1ID0A

Crystal structure of the nucleotide bond conformation of phoq kinase domain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
146
structure length
146
Chain Sequence
RELHPVAPLLDNLTSALNKVYQRKGVNISLDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDEHLYIVVEDDGPGIPLSKREVIFDRGQRVDTLRPGQGVGLAVAREITEQYEGKIVAGESMLGGARMEVIFGRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mutational analysis of the PhoQ histidine kinase catalytic domain. Insight into the reaction mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords PHOQ HISTIDINE KINASE
total genus 45
structure length 146
sequence length 146
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2001-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1id0A00
2YE7A 1UYMA 3R92A 3Q5JA 4L90A 1MX0A 4KQVA 4PRVA 4XKAA 3KE6A 4CWOA 4PU9A 1JM6A 2XDUA 4WUCA 4O0BA 3FV5A 3WQ9A 4YKZA 1YT0A 3K99A 2YEAA 1YC3A 1BKNA 1BYQA 4MB9A 1B3QA 1EA6A 2WI1A 1US7A 2YE4A 2YGFA 2BU7A 2Q8HA 3MNRP 4FCPA 2UWDA 4XIQA 1TH8A 4WUBA 4O05A 1UYKA 2EXLA 1QYEA 4BIZA 4EGHA 5FNFA 1GJVA 2HCHA 3A0WA 4ASFA 1ZXMA 4R1FA 1GKZA 1Y4SA 2FWZA 1YETA 3U67A 2XHRA 3EHHA 4HXWA 3CRKA 3D36A 3DGEA 4P7AA 4WUDA 1UY8A 2YEDA 4CWSA 3ZXQA 3WHAA 3B28A 3EHJA 4GFNA 3ZM7A 1TBWA 3B26A 2WEQA 2FYPA 4H81A 4E01A 2YJWA 4URLA 2IOQA 5CTUA 4XD8A 1UY6A 2ZKJA 1NHIA 3GIGB 5M4PA 4ASBA 1YSZA 4GQTA 2CCTA 2YEEA 1YT2A 4H7QA 2XJXA 2YGAA 3H80A 1TIDA 4CE1A 3PEJA 2IOPA 2GFDA 2WI6A 5M4KA 3C11A 3SL2A 1AMWA 4PRXA 3INXA 4AWQA 2CH4A 4HY6A 4LWFA 3U2KA 4NH9A 1U2OA 4YKYA 3O2FA 2YEJA 5J6AA 2BYHA 2YI7A 1ZXNA 2YE3A 3D2RA 1Z5AA 4CWRA 4K4OA 4V26A 1GKXA 5IDMA 3CRLA 1UYIA 4ASGA 4FPPA 2YE9A 1Y8NA 3K60A 2YE6A 3RKZA 4V25A 2XX2A 2YI5A 5D7DA 4FMTA 3T0HA 1YSRA 3T2SA 2VW5A 2WERA 4PL9A 5J71A 2O1VA 3T10A 1S16A 2BU6A 2YGEA 3EKOA 4YKTA 5FNCA 1H7SA 1THNA 3TZ5A 1L0OA 4I5SA 2YKEA 4KSGA 2BU8A 1Y8PA 3U2DA 2BRCA 2YEHA 1I59A 2XD6A 4MOTA 3A0ZA 4L94A 3A0TA 4AS9A 2AKPA 2CGFA 4U7OA 3OWBA 4LWEA 2YE8A 4LWGA 1A4HA 3RLPA 3RLQA 4ZVIA 1MU5A 1TC0A 4EFUA 2XX5A 3OPDA 1ZW9A 4MP7A 3D0BA 3R4NA 1TILA 3K97A 2YE5A 1YT1A 4EEHA 4O07A 4U93A 3A0XA 4XC0A 2BYIA 2WI3A 4KTNA 3HHUA 3QDDA 1B63A 2XDXA 3BMYA 2XJJA 5BODA 2YEGA 2Q8FA 4H85A 1ZWHA 4FCRA 5D6PA 3JZ3A 4GEEA 1UYEA 1BGQA 5CPHA 4ASAA 5M4MA 2K5BA 4MBCA 2BTZA 2O1UA 2ZDXA 4BQGA 2XDKA 4EFTA 2XDSA 4JQLA 2QF6A 4HY1A 4LWHA 3EHFA 2C2AA 3O6OA 2JKIA 5M4HA 4CWPA 2YEIA 4YKXA 3FT5A 4BXIA 2FXSA 3GIGA 3IEDA 3RLRA 3Q5LA 4CWFA 4URMA 3OW6A 2WI7A 2WEPA 4GCZA 4U7NA 4XCLA 4FCQA 4NH7A 4MPNA 1YS3A 5CTWA 1AJ6A 3FT8A 4E00A 4CE2A 4Q20A 4XIRA 3CWVA 2YI0A 4ZKIA 1B62A 2BSMA 2YJXA 1UYLA 1OSFA 5D6QA 4CE3A 1AH6A 3G75A 1UYHA 3VHDA 1I5CA 3EHGA 1PVGA 3Q5KA 2WI5A 1NHJA 3LNUA 4R3AA 1AH8A 1I5AA 3OWDA 4JAUA 2XX4A 4EGKA 2HKJA 3TUHA 4HYPA 1S14A 4EMVA 3PEHA 4P8OA 4GGLA 1I5BA 1UYDA 4R3MA 5IDJA 5D7CA 3TTZA 3NMQA 1EI1A 4MPCA 5GGZA 1UYFA 4CWTA 1R62A 3R4PA 4URNA 3B24A 3INWA 4HZ5A 2XHXA 3A0RA 3BM9A 5FWKA 1KZNA 2YKBA 4I3HA 2IWUA 2YKCA 2HG1A 2Q8GA 4X9LA 2GQPA 4XKKA 4MP2A 3G7EA 4KP4A 2VCJA 2VCIA 4O04A 3B25A 4B7PA 2WI4A 2YI6A 2XDLA 4YKRA 3ZXOA 2XABA 5F5RA 4LWIA 2WI2A 2ESAA 2IORA 2XCMA 1UY7A 1KIJA 3T1KA 1QZRA 1QY8A 3O0IA 1AM1A 3R4MA 4L93A 5C93A 2BT0A 3CGYA 1YESA 3R4OA 4L8ZA 2XK2A 2ZDYA 1Z5BA 4XCJA 3R91A 4B6CA 2YK2A 2YECA 1UYGA 2BU2A 2CCUA 2VWCA 1NHHA 2XJGA 4YKWA 3TZ0A 4XE2A 4GT8A 5BOCA 1TC6A 3OMUA 4HZ0A 5CTXA 2YK9A 4MPEA 2BZ5A 5CF0A 2CG9A 4XTJA 1Z5CA 3T0ZA 2XHTA 4BIUA 1YC1A 4W7TA 1Z59A 4XITA 4YKUA 1YC4A 3B27A 3LPSA 2O1WA 5CTYA 5D7RA 4CWQA 5M4NA 2YEFA 4DUHA 3VHCA 2H8MA 1Y8OA 4BAEA 3VHAA 4CWNA 1I5DA 4DZYA 2QG0A 3HYYA 4QPKA 5M4EA 1UYCA 4BQJA 2Q2EB 4XDMA 3H4LA 5IN9A 3ZKBA 2JJCA 2FWYA 3C0EA 4HYMA 4XKOA 4YKQA 4EM7A 3GIFA 2E0AA 4HXZA 2ZBKB 3VADA 3HYZA 4AWPA 1UY9A 1I58A 4XIPA 3TZ2A 4LPBA 2QG2A 3GIEA 1Y4UA 4AWOA 4LP0A 4JAVA 2BU5A 3ZKDA 3HEKA 4EGIA 4KFGA 5L3JA 2PNRA 2CCSA 3HZ1A 1H7UA 3CGZA 3K98A 4O09A 3QTFA 3HZ5A 4L91A 3TZ4A 2QFOA 5F3KA 2IWSA 4QPJA 4E02A 1BXDA 2H55A 2YEBA 4KSHA 4UROA 3A0YA 2YE2A 1U0ZA 1YERA 3EKRA 2Q8IA 2BREA 1ID0A 4NH8A 2YKJA 3G7BA 5FNDA 2IWXA 4JASA 2YKIA
chains in the Genus database with same CATH superfamily
2YE7A 1UYMA 3R92A 3Q5JA 4L90A 1MX0A 4KQVA 4PRVA 4XKAA 3KE6A 4CWOA 4PU9A 1JM6A 2XDUA 4WUCA 4O0BA 3FV5A 3WQ9A 4YKZA 1YT0A 3K99A 2YEAA 1YC3A 1BKNA 1BYQA 1IXMA 4MB9A 1B3QA 1EA6A 3LMMA 2WI1A 1US7A 2YE4A 2YGFA 2BU7A 2Q8HA 3MNRP 4FCPA 2UWDA 4XIQA 1TH8A 4WUBA 4O05A 1UYKA 2EXLA 1QYEA 4BIZA 2C1IA 4EGHA 5FNFA 1GJVA 2HCHA 3A0WA 4ASFA 1ZXMA 4R1FA 1GKZA 1Y4SA 2FWZA 1YETA 3U67A 2XHRA 3EHHA 4HXWA 3CRKA 3D36A 2HHIA 3DGEA 4P7AA 4WUDA 1UY8A 2YEDA 4CWSA 3ZXQA 3WHAA 3B28A 3EHJA 4GFNA 2FTKA 3ZM7A 1TBWA 3B26A 2WEQA 2FYPA 4H81A 4E01A 2YJWA 4URLA 2IOQA 5CTUA 4XD8A 1UY6A 2ZKJA 1NHIA 3GIGB 5M4PA 4ASBA 1YSZA 4GQTA 2CCTA 2YEEA 1YT2A 4H7QA 2XJXA 2YGAA 3H80A 1TIDA 4CE1A 3PEJA 2IOPA 2GFDA 2WI6A 5M4KA 3C11A 3SL2A 1AMWA 4PRXA 3INXA 4AWQA 2CH4A 4HY6A 4LWFA 3U2KA 4NH9A 1U2OA 4YKYA 3O2FA 2YEJA 5J6AA 2BYHA 2YI7A 1ZXNA 2YE3A 3D2RA 1Z5AA 4CWRA 4K4OA 4V26A 1GKXA 5IDMA 3CRLA 1UYIA 4ASGA 4FPPA 2YE9A 1Y8NA 3K60A 3CYGA 2YE6A 3RKZA 4V25A 2XX2A 2YI5A 5D7DA 4FMTA 3T0HA 1YSRA 3T2SA 2VW5A 2WERA 4PL9A 5J71A 2O1VA 3T10A 1S16A 2BU6A 2YGEA 3EKOA 4YKTA 5FNCA 1H7SA 1THNA 3TZ5A 1L0OA 4I5SA 2YKEA 4KSGA 2BU8A 1Y8PA 3U2DA 2BRCA 2YEHA 1I59A 2XD6A 4MOTA 3A0ZA 4L94A 3A0TA 4AS9A 2AKPA 2CGFA 4U7OA 1F51A 3OWBA 4LWEA 2YE8A 4LWGA 1A4HA 3RLPA 3RLQA 4ZVIA 1MU5A 1TC0A 4EFUA 2XX5A 3OPDA 1ZW9A 4MP7A 3D0BA 3R4NA 1TILA 3K97A 2YE5A 1YT1A 4EEHA 4O07A 4U93A 3A0XA 4XC0A 2BYIA 2WI3A 4KTNA 3HHUA 3QDDA 1B63A 2XDXA 3BMYA 2XJJA 5BODA 2YEGA 2Q8FA 4H85A 1ZWHA 4FCRA 5D6PA 3JZ3A 4GEEA 1UYEA 1BGQA 5CPHA 4ASAA 5M4MA 2K5BA 4MBCA 2BTZA 2O1UA 2ZDXA 4BQGA 2XDKA 4EFTA 2XDSA 4JQLA 2QF6A 4HY1A 4LWHA 3EHFA 2C2AA 3O6OA 2JKIA 5M4HA 4CWPA 2YEIA 4YKXA 3FT5A 4BXIA 2FXSA 3GIGA 3IEDA 3RLRA 3Q5LA 4CWFA 4URMA 3OW6A 2WI7A 2WEPA 4GCZA 4U7NA 4XCLA 4FCQA 4NH7A 4MPNA 1YS3A 5CTWA 1AJ6A 3FT8A 4E00A 4CE2A 4Q20A 4XIRA 3CWVA 2YI0A 4ZKIA 1B62A 4E72A 2BSMA 2YJXA 1UYLA 1OSFA 5D6QA 4CE3A 1AH6A 3G75A 1UYHA 3VHDA 1I5CA 3EHGA 1PVGA 3Q5KA 2WI5A 1NHJA 3LNUA 4R3AA 1AH8A 1I5AA 3OWDA 4JAUA 2XX4A 4EGKA 2HKJA 3TUHA 4HYPA 1S14A 4EMVA 3PEHA 4P8OA 4GGLA 1I5BA 1UYDA 4R3MA 5IDJA 5D7CA 3TTZA 3NMQA 1EI1A 4MPCA 5GGZA 1UYFA 2C1GA 4CWTA 1R62A 3R4PA 4URNA 4HZ5A 3B24A 3INWA 2XHXA 3A0RA 3BM9A 5FWKA 1KZNA 2YKBA 4I3HA 2IWUA 2YKCA 2HG1A 2Q8GA 4X9LA 2GQPA 4XKKA 4MP2A 3G7EA 4KP4A 2VCJA 2VCIA 4O04A 3B25A 3S5TA 4B7PA 2WI4A 2YI6A 2XDLA 4YKRA 3ZXOA 2XABA 5F5RA 2WI2A 4LWIA 2ESAA 2IORA 2XCMA 1UY7A 1KIJA 3T1KA 1QZRA 1QY8A 3O0IA 1AM1A 3R4MA 4L93A 5C93A 2BT0A 3CGYA 1YESA 3R4OA 4L8ZA 2XK2A 2ZDYA 1Z5BA 4XCJA 3R91A 4B6CA 2YK2A 2YECA 1UYGA 2BU2A 2CCUA 2VWCA 1NHHA 2XJGA 4YKWA 3TZ0A 4XE2A 4GT8A 5BOCA 1TC6A 3OMUA 4HZ0A 5CTXA 2YK9A 4MPEA 2BZ5A 5CF0A 2CG9A 4XTJA 1Z5CA 3T0ZA 2XHTA 5JENA 4BIUA 1YC1A 4W7TA 1Z59A 4XITA 4YKUA 1YC4A 3B27A 3LPSA 2O1WA 5CTYA 5D7RA 4CWQA 5M4NA 2YEFA 4DUHA 3VHCA 2H8MA 1Y8OA 4BAEA 3VHAA 4CWNA 1I5DA 4DZYA 2QG0A 3HYYA 4QPKA 5M4EA 1UYCA 4BQJA 2Q2EB 4XDMA 3H4LA 5IN9A 3ZKBA 2JJCA 2FWYA 3C0EA 4HYMA 4XKOA 4YKQA 4EM7A 3GIFA 2E0AA 4HXZA 2ZBKB 3VADA 3HYZA 4AWPA 1UY9A 1I58A 4XIPA 3TZ2A 4LPBA 2QG2A 3GIEA 1Y4UA 4AWOA 4LP0A 4JAVA 2BU5A 3ZKDA 3HEKA 4EGIA 4KFGA 5L3JA 2PNRA 2CCSA 3HZ1A 1H7UA 3CGZA 3K98A 4O09A 3QTFA 3HZ5A 4L91A 3TZ4A 2QFOA 5F3KA 2IWSA 4QPJA 4E02A 1BXDA 2H55A 2YEBA 4KSHA 4UROA 3A0YA 2YE2A 1U0ZA 1YERA 3EKRA 2Q8IA 2BREA 1ID0A 4NH8A 2YKJA 3G7BA 5FNDA 2IWXA 4JASA 2YKIA
chains in the Genus database with same CATH topology
2YE7A 1UYMA 3R92A 3Q5JA 4L90A 1MX0A 4KQVA 4PRVA 4XKAA 3KE6A 4CWOA 4PU9A 1JM6A 2XDUA 4WUCA 4O0BA 3FV5A 3WQ9A 4YKZA 1YT0A 3K99A 2YEAA 1YC3A 1BKNA 1BYQA 4MB9A 1B3QA 1EA6A 2WI1A 1US7A 2YE4A 2YGFA 2BU7A 2Q8HA 3MNRP 4FCPA 2UWDA 4XIQA 1TH8A 4WUBA 4O05A 1UYKA 2EXLA 1QYEA 4BIZA 4EGHA 5FNFA 1GJVA 2HCHA 3A0WA 4ASFA 1ZXMA 4R1FA 1GKZA 1Y4SA 2FWZA 1YETA 3U67A 2XHRA 3EHHA 4HXWA 3CRKA 3D36A 3DGEA 4P7AA 4WUDA 1UY8A 2YEDA 4CWSA 3ZXQA 3WHAA 3B28A 3EHJA 4GFNA 3ZM7A 1TBWA 3B26A 2WEQA 2FYPA 4H81A 4E01A 2YJWA 4URLA 2IOQA 5CTUA 4XD8A 1UY6A 2ZKJA 1NHIA 3GIGB 5M4PA 4ASBA 1YSZA 4GQTA 2CCTA 2YEEA 1YT2A 4H7QA 2XJXA 2YGAA 3H80A 1TIDA 4CE1A 3PEJA 2IOPA 2GFDA 2WI6A 5M4KA 3C11A 3SL2A 1AMWA 4PRXA 3INXA 4AWQA 2CH4A 4HY6A 4LWFA 3U2KA 4NH9A 1U2OA 4YKYA 3O2FA 2YEJA 5J6AA 2BYHA 2YI7A 1ZXNA 2YE3A 3D2RA 1Z5AA 4CWRA 4K4OA 4V26A 1GKXA 5IDMA 3CRLA 1UYIA 4ASGA 4FPPA 2YE9A 1Y8NA 3K60A 2YE6A 3RKZA 4V25A 2XX2A 2YI5A 5D7DA 4FMTA 3T0HA 1YSRA 3T2SA 2VW5A 2WERA 4PL9A 5J71A 2O1VA 3T10A 1S16A 2BU6A 2YGEA 3EKOA 4YKTA 5FNCA 1H7SA 1THNA 3TZ5A 1L0OA 4I5SA 2YKEA 4KSGA 2BU8A 1Y8PA 3U2DA 2BRCA 2YEHA 1I59A 2XD6A 4MOTA 3A0ZA 4L94A 3A0TA 4AS9A 2AKPA 2CGFA 4U7OA 3OWBA 4LWEA 2YE8A 4LWGA 1A4HA 3RLPA 3RLQA 4ZVIA 1MU5A 1TC0A 4EFUA 2XX5A 3OPDA 1ZW9A 4MP7A 3D0BA 3R4NA 1TILA 3K97A 2YE5A 1YT1A 4EEHA 4O07A 4U93A 3A0XA 4XC0A 2BYIA 2WI3A 4KTNA 3HHUA 3QDDA 1B63A 2XDXA 3BMYA 2XJJA 5BODA 2YEGA 2Q8FA 4H85A 1ZWHA 4FCRA 5D6PA 3JZ3A 4GEEA 1UYEA 1BGQA 5CPHA 4ASAA 5M4MA 2K5BA 4MBCA 2BTZA 2O1UA 2ZDXA 4BQGA 2XDKA 4EFTA 2XDSA 4JQLA 2QF6A 4HY1A 4LWHA 3EHFA 2C2AA 3O6OA 2JKIA 5M4HA 4CWPA 2YEIA 4YKXA 3FT5A 4BXIA 2FXSA 3GIGA 3IEDA 3RLRA 3Q5LA 4CWFA 4URMA 3OW6A 2WI7A 2WEPA 4GCZA 4U7NA 4XCLA 4FCQA 4NH7A 4MPNA 1YS3A 5CTWA 1AJ6A 3FT8A 4E00A 4CE2A 4Q20A 4XIRA 3CWVA 2YI0A 4ZKIA 1B62A 2BSMA 2YJXA 1UYLA 1OSFA 5D6QA 4CE3A 1AH6A 3G75A 1UYHA 3VHDA 1I5CA 3EHGA 1PVGA 3Q5KA 2WI5A 1NHJA 3LNUA 4R3AA 1AH8A 1I5AA 3OWDA 4JAUA 2XX4A 4EGKA 2HKJA 3TUHA 4HYPA 1S14A 4EMVA 3PEHA 4P8OA 4GGLA 1I5BA 1UYDA 4R3MA 5IDJA 5D7CA 3TTZA 3NMQA 1EI1A 4MPCA 5GGZA 1UYFA 4CWTA 1R62A 3R4PA 4URNA 3B24A 3INWA 4HZ5A 2XHXA 3A0RA 3BM9A 5FWKA 1KZNA 2YKBA 4I3HA 2IWUA 2YKCA 2HG1A 2Q8GA 4X9LA 2GQPA 4XKKA 4MP2A 3G7EA 4KP4A 2VCJA 2VCIA 4O04A 3B25A 4B7PA 2WI4A 2YI6A 2XDLA 4YKRA 3ZXOA 2XABA 5F5RA 4LWIA 2WI2A 2ESAA 2IORA 2XCMA 1UY7A 1KIJA 3T1KA 1QZRA 1QY8A 3O0IA 1AM1A 3R4MA 4L93A 5C93A 2BT0A 3CGYA 1YESA 3R4OA 4L8ZA 2XK2A 2ZDYA 1Z5BA 4XCJA 3R91A 4B6CA 2YK2A 2YECA 1UYGA 2BU2A 2CCUA 2VWCA 1NHHA 2XJGA 4YKWA 3TZ0A 4XE2A 4GT8A 5BOCA 1TC6A 3OMUA 4HZ0A 5CTXA 2YK9A 4MPEA 2BZ5A 5CF0A 2CG9A 4XTJA 1Z5CA 3T0ZA 2XHTA 4BIUA 1YC1A 4W7TA 1Z59A 4XITA 4YKUA 1YC4A 3B27A 3LPSA 2O1WA 5CTYA 5D7RA 4CWQA 5M4NA 2YEFA 4DUHA 3VHCA 2H8MA 1Y8OA 4BAEA 3VHAA 4CWNA 1I5DA 4DZYA 2QG0A 3HYYA 4QPKA 5M4EA 1UYCA 4BQJA 2Q2EB 4XDMA 3H4LA 5IN9A 3ZKBA 2JJCA 2FWYA 3C0EA 4HYMA 4XKOA 4YKQA 4EM7A 3GIFA 2E0AA 4HXZA 2ZBKB 3VADA 3HYZA 4AWPA 1UY9A 1I58A 4XIPA 3TZ2A 4LPBA 2QG2A 3GIEA 1Y4UA 4AWOA 4LP0A 4JAVA 2BU5A 3ZKDA 3HEKA 4EGIA 4KFGA 5L3JA 2PNRA 2CCSA 3HZ1A 1H7UA 3CGZA 3K98A 4O09A 3QTFA 3HZ5A 4L91A 3TZ4A 2QFOA 5F3KA 2IWSA 4QPJA 4E02A 1BXDA 2H55A 2YEBA 4KSHA 4UROA 3A0YA 2YE2A 1U0ZA 1YERA 3EKRA 2Q8IA 2BREA 1ID0A 4NH8A 2YKJA 3G7BA 5FNDA 2IWXA 4JASA 2YKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YE7 A;  1UYM A;  3R92 A;  3Q5J A;  4L90 A;  1MX0 A;  4KQV A;  4PRV A;  4XKA A;  3KE6 A;  4CWO A;  4PU9 A;  1JM6 A;  2XDU A;  4WUC A;  4O0B A;  3FV5 A;  3WQ9 A;  4YKZ A;  1YT0 A;  3K99 A;  2YEA A;  1YC3 A;  1BKN A;  1BYQ A;  4MB9 A;  1B3Q A;  1EA6 A;  2WI1 A;  1US7 A;  2YE4 A;  2YGF A;  2BU7 A;  2Q8H A;  3MNR P;  4FCP A;  2UWD A;  4XIQ A;  1TH8 A;  4WUB A;  4O05 A;  1UYK A;  2EXL A;  1QYE A;  4BIZ A;  4EGH A;  5FNF A;  1GJV A;  2HCH A;  3A0W A;  4ASF A;  1ZXM A;  4R1F A;  1GKZ A;  1Y4S A;  2FWZ A;  1YET A;  3U67 A;  2XHR A;  3EHH A;  4HXW A;  3CRK A;  3D36 A;  3DGE A;  4P7A A;  4WUD A;  1UY8 A;  2YED A;  4CWS A;  3ZXQ A;  3WHA A;  3B28 A;  3EHJ A;  4GFN A;  3ZM7 A;  1TBW A;  3B26 A;  2WEQ A;  2FYP A;  4H81 A;  4E01 A;  2YJW A;  4URL A;  2IOQ A;  5CTU A;  4XD8 A;  1UY6 A;  2ZKJ A;  1NHI A;  3GIG B;  5M4P A;  4ASB A;  1YSZ A;  4GQT A;  2CCT A;  2YEE A;  1YT2 A;  4H7Q A;  2XJX A;  2YGA A;  3H80 A;  1TID A;  4CE1 A;  3PEJ A;  2IOP A;  2GFD A;  2WI6 A;  5M4K A;  3C11 A;  3SL2 A;  1AMW A;  4PRX A;  3INX A;  4AWQ A;  2CH4 A;  4HY6 A;  4LWF A;  3U2K A;  4NH9 A;  1U2O A;  4YKY A;  3O2F A;  2YEJ A;  5J6A A;  2BYH A;  2YI7 A;  1ZXN A;  2YE3 A;  3D2R A;  1Z5A A;  4CWR A;  4K4O A;  4V26 A;  1GKX A;  5IDM A;  3CRL A;  1UYI A;  4ASG A;  4FPP A;  2YE9 A;  1Y8N A;  3K60 A;  2YE6 A;  3RKZ A;  4V25 A;  2XX2 A;  2YI5 A;  5D7D A;  4FMT A;  3T0H A;  1YSR A;  3T2S A;  2VW5 A;  2WER A;  4PL9 A;  5J71 A;  2O1V A;  3T10 A;  1S16 A;  2BU6 A;  2YGE A;  3EKO A;  4YKT A;  5FNC A;  1H7S A;  1THN A;  3TZ5 A;  1L0O A;  4I5S A;  2YKE A;  4KSG A;  2BU8 A;  1Y8P A;  3U2D A;  2BRC A;  2YEH A;  1I59 A;  2XD6 A;  4MOT A;  3A0Z A;  4L94 A;  3A0T A;  4AS9 A;  2AKP A;  2CGF A;  4U7O A;  3OWB A;  4LWE A;  2YE8 A;  4LWG A;  1A4H A;  3RLP A;  3RLQ A;  4ZVI A;  1MU5 A;  1TC0 A;  4EFU A;  2XX5 A;  3OPD A;  1ZW9 A;  4MP7 A;  3D0B A;  3R4N A;  1TIL A;  3K97 A;  2YE5 A;  1YT1 A;  4EEH A;  4O07 A;  4U93 A;  3A0X A;  4XC0 A;  2BYI A;  2WI3 A;  4KTN A;  3HHU A;  3QDD A;  1B63 A;  2XDX A;  3BMY A;  2XJJ A;  5BOD A;  2YEG A;  2Q8F A;  4H85 A;  1ZWH A;  4FCR A;  5D6P A;  3JZ3 A;  4GEE A;  1UYE A;  1BGQ A;  5CPH A;  4ASA A;  5M4M A;  2K5B A;  4MBC A;  2BTZ A;  2O1U A;  2ZDX A;  4BQG A;  2XDK A;  4EFT A;  2XDS A;  4JQL A;  2QF6 A;  4HY1 A;  4LWH A;  3EHF A;  2C2A A;  3O6O A;  2JKI A;  5M4H A;  4CWP A;  2YEI A;  4YKX A;  3FT5 A;  4BXI A;  2FXS A;  3GIG A;  3IED A;  3RLR A;  3Q5L A;  4CWF A;  4URM A;  3OW6 A;  2WI7 A;  2WEP A;  4GCZ A;  4U7N A;  4XCL A;  4FCQ A;  4NH7 A;  4MPN A;  1YS3 A;  5CTW A;  1AJ6 A;  3FT8 A;  4E00 A;  4CE2 A;  4Q20 A;  4XIR A;  3CWV A;  2YI0 A;  4ZKI A;  1B62 A;  2BSM A;  2YJX A;  1UYL A;  1OSF A;  5D6Q A;  4CE3 A;  1AH6 A;  3G75 A;  1UYH A;  3VHD A;  1I5C A;  3EHG A;  1PVG A;  3Q5K A;  2WI5 A;  1NHJ A;  3LNU A;  4R3A A;  1AH8 A;  1I5A A;  3OWD A;  4JAU A;  2XX4 A;  4EGK A;  2HKJ A;  3TUH A;  4HYP A;  1S14 A;  4EMV A;  3PEH A;  4P8O A;  4GGL A;  1I5B A;  1UYD A;  4R3M A;  5IDJ A;  5D7C A;  3TTZ A;  3NMQ A;  1EI1 A;  4MPC A;  5GGZ A;  1UYF A;  4CWT A;  1R62 A;  3R4P A;  4URN A;  3B24 A;  3INW A;  4HZ5 A;  2XHX A;  3A0R A;  3BM9 A;  5FWK A;  1KZN A;  2YKB A;  4I3H A;  2IWU A;  2YKC A;  2HG1 A;  2Q8G A;  4X9L A;  2GQP A;  4XKK A;  4MP2 A;  3G7E A;  4KP4 A;  2VCJ A;  2VCI A;  4O04 A;  3B25 A;  4B7P A;  2WI4 A;  2YI6 A;  2XDL A;  4YKR A;  3ZXO A;  2XAB A;  5F5R A;  4LWI A;  2WI2 A;  2ESA A;  2IOR A;  2XCM A;  1UY7 A;  1KIJ A;  3T1K A;  1QZR A;  1QY8 A;  3O0I A;  1AM1 A;  3R4M A;  4L93 A;  5C93 A;  2BT0 A;  3CGY A;  1YES A;  3R4O A;  4L8Z A;  2XK2 A;  2ZDY A;  1Z5B A;  4XCJ A;  3R91 A;  4B6C A;  2YK2 A;  2YEC A;  1UYG A;  2BU2 A;  2CCU A;  2VWC A;  1NHH A;  2XJG A;  4YKW A;  3TZ0 A;  4XE2 A;  4GT8 A;  5BOC A;  1TC6 A;  3OMU A;  4HZ0 A;  5CTX A;  2YK9 A;  4MPE A;  2BZ5 A;  5CF0 A;  2CG9 A;  4XTJ A;  1Z5C A;  3T0Z A;  2XHT A;  4BIU A;  1YC1 A;  4W7T A;  1Z59 A;  4XIT A;  4YKU A;  1YC4 A;  3B27 A;  3LPS A;  2O1W A;  5CTY A;  5D7R A;  4CWQ A;  5M4N A;  2YEF A;  4DUH A;  3VHC A;  2H8M A;  1Y8O A;  4BAE A;  3VHA A;  4CWN A;  1I5D A;  4DZY A;  2QG0 A;  3HYY A;  4QPK A;  5M4E A;  1UYC A;  4BQJ A;  2Q2E B;  4XDM A;  3H4L A;  5IN9 A;  3ZKB A;  2JJC A;  2FWY A;  3C0E A;  4HYM A;  4XKO A;  4YKQ A;  4EM7 A;  3GIF A;  2E0A A;  4HXZ A;  2ZBK B;  3VAD A;  3HYZ A;  4AWP A;  1UY9 A;  1I58 A;  4XIP A;  3TZ2 A;  4LPB A;  2QG2 A;  3GIE A;  1Y4U A;  4AWO A;  4LP0 A;  4JAV A;  2BU5 A;  3ZKD A;  3HEK A;  4EGI A;  4KFG A;  5L3J A;  2PNR A;  2CCS A;  3HZ1 A;  1H7U A;  3CGZ A;  3K98 A;  4O09 A;  3QTF A;  3HZ5 A;  4L91 A;  3TZ4 A;  2QFO A;  5F3K A;  2IWS A;  4QPJ A;  4E02 A;  1BXD A;  2H55 A;  2YEB A;  4KSH A;  4URO A;  3A0Y A;  2YE2 A;  1U0Z A;  1YER A;  3EKR A;  2Q8I A;  2BRE A;  1ID0 A;  4NH8 A;  2YKJ A;  3G7B A;  5FND A;  2IWX A;  4JAS A;  2YKI A; 
#chains in the Genus database with same CATH topology
 2YE7 A;  1UYM A;  3R92 A;  3Q5J A;  4L90 A;  1MX0 A;  4KQV A;  4PRV A;  4XKA A;  3KE6 A;  4CWO A;  4PU9 A;  1JM6 A;  2XDU A;  4WUC A;  4O0B A;  3FV5 A;  3WQ9 A;  4YKZ A;  1YT0 A;  3K99 A;  2YEA A;  1YC3 A;  1BKN A;  1BYQ A;  1IXM A;  4MB9 A;  1B3Q A;  1EA6 A;  3LMM A;  2WI1 A;  1US7 A;  2YE4 A;  2YGF A;  2BU7 A;  2Q8H A;  3MNR P;  4FCP A;  2UWD A;  4XIQ A;  1TH8 A;  4WUB A;  4O05 A;  1UYK A;  2EXL A;  1QYE A;  4BIZ A;  2C1I A;  4EGH A;  5FNF A;  1GJV A;  2HCH A;  3A0W A;  4ASF A;  1ZXM A;  4R1F A;  1GKZ A;  1Y4S A;  2FWZ A;  1YET A;  3U67 A;  2XHR A;  3EHH A;  4HXW A;  3CRK A;  3D36 A;  2HHI A;  3DGE A;  4P7A A;  4WUD A;  1UY8 A;  2YED A;  4CWS A;  3ZXQ A;  3WHA A;  3B28 A;  3EHJ A;  4GFN A;  2FTK A;  3ZM7 A;  1TBW A;  3B26 A;  2WEQ A;  2FYP A;  4H81 A;  4E01 A;  2YJW A;  4URL A;  2IOQ A;  5CTU A;  4XD8 A;  1UY6 A;  2ZKJ A;  1NHI A;  3GIG B;  5M4P A;  4ASB A;  1YSZ A;  4GQT A;  2CCT A;  2YEE A;  1YT2 A;  4H7Q A;  2XJX A;  2YGA A;  3H80 A;  1TID A;  4CE1 A;  3PEJ A;  2IOP A;  2GFD A;  2WI6 A;  5M4K A;  3C11 A;  3SL2 A;  1AMW A;  4PRX A;  3INX A;  4AWQ A;  2CH4 A;  4HY6 A;  4LWF A;  3U2K A;  4NH9 A;  1U2O A;  4YKY A;  3O2F A;  2YEJ A;  5J6A A;  2BYH A;  2YI7 A;  1ZXN A;  2YE3 A;  3D2R A;  1Z5A A;  4CWR A;  4K4O A;  4V26 A;  1GKX A;  5IDM A;  3CRL A;  1UYI A;  4ASG A;  4FPP A;  2YE9 A;  1Y8N A;  3K60 A;  3CYG A;  2YE6 A;  3RKZ A;  4V25 A;  2XX2 A;  2YI5 A;  5D7D A;  4FMT A;  3T0H A;  1YSR A;  3T2S A;  2VW5 A;  2WER A;  4PL9 A;  5J71 A;  2O1V A;  3T10 A;  1S16 A;  2BU6 A;  2YGE A;  3EKO A;  4YKT A;  5FNC A;  1H7S A;  1THN A;  3TZ5 A;  1L0O A;  4I5S A;  2YKE A;  4KSG A;  2BU8 A;  1Y8P A;  3U2D A;  2BRC A;  2YEH A;  1I59 A;  2XD6 A;  4MOT A;  3A0Z A;  4L94 A;  3A0T A;  4AS9 A;  2AKP A;  2CGF A;  4U7O A;  1F51 A;  3OWB A;  4LWE A;  2YE8 A;  4LWG A;  1A4H A;  3RLP A;  3RLQ A;  4ZVI A;  1MU5 A;  1TC0 A;  4EFU A;  2XX5 A;  3OPD A;  1ZW9 A;  4MP7 A;  3D0B A;  3R4N A;  1TIL A;  3K97 A;  2YE5 A;  1YT1 A;  4EEH A;  4O07 A;  4U93 A;  3A0X A;  4XC0 A;  2BYI A;  2WI3 A;  4KTN A;  3HHU A;  3QDD A;  1B63 A;  2XDX A;  3BMY A;  2XJJ A;  5BOD A;  2YEG A;  2Q8F A;  4H85 A;  1ZWH A;  4FCR A;  5D6P A;  3JZ3 A;  4GEE A;  1UYE A;  1BGQ A;  5CPH A;  4ASA A;  5M4M A;  2K5B A;  4MBC A;  2BTZ A;  2O1U A;  2ZDX A;  4BQG A;  2XDK A;  4EFT A;  2XDS A;  4JQL A;  2QF6 A;  4HY1 A;  4LWH A;  3EHF A;  2C2A A;  3O6O A;  2JKI A;  5M4H A;  4CWP A;  2YEI A;  4YKX A;  3FT5 A;  4BXI A;  2FXS A;  3GIG A;  3IED A;  3RLR A;  3Q5L A;  4CWF A;  4URM A;  3OW6 A;  2WI7 A;  2WEP A;  4GCZ A;  4U7N A;  4XCL A;  4FCQ A;  4NH7 A;  4MPN A;  1YS3 A;  5CTW A;  1AJ6 A;  3FT8 A;  4E00 A;  4CE2 A;  4Q20 A;  4XIR A;  3CWV A;  2YI0 A;  4ZKI A;  1B62 A;  4E72 A;  2BSM A;  2YJX A;  1UYL A;  1OSF A;  5D6Q A;  4CE3 A;  1AH6 A;  3G75 A;  1UYH A;  3VHD A;  1I5C A;  3EHG A;  1PVG A;  3Q5K A;  2WI5 A;  1NHJ A;  3LNU A;  4R3A A;  1AH8 A;  1I5A A;  3OWD A;  4JAU A;  2XX4 A;  4EGK A;  2HKJ A;  3TUH A;  4HYP A;  1S14 A;  4EMV A;  3PEH A;  4P8O A;  4GGL A;  1I5B A;  1UYD A;  4R3M A;  5IDJ A;  5D7C A;  3TTZ A;  3NMQ A;  1EI1 A;  4MPC A;  5GGZ A;  1UYF A;  2C1G A;  4CWT A;  1R62 A;  3R4P A;  4URN A;  4HZ5 A;  3B24 A;  3INW A;  2XHX A;  3A0R A;  3BM9 A;  5FWK A;  1KZN A;  2YKB A;  4I3H A;  2IWU A;  2YKC A;  2HG1 A;  2Q8G A;  4X9L A;  2GQP A;  4XKK A;  4MP2 A;  3G7E A;  4KP4 A;  2VCJ A;  2VCI A;  4O04 A;  3B25 A;  3S5T A;  4B7P A;  2WI4 A;  2YI6 A;  2XDL A;  4YKR A;  3ZXO A;  2XAB A;  5F5R A;  2WI2 A;  4LWI A;  2ESA A;  2IOR A;  2XCM A;  1UY7 A;  1KIJ A;  3T1K A;  1QZR A;  1QY8 A;  3O0I A;  1AM1 A;  3R4M A;  4L93 A;  5C93 A;  2BT0 A;  3CGY A;  1YES A;  3R4O A;  4L8Z A;  2XK2 A;  2ZDY A;  1Z5B A;  4XCJ A;  3R91 A;  4B6C A;  2YK2 A;  2YEC A;  1UYG A;  2BU2 A;  2CCU A;  2VWC A;  1NHH A;  2XJG A;  4YKW A;  3TZ0 A;  4XE2 A;  4GT8 A;  5BOC A;  1TC6 A;  3OMU A;  4HZ0 A;  5CTX A;  2YK9 A;  4MPE A;  2BZ5 A;  5CF0 A;  2CG9 A;  4XTJ A;  1Z5C A;  3T0Z A;  2XHT A;  5JEN A;  4BIU A;  1YC1 A;  4W7T A;  1Z59 A;  4XIT A;  4YKU A;  1YC4 A;  3B27 A;  3LPS A;  2O1W A;  5CTY A;  5D7R A;  4CWQ A;  5M4N A;  2YEF A;  4DUH A;  3VHC A;  2H8M A;  1Y8O A;  4BAE A;  3VHA A;  4CWN A;  1I5D A;  4DZY A;  2QG0 A;  3HYY A;  4QPK A;  5M4E A;  1UYC A;  4BQJ A;  2Q2E B;  4XDM A;  3H4L A;  5IN9 A;  3ZKB A;  2JJC A;  2FWY A;  3C0E A;  4HYM A;  4XKO A;  4YKQ A;  4EM7 A;  3GIF A;  2E0A A;  4HXZ A;  2ZBK B;  3VAD A;  3HYZ A;  4AWP A;  1UY9 A;  1I58 A;  4XIP A;  3TZ2 A;  4LPB A;  2QG2 A;  3GIE A;  1Y4U A;  4AWO A;  4LP0 A;  4JAV A;  2BU5 A;  3ZKD A;  3HEK A;  4EGI A;  4KFG A;  5L3J A;  2PNR A;  2CCS A;  3HZ1 A;  1H7U A;  3CGZ A;  3K98 A;  4O09 A;  3QTF A;  3HZ5 A;  4L91 A;  3TZ4 A;  2QFO A;  5F3K A;  2IWS A;  4QPJ A;  4E02 A;  1BXD A;  2H55 A;  2YEB A;  4KSH A;  4URO A;  3A0Y A;  2YE2 A;  1U0Z A;  1YER A;  3EKR A;  2Q8I A;  2BRE A;  1ID0 A;  4NH8 A;  2YKJ A;  3G7B A;  5FND A;  2IWX A;  4JAS A;  2YKI A; 
#chains in the Genus database with same CATH homology
 2YE7 A;  1UYM A;  3R92 A;  3Q5J A;  4L90 A;  1MX0 A;  4KQV A;  4PRV A;  4XKA A;  3KE6 A;  4CWO A;  4PU9 A;  1JM6 A;  2XDU A;  4WUC A;  4O0B A;  3FV5 A;  3WQ9 A;  4YKZ A;  1YT0 A;  3K99 A;  2YEA A;  1YC3 A;  1BKN A;  1BYQ A;  4MB9 A;  1B3Q A;  1EA6 A;  2WI1 A;  1US7 A;  2YE4 A;  2YGF A;  2BU7 A;  2Q8H A;  3MNR P;  4FCP A;  2UWD A;  4XIQ A;  1TH8 A;  4WUB A;  4O05 A;  1UYK A;  2EXL A;  1QYE A;  4BIZ A;  4EGH A;  5FNF A;  1GJV A;  2HCH A;  3A0W A;  4ASF A;  1ZXM A;  4R1F A;  1GKZ A;  1Y4S A;  2FWZ A;  1YET A;  3U67 A;  2XHR A;  3EHH A;  4HXW A;  3CRK A;  3D36 A;  3DGE A;  4P7A A;  4WUD A;  1UY8 A;  2YED A;  4CWS A;  3ZXQ A;  3WHA A;  3B28 A;  3EHJ A;  4GFN A;  3ZM7 A;  1TBW A;  3B26 A;  2WEQ A;  2FYP A;  4H81 A;  4E01 A;  2YJW A;  4URL A;  2IOQ A;  5CTU A;  4XD8 A;  1UY6 A;  2ZKJ A;  1NHI A;  3GIG B;  5M4P A;  4ASB A;  1YSZ A;  4GQT A;  2CCT A;  2YEE A;  1YT2 A;  4H7Q A;  2XJX A;  2YGA A;  3H80 A;  1TID A;  4CE1 A;  3PEJ A;  2IOP A;  2GFD A;  2WI6 A;  5M4K A;  3C11 A;  3SL2 A;  1AMW A;  4PRX A;  3INX A;  4AWQ A;  2CH4 A;  4HY6 A;  4LWF A;  3U2K A;  4NH9 A;  1U2O A;  4YKY A;  3O2F A;  2YEJ A;  5J6A A;  2BYH A;  2YI7 A;  1ZXN A;  2YE3 A;  3D2R A;  1Z5A A;  4CWR A;  4K4O A;  4V26 A;  1GKX A;  5IDM A;  3CRL A;  1UYI A;  4ASG A;  4FPP A;  2YE9 A;  1Y8N A;  3K60 A;  2YE6 A;  3RKZ A;  4V25 A;  2XX2 A;  2YI5 A;  5D7D A;  4FMT A;  3T0H A;  1YSR A;  3T2S A;  2VW5 A;  2WER A;  4PL9 A;  5J71 A;  2O1V A;  3T10 A;  1S16 A;  2BU6 A;  2YGE A;  3EKO A;  4YKT A;  5FNC A;  1H7S A;  1THN A;  3TZ5 A;  1L0O A;  4I5S A;  2YKE A;  4KSG A;  2BU8 A;  1Y8P A;  3U2D A;  2BRC A;  2YEH A;  1I59 A;  2XD6 A;  4MOT A;  3A0Z A;  4L94 A;  3A0T A;  4AS9 A;  2AKP A;  2CGF A;  4U7O A;  3OWB A;  4LWE A;  2YE8 A;  4LWG A;  1A4H A;  3RLP A;  3RLQ A;  4ZVI A;  1MU5 A;  1TC0 A;  4EFU A;  2XX5 A;  3OPD A;  1ZW9 A;  4MP7 A;  3D0B A;  3R4N A;  1TIL A;  3K97 A;  2YE5 A;  1YT1 A;  4EEH A;  4O07 A;  4U93 A;  3A0X A;  4XC0 A;  2BYI A;  2WI3 A;  4KTN A;  3HHU A;  3QDD A;  1B63 A;  2XDX A;  3BMY A;  2XJJ A;  5BOD A;  2YEG A;  2Q8F A;  4H85 A;  1ZWH A;  4FCR A;  5D6P A;  3JZ3 A;  4GEE A;  1UYE A;  1BGQ A;  5CPH A;  4ASA A;  5M4M A;  2K5B A;  4MBC A;  2BTZ A;  2O1U A;  2ZDX A;  4BQG A;  2XDK A;  4EFT A;  2XDS A;  4JQL A;  2QF6 A;  4HY1 A;  4LWH A;  3EHF A;  2C2A A;  3O6O A;  2JKI A;  5M4H A;  4CWP A;  2YEI A;  4YKX A;  3FT5 A;  4BXI A;  2FXS A;  3GIG A;  3IED A;  3RLR A;  3Q5L A;  4CWF A;  4URM A;  3OW6 A;  2WI7 A;  2WEP A;  4GCZ A;  4U7N A;  4XCL A;  4FCQ A;  4NH7 A;  4MPN A;  1YS3 A;  5CTW A;  1AJ6 A;  3FT8 A;  4E00 A;  4CE2 A;  4Q20 A;  4XIR A;  3CWV A;  2YI0 A;  4ZKI A;  1B62 A;  2BSM A;  2YJX A;  1UYL A;  1OSF A;  5D6Q A;  4CE3 A;  1AH6 A;  3G75 A;  1UYH A;  3VHD A;  1I5C A;  3EHG A;  1PVG A;  3Q5K A;  2WI5 A;  1NHJ A;  3LNU A;  4R3A A;  1AH8 A;  1I5A A;  3OWD A;  4JAU A;  2XX4 A;  4EGK A;  2HKJ A;  3TUH A;  4HYP A;  1S14 A;  4EMV A;  3PEH A;  4P8O A;  4GGL A;  1I5B A;  1UYD A;  4R3M A;  5IDJ A;  5D7C A;  3TTZ A;  3NMQ A;  1EI1 A;  4MPC A;  5GGZ A;  1UYF A;  4CWT A;  1R62 A;  3R4P A;  4URN A;  3B24 A;  3INW A;  4HZ5 A;  2XHX A;  3A0R A;  3BM9 A;  5FWK A;  1KZN A;  2YKB A;  4I3H A;  2IWU A;  2YKC A;  2HG1 A;  2Q8G A;  4X9L A;  2GQP A;  4XKK A;  4MP2 A;  3G7E A;  4KP4 A;  2VCJ A;  2VCI A;  4O04 A;  3B25 A;  4B7P A;  2WI4 A;  2YI6 A;  2XDL A;  4YKR A;  3ZXO A;  2XAB A;  5F5R A;  4LWI A;  2WI2 A;  2ESA A;  2IOR A;  2XCM A;  1UY7 A;  1KIJ A;  3T1K A;  1QZR A;  1QY8 A;  3O0I A;  1AM1 A;  3R4M A;  4L93 A;  5C93 A;  2BT0 A;  3CGY A;  1YES A;  3R4O A;  4L8Z A;  2XK2 A;  2ZDY A;  1Z5B A;  4XCJ A;  3R91 A;  4B6C A;  2YK2 A;  2YEC A;  1UYG A;  2BU2 A;  2CCU A;  2VWC A;  1NHH A;  2XJG A;  4YKW A;  3TZ0 A;  4XE2 A;  4GT8 A;  5BOC A;  1TC6 A;  3OMU A;  4HZ0 A;  5CTX A;  2YK9 A;  4MPE A;  2BZ5 A;  5CF0 A;  2CG9 A;  4XTJ A;  1Z5C A;  3T0Z A;  2XHT A;  4BIU A;  1YC1 A;  4W7T A;  1Z59 A;  4XIT A;  4YKU A;  1YC4 A;  3B27 A;  3LPS A;  2O1W A;  5CTY A;  5D7R A;  4CWQ A;  5M4N A;  2YEF A;  4DUH A;  3VHC A;  2H8M A;  1Y8O A;  4BAE A;  3VHA A;  4CWN A;  1I5D A;  4DZY A;  2QG0 A;  3HYY A;  4QPK A;  5M4E A;  1UYC A;  4BQJ A;  2Q2E B;  4XDM A;  3H4L A;  5IN9 A;  3ZKB A;  2JJC A;  2FWY A;  3C0E A;  4HYM A;  4XKO A;  4YKQ A;  4EM7 A;  3GIF A;  2E0A A;  4HXZ A;  2ZBK B;  3VAD A;  3HYZ A;  4AWP A;  1UY9 A;  1I58 A;  4XIP A;  3TZ2 A;  4LPB A;  2QG2 A;  3GIE A;  1Y4U A;  4AWO A;  4LP0 A;  4JAV A;  2BU5 A;  3ZKD A;  3HEK A;  4EGI A;  4KFG A;  5L3J A;  2PNR A;  2CCS A;  3HZ1 A;  1H7U A;  3CGZ A;  3K98 A;  4O09 A;  3QTF A;  3HZ5 A;  4L91 A;  3TZ4 A;  2QFO A;  5F3K A;  2IWS A;  4QPJ A;  4E02 A;  1BXD A;  2H55 A;  2YEB A;  4KSH A;  4URO A;  3A0Y A;  2YE2 A;  1U0Z A;  1YER A;  3EKR A;  2Q8I A;  2BRE A;  1ID0 A;  4NH8 A;  2YKJ A;  3G7B A;  5FND A;  2IWX A;  4JAS A;  2YKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...