1N0S A;  4ARH A;  5HBS A;  1EUO A;  1GX9 A;  1A18 A;  1I4U A;  1RBP A;  2JU8 A;  1U18 A;  5LJD A;  2LBV A;  2FTB A;  3CQN A;  1BEB A;  2KT4 B;  1DZP A;  5KIC A;  3KFI A;  1LIB A;  1KXO A;  1ML7 A;  3CBS A;  4NYR A;  3D96 A;  4I3D A;  1IFC A;  3CQR A;  1YWC A;  2CBR A;  3PH6 A;  4DQ3 A;  4YDA A;  3FEL A;  5D47 A;  1OEK A;  4N7D A;  4ZFX A;  4ZCB A;  1QFT A;  1G85 A;  1MVG A;  1LFO A;  4HFO A;  1O8V A;  1Z24 A;  3B2H A;  3FW4 A;  1GT5 A;  3HWG A;  3GAQ A;  2Q9S A;  4HPA A;  4ZR2 A;  2LBA A;  3JSQ A;  4YFR A;  3K3L A;  1QFV A;  1GX8 A;  2X45 A;  4ZH9 A;  2CBS A;  4NNS A;  4YKM A;  2K62 A;  4ORS A;  3WJC A;  3BRN A;  3NPO A;  4A1Y A;  5JR8 A;  1CBR A;  4LZU A;  1EPA A;  1BRQ A;  1LPJ A;  1EIO A;  2QO6 A;  1KT6 A;  3STN A;  4Y0P A;  1ADL A;  2LKK A;  1S7D A;  1BSY A;  4GKC A;  2A3F X;  1JYJ A;  1BSQ A;  1VYG A;  1CBI A;  4ORR A;  5LKE A;  5LJK A;  5F58 A;  2HNX A;  5HAE A;  4AZO A;  1ERB A;  1D2U A;  1O1V A;  1GKA A;  5EZ2 A;  3OJY C;  3I17 A;  4EXZ A;  3C78 X;  4AZM A;  1GM6 A;  3BSZ E;  4YKO A;  1TXL A;  5L8N A;  3Q6L A;  4OS0 A;  1YUP A;  3DTQ A;  4R0B A;  1GT3 A;  4ORX A;  2CZU A;  2NND A;  1I05 A;  3B2K A;  3BLG A;  4M6S A;  1G5W A;  4XMD A;  4Y0R A;  2FT9 A;  4YCH A;  3P6G A;  1XKI A;  5HZ6 A;  3O2Y A;  2ASN X;  2R74 A;  3WVM A;  3FIQ A;  1AEL A;  3ELX A;  3P6H A;  1JBH A;  1L6M A;  3B2L A;  2OVD A;  5HA1 A;  2W2B A;  3KQ0 A;  3EMM A;  1OBQ A;  5IO7 A;  3PEC A; 
#chains in the Genus database with same CATH topology
 3FW5 A;  2IZE B;  3WYP A;  5EDB A;  5FEN A;  3FEP A;  2KTS A;  1EQD A;  1GT1 A;  1I9H A;  1RLB E;  1X89 A;  3ZW0 B;  1EII A;  1JJU A;  3FR5 A;  3PP6 A;  1VWH B;  3CBC A;  3SZH A;  2ANS A;  2FWV A;  1IIU A;  1R0U A;  3HWD A;  4QAE A;  4Z28 A;  1JIW I;  1VWD B;  1VWN B;  2WQA E;  4TJZ A;  1ZNE A;  5HZ5 A;  3D97 A;  1N7Y A;  2GC9 A;  5EDC A;  5LJC A;  1SRF A;  1AB0 A;  1ALB A;  1FEL A;  1LF7 A;  4EFG A;  5B2A O;  2FS7 A;  1ERX A;  2FHL A;  2MJI A;  1LCW A;  2XKL A;  2A5B A;  1DF8 A;  4I3B A;  4I9R A;  5AJC A;  4GUZ A;  1MM9 A;  3U9P C;  3RSW A;  1SWT A;  2NNQ A;  1LUQ A;  1LID A;  1SWG A;  4QGX A;  2OZQ A;  3LV4 A;  1T0V A;  5IRU A;  3RDU A;  4D6B A;  2Q4N A;  2HYS A;  2WWP A;  4ML7 B;  1TW4 A;  3BX8 A;  3NAD A;  2G78 A;  4U3Q A;  1NP1 A;  4UU2 A;  1SXU A;  4XME A;  2OY5 O;  2MM3 A;  1KT7 A;  1AVE A;  4ZHD A;  1KZW A;  1CBQ A;  1N43 A;  1B0O A;  2BLG A;  2MF6 A;  4ORU A;  4CDC A;  4KII A;  2FS6 A;  1LNM A;  2RTC B;  1B8E A;  4B55 A;  2OF9 A;  5BVQ A;  1X8N A;  4ZHF A;  2LFO A;  3WZN A;  3CKG A;  4HWM A;  4L1N A;  4EQA C;  1KT5 A;  1G74 A;  1W5R A;  3MM0 A;  5LJG A;  3ZUO A;  3RDQ A;  2CM9 A;  2ZSC A;  4CK4 A;  3FDC A;  4L3R A;  3PK2 A;  1E06 A;  3B2I A;  1YP7 A;  3TGA A;  2MHD A;  2OFA A;  4O3Z A;  1HXL A;  2GH7 A;  1B4M A;  1OSP O;  1SWF A;  1E5P A;  1FDQ A;  3EW2 A;  3WZP A;  4O9S A;  1JJX A;  2YMS A;  1VWB B;  3NR3 A;  2WUT A;  4YDB A;  3NBX X;  1BBP A;  1MX8 A;  1VWO B;  2QO5 A;  2RTL A;  3ZUI A;  3EYC A;  3ZW2 A;  4GGZ A;  1RST B;  5LJH A;  1KL5 A;  4IAB A;  3CMP A;  2CZT A;  2O62 A;  1STR B;  1W4T A;  4BX5 A;  4YGG A;  2K23 A;  3VGW A;  5K06 A;  3SZJ A;  1EAL A;  4ORW A;  2HMB A;  3H3I A;  5HCD C;  5D45 A;  3U03 A;  2X4M A;  4JO6 A;  2RTQ B;  1HN2 A;  1Y52 X;  5FAZ A;  1PEE A;  4BCS A;  1NQN A;  5H9A A;  3NQ9 A;  1CBS A;  3P6E A;  3SAO A;  3VG3 A;  3ZW1 A;  2VDF A;  3CWK A;  3TGB A;  5IRW A;  1VWL B;  4GDA A;  3STK A;  2KTD A;  2GTF X;  3P24 A;  1H91 A;  4FBR A;  3EBK A;  2A8G A;  1QAB E;  1MEP A;  3G7X A;  1PM1 X;  3KFH A;  4BQU A;  3RDS A;  3AKN A;  4ID2 A;  2RTR B;  1O1U A;  1RAV A;  3ZI8 A;  1I06 A;  1DC9 A;  1SLE B;  4I60 A;  2G79 A;  4O3X B;  3T2X A;  4AW8 A;  4BX5 B;  4QQ1 A;  4CPH A;  2IFB A;  3E3C A;  4GDZ A;  3SOT A;  2OY8 A;  1BRP A;  3Q34 A;  4LQZ A;  4EDE A;  4IB6 A;  3KFG A;  4IB9 A;  2RTF B;  3FMZ A;  4CV7 A;  2ZAI A;  1PBO A;  4IMO A;  1VWE B;  2QOM A;  2L67 A;  4AYH A;  2Y3F A;  4U8U N;  3HTY A;  4YMY A;  3O22 A;  2OFM X;  1SY2 A;  3BY0 A;  3PDF A;  1RXJ A;  2CM4 A;  1JMX A;  1FTP A;  5H9L A;  3VHM A;  5HTD A;  1DZK A;  1OPA A;  2JU7 A;  1KQX A;  2AT8 X;  2IZI A;  3AEH A;  5HWZ A;  4NNT A;  3SLJ A;  4CPH B;  3NX2 A;  2PY1 A;  2R56 A;  3UEV A;  4U46 A;  1SXW A;  1AQB A;  4PSQ A;  1HBP A;  5HTE A;  1BWY A;  2G8C O;  4TKH A;  4IMN A;  3IFB A;  2Q2M A;  5B11 O;  4ALO A;  3GE2 A;  4YBP A;  2RD7 C;  4BX6 A;  1KT3 A;  4NLI A;  3O19 A;  4I3C A;  4YFP A;  4Z2V A;  4KT5 A;  1SRG A;  4KH8 A;  1EW3 A;  3CKF A;  3WJD A;  4U8U O;  3VPJ E;  2A5C A;  2JW1 A;  1KGL A;  2OVE A;  1ZRY A;  2IZF B;  2ALL X;  2JOZ A;  4ORY A;  2WPU A;  3JS1 A;  2RTO B;  2N93 A;  4CDF A;  2A0A A;  3RE6 A;  1GKA B;  2AL0 X;  3PPT A;  5B5G A;  2GTL M;  4D6A A;  4NYQ A;  3UEX A;  1TOW A;  2IZL B;  4MVL A;  3MX7 A;  2OL6 O;  3AUM O;  3EW1 A;  5B29 A;  2OVS A;  3RDO A;  3FA8 A;  5IO5 A;  1ZND A;  2FLJ A;  4ALB A;  4QZT A;  1FEN A;  4UU3 A;  5B27 A;  1WBI A;  1A2D A;  5D4A A;  1URE A;  3SLO A;  3WJG A;  2Z4I A;  1A3Y A;  1LCV A;  1NC9 A;  3F8A A;  2Z4H A;  1SWR A;  1NDJ A;  1T8V A;  1MX7 A;  2IZD B;  3BU9 A;  4NV7 A;  3HPE A;  1JJJ A;  3UEU A;  3EM0 A;  3NX1 A;  1YWB A;  1LIC A;  4BOE A;  3APV A;  2NP1 A;  4GH7 A;  2HLV A;  4CPE A;  2RTB B;  3WBG A;  2F09 A;  3OBL A;  4ZGU A;  5C0N A;  4OMW A;  4Y0Q A;  2Q2P A;  1DFV A;  1KQW A;  1SWP A;  5AJB A;  5DPQ A;  3WXQ A;  4GRJ A;  4O4S A;  4GU8 A;  1MK5 A;  3PED A;  1NGL A;  1LKE A;  4IAX A;  4OS8 A;  4QRL A;  3C77 X;  4ZHH A;  4AZN A;  4NV8 A;  1SWC A;  4QYN A;  3ZZV A;  2FKG A;  5F1E A;  1HXZ A;  1RXH A;  5DG4 A;  5AEO A;  1QWD A;  3FEN A;  2OY1 O;  1QQS A;  3FA7 A;  2ZAG A;  1X8P A;  4NW4 A;  4NLJ A;  3RDX A;  1JV4 A;  2IZG B;  3KZA A;  1FJ1 E;  4C5P A;  2KD2 A;  4GNY A;  1NBX A;  2FHN X;  4YCE A;  1OBU A;  2FRS A;  3P6D A;  2L9C A;  1BSO A;  2JN3 A;  4BVM A;  4TLJ A;  3APW A;  3B2J A;  3N91 A;  1VWR B;  2IZC B;  4KC8 A;  1IFB A;  4JNJ A;  1SLG B;  1VWF B;  1IW2 A;  2FGS A;  4GJV A;  2XST A;  2E4J A;  1KZX A;  1QY1 A;  5F7G A;  5FFH A;  2AT0 X;  1SWD A;  2RTN B;  5D48 A;  1DF3 A;  4GGT A;  1K24 A;  2G7B A;  2WQ9 A;  4OMX A;  2BC3 A;  4O49 A;  4YGH A;  4ON1 A;  4GK9 A;  5EPQ A;  5HCE C;  3WOV A;  5LJE A;  2PI3 O;  1QY2 A;  2NNE A;  1GT4 A;  2C1S A;  3C76 X;  4AZP A;  4A8Z A;  4OEM A;  4OKA A;  2L5P A;  3I0A A;  1HQP A;  3IA8 A;  3MVF A;  4AZQ A;  1TVQ A;  3V8U A;  1JQP A;  5JD2 A;  2DJF A;  5L8O A;  1MOY A;  4HPD A;  4CDE A;  5KID A;  1VWQ B;  1VWP B;  1I04 A;  4N7C A;  2DJG A;  1UZ2 X;  1A57 A;  1S2P A;  3HWE A;  5H9N A;  4IBA A;  4O3Y A;  1BLR A;  1VWM B;  3EBW A;  3BX7 A;  3S60 A;  1PMP A;  4Z6J A;  4FQB B;  3F9D A;  5CE4 A;  3APX A;  4O4U A;  2ACP X;  2IZJ A;  4O3W A;  1KL4 A;  1SRE A;  2QM9 A;  3RY1 A;  1ZNK A;  2I5V O;  3VG2 A;  1GGL A;  1JYD A;  1QG5 A;  3SZI A;  2AVI A;  1YWD A;  1RSU B;  1VPR A;  2OL7 A;  1U0X A;  1E00 A;  4O4X A;  5KHP A;  1VWA B;  2I5Z O;  2RTA A;  5EEE A;  1N4J A;  1SA8 A;  5LKF A;  1LIF A;  2AH7 X;  1CJ5 A;  3HWF A;  3ZW1 B;  4CSB A;  1MDC A;  1JZU A;  1EXS A;  4FBV A;  1IKE A;  1DZM A;  3RDM A;  1OEJ A;  3FA9 A;  4JGL A;  4ZH6 A;  3KVN A;  3UEW A;  3TZS A;  2CAM A;  4Y0S A;  4XMG A;  5HA0 A;  3SLT A;  2OF8 A;  1SRI A;  2Y3E A;  4XMF A;  5EED A;  4CDD A;  3P02 A;  2MWH A;  1KOI A;  1U17 A;  1ICM A;  1SWA A;  4QGW A;  2X46 A;  3TF6 A;  3WZO A;  1UYO X;  1VWC B;  4YVB A;  3CR6 A;  2RTM A;  4Z27 A;  2BHV A;  1MUP A;  1SY0 A;  5CYB A;  5BVS A;  5HZ9 A;  5LJB A;  5CSE A;  1B56 A;  2A2G A;  1EPB A;  3FEK A;  4HPC A;  2AKQ A;  3APU A;  3PH5 A;  4A60 A;  1OPB A;  4TQ2 A;  1YIV A;  5L3Y A;  3NP1 A;  1EI5 A;  4K19 A;  1OBP A;  4GET A;  3BDR A;  1X8O A;  4MVE A;  1BM5 A;  4QYP A;  3VE2 A;  2X56 A;  1W6F A;  1SWQ A;  2ACO A;  2RTH B;  4ES7 A;  2JGS A;  2QOS C;  3PQU A;  4GJS A;  4GZV A;  4LZV A;  4MIS A;  4MVK A;  5L8I A;  4EKV A;  1GXA A;  5IO6 A;  4ZJ0 A;  1Y0G A;  1ZNL A;  1HY2 A;  4I9S A;  1G7N A;  1DZJ A;  1CRB A;  4XMC A;  4NP1 A;  2KW1 A;  1SMP I;  2FR2 A;  2IZK A;  1SWH A;  4IAW A;  4WBK A;  4YFQ A;  2C1Q A;  5HZ8 A;  1ACD A;  1SRJ A;  1SWN A;  3QQ2 A;  2DM5 A;  2RA6 A;  3S5X A;  4Y5D A;  3T1D A;  4MEE A;  5HZQ A;  3P6F A;  2OFB A;  4HPB A;  4A1H A;  4Z2P A;  1LIE A;  4RUU A;  1NQM A;  4DCB A;  3ELZ A;  4LKP A;  1SWS A;  2A2U A;  2RTP B;  5HCC C;  3WJF A;  4XMH A;  1ZNH A;  1SWE A;  1Y55 X;  2AT5 X;  4YH0 A;  3LTW A;  1SY1 A;  2RTK A;  1VWK B;  2GTL N;  1LEL A;  2QO4 A;  3NQ3 A;  4OS3 A;  3RBY A;  1VWG B;  5CHK A;  3D9W A;  4I95 A;  3WYQ A;  4IB7 A;  4GE1 A;  2RCT A;  2RQ0 A;  1SWL A;  2OVA A;  5F6Z A;  2OY7 A;  1K3B A;  1XCA A;  3OE3 A;  1SXX A;  3JQO A;  4JHQ A;  5IRA A;  1HBQ A;  3WJE A;  4COT A;  1T68 X;  3ZW0 A;  1KL3 A;  4IB8 A;  2BSZ A;  4CPF A;  3EC5 A;  4TKJ A;  2WEW A;  3VG6 A;  1DV9 A;  2P8G A;  1SY3 A;  4BGF A;  1AVD A;  2OFR X;  2Q39 A;  4AZR A;  2AMM X;  3QKG A;  3UAQ A;  2C4I A;  1ZNG A;  2RTI B;  2X34 A;  5K68 A;  2LB6 A;  1SLD B;  2HKD A;  1HMR A;  1E2T A;  2W2F A;  3KFF A;  3AKM A;  2R73 A;  1YWA A;  3MBT A;  3VG7 A;  3TGC A;  1D3S A;  1QY0 A;  2GTL O;  1WUB A;  3T6L A;  3P6C A;  4WFV A;  5H8T A;  2MO5 A;  1N9M A;  1Y9T A;  3L4R A;  1KT4 A;  1HMT A;  5IXG A;  3BU1 A;  1FE3 A;  3FR4 A;  1NP4 A;  3NQK A;  2YG2 A;  2WEX A;  3D95 A;  1X71 A;  1YP6 A;  3RKG A;  4YGZ A;  4KC7 A;  5F6B A;  2HZQ A;  2WR6 A;  3BS2 A;  5K67 A;  3U0D A;  1BJ7 A;  3ZQ3 A;  2HZR A;  2EU7 X;  1VYF A;  3S26 A;  3VG4 A;  4ZHG A;  2UYW A;  3FR2 A;  2W2A A;  3VG5 A;  4QNI A;  3X00 A;  2FR3 A;  4LKT A;  1PTS A;  2RTD B;  3HK1 A;  2M4L A;  1ICN A;  4IRW A;  3FA6 A;  2POA A;  2A13 A;  2L68 A;  1IKJ A;  2RN4 A;  5BVT A;  3FLL A;  4YBU A;  1VWI B;  1OEE A;  5F2B A;  1S44 A;  1TOU A;  2AT6 X;  2IZA A;  2WSJ A;  2UZ2 A;  1VYO A;  3LHN A;  4TKB A;  3D4R A;  1Y53 X;  3FID A;  3OD9 A;  2AT3 X;  2BS5 A;  2BT9 A;  4BJ8 A;  1Y9L A;  4TNN A;  4M7M A;  4ZHC A;  2GJ5 A;  1AVG I;  1X8U A;  1X8Q A;  3VU1 A;  4QGV A;  2RTE B;  4QZU A;  2F73 A;  3RZY A;  4WFU A;  4EEJ A;  1E02 A;  4DQ4 A;  3DSZ A;  4Z2O A;  4GGR A;  4MVI A;  1VWJ B;  2JU3 A;  2X8T A;  3WJB A;  2X8S A;  4ODD A;  4DNE A;  1FEM A;  1HMS A;  2RCQ A;  5BYP A;  3STM X;  4RUN A;  5D8J A;  1P6P A;  3MG5 A;  5H9K A;  5AQ6 A;  1SXY A;  3T6F A;  2F01 A;  4GNW A;  1N0S A;  4ARH A;  5HBS A;  1EUO A;  4FGI B;  4BX7 A;  1GX9 A;  4U9C A;  1IJ8 A;  1A18 A;  1I4U A;  5B10 O;  2IZB A;  1RBP A;  2JU8 A;  1U18 A;  3PQS A;  5LJD A;  1PBY A;  1SWK A;  2FTB A;  1GX3 A;  3CQN A;  2LBV A;  1BEB A;  2KT4 B;  4PJ2 A;  1DZP A;  4BBO A;  3RWX A;  4INN A;  2LA7 A;  3HOE A;  3RE5 A;  5KIC A;  2RTG B;  3KFI A;  1LIB A;  1KXO A;  1ML7 A;  3CBS A;  4NYR A;  3D96 A;  4I3D A;  1IFC A;  4ZGF A;  3CQR A;  1LCZ A;  1YWC A;  2CBR A;  3PH6 A;  4O4O A;  4YDA A;  4DQ3 A;  3FEL A;  2X55 A;  5D47 A;  1OEK A;  4N7D A;  4BX7 B;  4ZCB A;  4ZFX A;  1QFT A;  1G85 A;  1MVG A;  1LFO A;  1SWJ A;  4HFO A;  3S5V A;  3WZQ A;  1O8V A;  1Z24 A;  3FYF A;  3B2H A;  3FW4 A;  4U8U M;  2FKJ A;  1GT5 A;  1SLF B;  3HWG A;  3GAQ A;  2Q9S A;  4HPA A;  4ZR2 A;  2LBA A;  3JSQ A;  2OYB O;  4YFR A;  3K3L A;  1SWB A;  1QFV A;  1GX8 A;  4CPI A;  4FBO A;  5B3M O;  2X45 A;  2G5L A;  1SWU A;  4ZH9 A;  2CBS A;  4NNS A;  4YKM A;  2K62 A;  4ORS A;  3VHI A;  2Y32 A;  1STS B;  1N9Y A;  3BRN A;  3WJC A;  3NPO A;  4A1Y A;  4OEL A;  5JR8 A;  1CBR A;  1LDO A;  4LZU A;  5FQ7 E;  1EPA A;  1BRQ A;  1LPJ A;  1KFF A;  1EIO A;  2QO6 A;  1KT6 A;  2QCB A;  3STN A;  4Y0P A;  3RY2 A;  1ADL A;  2AF5 A;  2LKK A;  1S7D A;  1BSY A;  1STP A;  4GKC A;  1HQQ A;  1JYJ A;  1BSQ A;  1VYG A;  1CBI A;  2A3F X;  2JMB A;  2OL8 O;  4I6S A;  4ORR A;  3ZWE A;  2BS6 A;  5LJK A;  5F58 A;  2HNX A;  3VHH A;  5HAE A;  5LKE A;  4AZO A;  1ERB A;  1D2U A;  1O1V A;  1GKA A;  5EZ2 A;  3OJY C;  3I17 A;  3VE1 A;  4EXZ A;  3C78 X;  4Y59 A;  2IZH B;  4AZM A;  3T2W A;  1GM6 A;  3BSZ E;  1I78 A;  1SRH A;  4YKO A;  3HOL A;  1TXL A;  5FQ8 E;  5L8N A;  3Q6L A;  4OS0 A;  1YUP A;  3DTQ A;  4R0B A;  5FQ6 E;  1GT3 A;  4ORX A;  2CZU A;  2QMI A;  2NND A;  1I05 A;  3B2K A;  3BLG A;  4GD9 A;  4BX6 B;  4M6S A;  1G5W A;  4XMD A;  1UYN X;  2FT9 A;  2VFB A;  3F6Z B;  4WHI A;  2X32 A;  3P6G A;  4Y0R A;  1XKI A;  2X8F A;  4YCH A;  5HZ6 A;  3O2Y A;  1LDQ A;  2ASN X;  2R74 A;  3WVM A;  1SWO A;  3FIQ A;  4KCA A;  5B5F A;  1AEL A;  1RXK A;  3ELX A;  4MIR A;  3P6H A;  1JBH A;  1L6M A;  3B2L A;  2RTJ A;  2OVD A;  5HA1 A;  2VFC A;  2W2B A;  3KQ0 A;  3EMM A;  1OBQ A;  5IO7 A;  1JMZ A;  3PEC A; 
#chains in the Genus database with same CATH homology
 3FW5 A;  5EDB A;  5FEN A;  3FEP A;  2KTS A;  1EQD A;  1GT1 A;  1RLB E;  3ZW0 B;  1X89 A;  1EII A;  3FR5 A;  3PP6 A;  3CBC A;  2ANS A;  2FWV A;  1IIU A;  1R0U A;  3HWD A;  4QAE A;  1JIW I;  2WQA E;  1BM5 A;  4TJZ A;  1KZW A;  1ZNE A;  5HZ5 A;  3D97 A;  2GC9 A;  5EDC A;  5LJC A;  1AB0 A;  1ALB A;  1FEL A;  1LF7 A;  4EFG A;  2FS7 A;  1ERX A;  2XKL A;  2MJI A;  4I3B A;  4I9R A;  5AJC A;  3U9P C;  3RSW A;  2NNQ A;  1LID A;  4QGX A;  2OZQ A;  3LV4 A;  1T0V A;  4D6B A;  2Q4N A;  2HYS A;  2WWP A;  4ML7 B;  1TW4 A;  3BX8 A;  3NAD A;  2G78 A;  4U3Q A;  1NP1 A;  4UU2 A;  1SXU A;  4XME A;  2MM3 A;  1KT7 A;  4ZHD A;  1CBQ A;  2BLG A;  1B0O A;  4ORU A;  4KII A;  2FS6 A;  1LNM A;  1B8E A;  5BVQ A;  1X8N A;  4ZHF A;  2LFO A;  4HWM A;  4L1N A;  1KT5 A;  1G74 A;  5LJG A;  3ZUO A;  2CM9 A;  4CK4 A;  4L3R A;  1E06 A;  3B2I A;  1YP7 A;  3TGA A;  2MHD A;  4O3Z A;  1B4M A;  1E5P A;  1FDQ A;  4O9S A;  1JJX A;  2YMS A;  3NR3 A;  2WUT A;  4YDB A;  3NBX X;  1BBP A;  1MX8 A;  2QO5 A;  3ZUI A;  3EYC A;  3ZW2 A;  5LJH A;  4IAB A;  3CMP A;  2CZT A;  2O62 A;  4YGG A;  2K23 A;  1EAL A;  5K06 A;  4ORW A;  2HMB A;  3H3I A;  5HCD C;  5D45 A;  3U03 A;  5FAZ A;  1PEE A;  1HN2 A;  5H9A A;  3NQ9 A;  1CBS A;  3P6E A;  3SAO A;  3VG3 A;  3ZW1 A;  3CWK A;  3TGB A;  3STK A;  2KTD A;  2GTF X;  3P24 A;  1H91 A;  4FBR A;  3EBK A;  1QAB E;  3G7X A;  1PM1 X;  3KFH A;  4BQU A;  3AKN A;  4ID2 A;  1O1U A;  3ZI8 A;  1I06 A;  1DC9 A;  2G79 A;  4O3X B;  4AW8 A;  4QQ1 A;  2IFB A;  3E3C A;  4GDZ A;  3SOT A;  1BRP A;  4LQZ A;  4EDE A;  4IB6 A;  3KFG A;  4IB9 A;  3FMZ A;  4CV7 A;  2ZAI A;  1PBO A;  4IMO A;  2L67 A;  4AYH A;  4U8U N;  3HTY A;  4YMY A;  3O22 A;  2OFM X;  1SY2 A;  3BY0 A;  5HTD A;  2CM4 A;  5H9L A;  1FTP A;  1DZK A;  1OPA A;  2JU7 A;  1KQX A;  2AT8 X;  5HWZ A;  4NNT A;  3NX2 A;  2PY1 A;  2R56 A;  3UEV A;  1SXW A;  1AQB A;  4PSQ A;  1HBP A;  5HTE A;  1BWY A;  4TKH A;  4IMN A;  3IFB A;  2Q2M A;  4ALO A;  3GE2 A;  4YBP A;  2RD7 C;  1KT3 A;  4NLI A;  3O19 A;  4I3C A;  4YFP A;  4KT5 A;  4KH8 A;  1EW3 A;  3WJD A;  4U8U O;  3VPJ E;  2JW1 A;  1KGL A;  2OVE A;  1ZRY A;  2ALL X;  2JOZ A;  4ORY A;  3JS1 A;  2N93 A;  2A0A A;  1GKA B;  2AL0 X;  3PPT A;  2GTL M;  4D6A A;  4NYQ A;  3UEX A;  1TOW A;  4MVL A;  3MX7 A;  5B29 A;  5IO5 A;  2OVS A;  3FA8 A;  1ZND A;  2FLJ A;  4ALB A;  4QZT A;  1FEN A;  4UU3 A;  5B27 A;  1A2D A;  5D4A A;  1URE A;  3WJG A;  2Z4I A;  1A3Y A;  3F8A A;  2Z4H A;  1T8V A;  1MX7 A;  3BU9 A;  1JJJ A;  3UEU A;  3EM0 A;  3NX1 A;  1YWB A;  1LIC A;  4BOE A;  3APV A;  2NP1 A;  4GH7 A;  2HLV A;  3WBG A;  2F09 A;  3OBL A;  4ZGU A;  5C0N A;  4OMW A;  4Y0Q A;  2Q2P A;  1DFV A;  1KQW A;  5AJB A;  5DPQ A;  3WXQ A;  4GRJ A;  4O4S A;  4GU8 A;  3PED A;  1NGL A;  1LKE A;  4IAX A;  4OS8 A;  4QRL A;  3C77 X;  4ZHH A;  4AZN A;  4QYN A;  3ZZV A;  5F1E A;  5DG4 A;  5AEO A;  1QWD A;  3FEN A;  1QQS A;  3FA7 A;  2ZAG A;  1X8P A;  4NW4 A;  4NLJ A;  1JV4 A;  3KZA A;  2KD2 A;  4GNY A;  4YCE A;  1OBU A;  2FRS A;  3P6D A;  2L9C A;  1BSO A;  2JN3 A;  4BVM A;  4TLJ A;  3APW A;  3B2J A;  3N91 A;  5CYB A;  4EQA C;  4KC8 A;  1IFB A;  1IW2 A;  2XST A;  2E4J A;  1KZX A;  1QY1 A;  5F7G A;  5FFH A;  2AT0 X;  5D48 A;  1DF3 A;  2G7B A;  2WQ9 A;  4OMX A;  4YGH A;  4O49 A;  5EPQ A;  4ON1 A;  4GK9 A;  5HCE C;  3WOV A;  5LJE A;  1QY2 A;  2NNE A;  1GT4 A;  3C76 X;  4AZP A;  4A8Z A;  2L5P A;  3I0A A;  1HQP A;  3IA8 A;  3MVF A;  4AZQ A;  1TVQ A;  3V8U A;  5L8O A;  5KID A;  4HPD A;  1I04 A;  4N7C A;  1UZ2 X;  1A57 A;  1S2P A;  3HWE A;  5H9N A;  4IBA A;  4O3Y A;  1BLR A;  3EBW A;  3S60 A;  3BX7 A;  1PMP A;  4FQB B;  3F9D A;  5CE4 A;  3APX A;  4O4U A;  2ACP X;  4O3W A;  2QM9 A;  1ZNK A;  3VG2 A;  1GGL A;  1JYD A;  1QG5 A;  1YWD A;  1VPR A;  1U0X A;  1E00 A;  4O4X A;  5KHP A;  5EEE A;  1SA8 A;  5LKF A;  1LIF A;  2AH7 X;  1CJ5 A;  3HWF A;  3ZW1 B;  4CSB A;  1MDC A;  1JZU A;  1EXS A;  4FBV A;  1IKE A;  1DZM A;  3UEW A;  1OEJ A;  3FA9 A;  4JGL A;  4ZH6 A;  3TZS A;  4Y0S A;  4XMG A;  5HA0 A;  5EED A;  4XMF A;  3P02 A;  2MWH A;  1KOI A;  1U17 A;  1ICM A;  4QGW A;  3TF6 A;  2X46 A;  3CR6 A;  2BHV A;  1MUP A;  1SY0 A;  5BVS A;  5LJB A;  5HZ9 A;  1B56 A;  2A2G A;  1EPB A;  3FEK A;  4HPC A;  2AKQ A;  3APU A;  3PH5 A;  4A60 A;  1OPB A;  4TQ2 A;  1YIV A;  3NP1 A;  1EI5 A;  4K19 A;  1OBP A;  4GET A;  3BDR A;  1X8O A;  4MVE A;  4QYP A;  3VE2 A;  2ACO A;  4ES7 A;  4MIS A;  2QOS C;  3PQU A;  4GZV A;  4LZV A;  4MVK A;  5L8I A;  5IO6 A;  1GXA A;  4ZJ0 A;  1ZNL A;  4I9S A;  1G7N A;  1DZJ A;  1CRB A;  4XMC A;  4NP1 A;  2KW1 A;  1SMP I;  2FR2 A;  4IAW A;  4WBK A;  4YFQ A;  5HZ8 A;  1ACD A;  2DM5 A;  2RA6 A;  3S5X A;  3T1D A;  5HZQ A;  3P6F A;  4HPB A;  4A1H A;  1LIE A;  4RUU A;  3ELZ A;  4LKP A;  2A2U A;  5HCC C;  3WJF A;  4XMH A;  1ZNH A;  2AT5 X;  4YH0 A;  1SY1 A;  2GTL N;  3NQ3 A;  2QO4 A;  4OS3 A;  3RBY A;  4I95 A;  4IB7 A;  4GE1 A;  2RCT A;  2RQ0 A;  2OVA A;  5F6Z A;  1XCA A;  3OE3 A;  1SXX A;  3JQO A;  4COT A;  3WJE A;  1HBQ A;  1T68 X;  3ZW0 A;  4IB8 A;  4TKJ A;  2WEW A;  3VG6 A;  1DV9 A;  2P8G A;  1SY3 A;  2Q39 A;  2OFR X;  4AZR A;  2AMM X;  3QKG A;  3UAQ A;  1ZNG A;  2LB6 A;  1HMR A;  2W2F A;  3KFF A;  3AKM A;  2R73 A;  1YWA A;  3MBT A;  3VG7 A;  3TGC A;  1D3S A;  1QY0 A;  2GTL O;  3P6C A;  4WFV A;  5H8T A;  2MO5 A;  1Y9T A;  3L4R A;  1KT4 A;  1HMT A;  3BU1 A;  1FE3 A;  3FR4 A;  1NP4 A;  3NQK A;  2YG2 A;  2WEX A;  3D95 A;  1X71 A;  1YP6 A;  3RKG A;  4YGZ A;  4KC7 A;  5F6B A;  2HZQ A;  2WR6 A;  3BS2 A;  3U0D A;  1BJ7 A;  3ZQ3 A;  2HZR A;  2EU7 X;  1VYF A;  3S26 A;  3VG4 A;  4ZHG A;  3FR2 A;  2W2A A;  3VG5 A;  4QNI A;  2FR3 A;  4LKT A;  3HK1 A;  2M4L A;  1ICN A;  3FA6 A;  2POA A;  2A13 A;  2L68 A;  1IKJ A;  2RN4 A;  5BVT A;  3FLL A;  4YBU A;  1OEE A;  1S44 A;  1TOU A;  2AT6 X;  2WSJ A;  3LHN A;  4TKB A;  3D4R A;  3OD9 A;  2AT3 X;  2BS5 A;  2BT9 A;  4ZHC A;  1Y9L A;  4TNN A;  4M7M A;  2GJ5 A;  1AVG I;  1X8U A;  1X8Q A;  3VU1 A;  4QGV A;  4QZU A;  2F73 A;  3RZY A;  4WFU A;  4EEJ A;  1E02 A;  4DQ4 A;  3DSZ A;  4MVI A;  2X8T A;  2JU3 A;  3WJB A;  2X8S A;  4ODD A;  1FEM A;  1HMS A;  2RCQ A;  5BYP A;  3STM X;  4RUN A;  5D8J A;  1P6P A;  5H9K A;  5AQ6 A;  1SXY A;  4GNW A;  1N0S A;  4ARH A;  5HBS A;  1EUO A;  4FGI B;  1GX9 A;  4U9C A;  1A18 A;  1I4U A;  1RBP A;  2JU8 A;  1U18 A;  3PQS A;  5LJD A;  2LBV A;  2FTB A;  3CQN A;  1BEB A;  2KT4 B;  4PJ2 A;  1DZP A;  3RWX A;  4INN A;  2LA7 A;  3HOE A;  5KIC A;  3KFI A;  1LIB A;  1KXO A;  1ML7 A;  3CBS A;  4NYR A;  3D96 A;  4I3D A;  1IFC A;  4ZGF A;  3CQR A;  1YWC A;  2CBR A;  3PH6 A;  4O4O A;  4DQ3 A;  4YDA A;  3FEL A;  5D47 A;  1OEK A;  4N7D A;  4ZFX A;  4ZCB A;  1QFT A;  1G85 A;  1MVG A;  1LFO A;  4HFO A;  3S5V A;  1O8V A;  1Z24 A;  3FYF A;  3B2H A;  3FW4 A;  4U8U M;  1GT5 A;  3HWG A;  3GAQ A;  2Q9S A;  4HPA A;  4ZR2 A;  2LBA A;  3JSQ A;  4YFR A;  3K3L A;  1QFV A;  1GX8 A;  4FBO A;  2X45 A;  4ZH9 A;  2CBS A;  4NNS A;  4YKM A;  2K62 A;  4ORS A;  3WJC A;  3BRN A;  3NPO A;  4A1Y A;  5JR8 A;  1CBR A;  4LZU A;  5FQ7 E;  1EPA A;  1BRQ A;  1LPJ A;  1EIO A;  2QO6 A;  1KT6 A;  3STN A;  4Y0P A;  1ADL A;  2LKK A;  1S7D A;  1BSY A;  4GKC A;  2JMB A;  2A3F X;  1JYJ A;  1BSQ A;  1CBI A;  1VYG A;  4I6S A;  4ORR A;  3ZWE A;  5LKE A;  5LJK A;  2BS6 A;  5F58 A;  2HNX A;  5HAE A;  4AZO A;  1ERB A;  1D2U A;  1O1V A;  1GKA A;  5EZ2 A;  3OJY C;  3I17 A;  3VE1 A;  4EXZ A;  3C78 X;  4AZM A;  1GM6 A;  3BSZ E;  4YKO A;  3HOL A;  1TXL A;  5FQ8 E;  5L8N A;  3Q6L A;  4OS0 A;  1YUP A;  3DTQ A;  4R0B A;  5FQ6 E;  1GT3 A;  4ORX A;  2CZU A;  2QMI A;  2NND A;  1I05 A;  3B2K A;  3BLG A;  4M6S A;  1G5W A;  4XMD A;  3F6Z B;  2FT9 A;  4Y0R A;  4YCH A;  4WHI A;  3P6G A;  1XKI A;  2X8F A;  5HZ6 A;  3O2Y A;  2ASN X;  2R74 A;  3WVM A;  3FIQ A;  1AEL A;  4KCA A;  3ELX A;  4MIR A;  3P6H A;  1JBH A;  1L6M A;  3B2L A;  2OVD A;  5HA1 A;  2W2B A;  3KQ0 A;  3EMM A;  1OBQ A;  5IO7 A;  3PEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...