1ID3C

Crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
110
structure length
110
Chain Sequence
QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PALINDROMIC 146BP DNA FRAGMENT
publication title Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 110
sequence length 110
chains with identical sequence G
ec nomenclature
pdb deposition date 2001-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1id3C00
5AV8C 2HIOB 3KWQB 5AV6A 3REJD 5DNMC 4ZUXA 3AFAC 3AZJA 3AZND 1P3MC 4KUDB 1S32C 3LZ0D 3AZNB 3LZ0B 3UTBB 4HGAC 5JRGD 1KX4D 4WU9C 4EO5C 3NQUA 5GXQC 5JRGB 3W98B 3WKJC 5AVCD 3WTPC 4J8XA 3AV2C 1P3LA 1ZLAD 2PYOA 2BYKA 1ZLAB 5B1LA 3MGRC 3MVDD 3MGSD 4J8VD 3REKD 2HIOC 3KWQC 3MGSB 4J8VB 4R8PA 4E44A 4QLCA 4XZQD 2JSSA 1KX5A 2NZDB 5CPID 1AOIA 3REJC 1ID3C 4XZQB 1ULYA 2CV5B 5CPIB 3LZ0C 3LJAA 1B67A 4CSRB 3LELA 4M6BA 5B0ZA 5JRGC 1KX4C 3AZKD 2NQBA 3AZKB 2AROD 5DNND 3C1CD 5E5AB 2AROB 5DNNB 5AVCC 3AZHA 1ZLAC 1P3GA 3REIA 5BS7A 5AV6D 3MVDC 4J8VC 3REKC 1H3OB 1P3BA 2YFWA 5CP6C 3B0CT 4XZQC 1F66D 5CPIC 1JFIB 3AYWD 3LZ1A 1F66B 2FJ7A 3AYWB 4NE5A 1U35D 2LY8A 3V9RA 1U35B 5B31D 3MGPA 4KHAB 3AZKC 1P3KA 5B31B 2AROC 4G91C 1BH8A 4XUJA 1HTAA 3C1CC 5DNMA 3AFAA 1P3MA 1M19C 4JJNB 5AV6C 4H9NA 1AOID 4WU9A 1BH9B 5GXQA 4Z5TD 3WAAD 1P3FA 1F66C 2RVQD 5B24D 3AYWC 5B24B 1U35C 4ZBJB 3MGRA 3AZGD 3MGQB 4AWLB 4X23B 5B31C 2HIOA 3KWQA 3W99B 3AZHD 1P3GD 3REJA 3WTPE 3AZNA 4WNNB 3LZ0A 4UUZB 5B2ID 3REHB 4J8UD 5G49B 5JRGA 5B2IB 1KX4A 1AOIC 3W98A 5BT1D 3O62D 2FJ7D 4Z5TC 3AZID 3WAAC 3O62B 2RVQC 5AVCA 3AZIB 1ZLAA 3AV1B 4AWLC 3VH6A 3AZGC 4XUJD 3MGSA 4J8VA 3REKA 1WWIA 3AZHC 1P3GC 4H9SC 4XZQA 4J8WD 5CPIA 2CV5A 1TZYB 4CSRA 2HUEC 1P3PD 4J8UC 1P3AD 1P3PB 3AZKA 1P3AB 5BT1C 5E5AA 3O62C 5B40D 3MNND 2AROA 5DNNA 3AZIC 2FJ7C 5GT0D 5B33B 4WU8D 5GT0B 4WU8B 1H3OA 5GT3D 4XUJC 4KUDD 5GT3B 1M18D 3UTBD 1JFIA 1F66A 4J8WC 1M18B 3AYWA 5AVBD 3X1SB 1KU5A 3W98D 1U35A 1P3PC 4KHAA 4KGCD 1P3AC 5AVBB 1P3FC 5B31A 4KGCB 4H9OB 5B40C 3MNNC 4H9PB 5GT0C 1P3ID 4WU8C 1P3IB 4JJNA 2NZDD 5GT3C 5B32B 1BH9A 2CV5D 4KUDC 3AZNC 4Z5TA 3UTBC 3WAAA 3B0DB 5B24A 1F1EA 5B31G 5AVBC 3MGQA 3W98C 5E5AD 4KGCC 3AZGA 4NE3A 4LD9D 5CPJD 3W96D 3X1VB 4LD9B 4H9SA 5CPJB 3W96B 5BNXB 1P3IC 5AV9D 4WNNA 1TAFB 4UUZA 3A6ND 3MGSC 3REHA 3W97D 5AV9B 2NZDC 3A6NB 5B2IA 3WA9D 4J8UA 3W97B 4H9RB 3X1UD 2CV5C 3WA9B 1A7WA 5KDMB 2IO5B 3X1UB 3O62A 3AZIA 3AZMD 3KXBD 2BYMB 3AZMB 3KXBB 5E5AC 5DNNC 1B6WA 5AY8D 5BNVA 4LD9C 4YM6B 3R45B 3W96C 5CPJC 5AY8B 2L5AA 4JJND 1TZYA 4DRBA 4J8WA 5AV9C 3A6NC 3VH5W 3W97C 4ZUXB 1P3PA 1M1AD 1P3AA 2IO5C 3X1UC 1M1AB 3B6FD 4WV4B 5B40A 3MNNA 3MGQD 1KX3D 2YFVA 5GT0A 4X23D 3B6FB 4WU8A 1KX3B 3W99D 3AZMC 3KXBC 4J8XB 5B0YD 5GT3A 5B1LB 4KUDA 5B0YB 3REHD 5F99D 1M18A 4JJNC 3KUYD 3UTBA 4R8PB 5F99B 3KUYB 3AZLD 3B0BA 1N1JB 5AVBA 3AZLB 4KGCA 4Z66D 1M1AC 4H9OA 3AV1D 3RELD 4Z66B 4H9PA 5B24C 4ZBJC 3B6FC 3RELB 1KX3C 3MGQC 4X23C 1P3IA 3AZFD 3W99C 1Q9CA 3AZFB 2NZDA 5B32A 2F8ND 4YS3B 5CPKD 1TZYD 2F8NB 3TU4D 5CPKB 4H9QB 3TU4B 3REHC 3KUYC 3VH6W 5B2IC 1EQZA 3B6GD 3AZLC 1R4VA 3B6GB 5GSUB 3LZ1B 5C3IB 5B33D 4Z66C 3X1VA 5JA4B 4LD9A 3AV1C 3RELC 5CPJA 3W96A 5AV8D 3VH5T 1HQ3D 1TAFA 5AV8B 5B2JD 5B32G 5AV9A 1HQ3B 1BH8B 5B2JB 3A6NA 3W97A 4H9RA 5FUGB 1S32B 4CAYB 3WA9A 5CPKC 1TZYC 3X1UA 3TU4C 4HGAB 3X1SD 3AN2D 1P3OD 3AN2B 3WKJD 5GXQB 2BYMA 3AV2D 3C1BD 1P3OB 3WKJB 3AZMA 3KXBA 3AV2B 3WTPB 3C1BB 5B33C 4YM6A 3R45A 5CHLB 5AY8A 1HQ3C 5B32D 5B2JC 1ID3D 5AV5D 4Z2MH 3REJB 1ID3B 5AV5B 1M1AA 1M18C 3X1SC 3AN2C 1KX4B 3B6FA 1KX3A 1P3OC 4X23A 3C1BC 3X1VD 3W99A 5AVCB 3X1TD 4Z2MG 3VH6T 5B0YA 3X1TB 3AZED 5CP6D 1WWSA 3MVDB 3REKB 4G92B 5F99A 3AZEB 5CP6B 1P34D 3KUYA 2F8NK 5B32C 5G49A 1N1JA 1P34B 5AV5C 3AZLA 3B0DC 5BO0B 4Z66A 3AV1A 3RELA 4E45A 3UTAD 5B1MD 3UT9D 3NQJB 3UTAB 4YM6D 3AZFA 4G91B 5B1MB 3X1VC 3C1CB 1M19D 3UT9B 1EQZD 4YS3A 1M19B 2F8NA 3X1TC 1EQZB 5CPKA 4H9QA 3TU4A 4G92C 5AV6B 4ZUXD 3AZEC 3AZJD 2F8NH 1P34C 3AZJB 3WA9C 3B6GA 5GSUA 5JA4A 5B33A 3NQUB 4J8XD 4NE6A 3VH5A 1P3LD 5AV8A 2PYOD 3UTAC 1P3LB 1HQ3A 5B1MC 4WZSB 5B1LD 5B2JA 3UT9C 2F8NG 4YM6C 4NFTA 2PYOB 2BYKB 5FUGA 5AY8C 1S32A 1EQZC 4CAYA 4R8PD 4QLCD 1KX5D 3X1SA 4ZUXC 4QLCB 3AZJC 3AN2A 1KX5B 1AOIB 3LJAD 1P3OA 3LELD 3WKJA 4Z5TB 3WTPA 3LJAB 3C1BA 3AV2A 5B0ZD 3LELB 3WAAB 2NQBD 5B0ZB 2NQBB 1BFMA 3AZGB 4J8XC 1P3LC 2PYOC 4YS3D 3REID 3AZHB 1P3GB 5B1LC 1ID3A 3REIB 5AV5A 5B0YC 1P3BD 2HUEB 4DRAA 1P3BB 4R8PC 2YFWB 5F99C 4QLCC 1KX5C 4J8UB 5GSUD 3LZ1D 3KSYA 3LJAC 3LELC 2FJ7B 5B0ZC 3MGPD 2NQBC 3V9RB 1P3KD 5BNXA 3MGPB 3X1TA 1P3KB 3MVDA 5DNMD 3AZEA 5CP6A 5BNVB 3AFAD 4XUJB 3AZFC 1P3MD 1S32D 5DNMB 1P34A 4YS3C 3AFAB 3REIC 1P3MB 5BS7C 5KDMA 1P3BC 4J8WB 4WU9D 5BO0A 5GXQD 4H9NB 4WU9B 4EO5B 1P3FD 3WTPD 3B6GC 5GSUC 3LZ1C 1P3FB 2CWEA 3B0CW 3NQJA 5C3IC 3UTAA 5B1MA 3C1CA 3UT9A 3MGRD 5B40B 3MNNB 2YFVB 1M19A 3MGPC 2HIOD 3KWQD 3MGRB 1P3KC
chains in the Genus database with same CATH superfamily
5AV8C 2HIOB 3KWQB 5AV6A 3REJD 5DNMC 2W8SA 4ZUXA 3AFAC 3AZJA 3AZND 1P3MC 4KUDB 1S32C 3LZ0D 3AZNB 3A1KA 3LZ0B 4HGAC 3UTBB 5JRGD 1KX4D 4WU9C 4EO5C 3NQUA 5GXQC 5JRGB 4WJ3C 3W98B 3WKJC 2Y2PA 5AVCD 3WTPC 4J8XA 3AV2C 1P3LA 1ZLAD 2PYOA 2BYKA 1ZLAB 5B1LA 3MGRC 2ZY4A 3MVDD 3MGSD 4J8VD 3REKD 2HIOC 3KWQC 3MGSB 4J8VB 4R8PA 4E44A 4QLCA 4XZQD 2JSSA 1KX5A 2ZM5A 2NZDB 5CPID 1AOIA 3REJC 1ID3C 4XZQB 1Z2CB 1ULYA 2CV5B 5CPIB 3LZ0C 3LJAA 1B67A 4CSRB 3LELA 4M6BA 5B0ZA 5JRGC 1KX4C 3AZKD 2NQBA 3AZKB 2AROD 5DNND 3C1CD 5E5AB 2AROB 5DNNB 5AVCC 3AZHA 1ZLAC 1P3GA 3H0RC 3REIA 5BS7A 5AV6D 3MVDC 4J8VC 3REKC 1H3OB 1P3BA 2YFWA 5CP6C 3B0CT 4XZQC 1F66D 5CPIC 1JFIB 3AYWD 3LZ1A 1F66B 2FJ7A 3AYWB 4NE5A 1U35D 2LY8A 3EPHA 3V9RA 1U35B 2Y2KA 5B31D 3MGPA 4KHAB 3AZKC 1P3KA 5B31B 2AROC 4G91C 1BH8A 4XUJA 1HTAA 3C1CC 5DNMA 3AFAA 1P3MA 1M19C 2RIQA 4JJNB 5AV6C 4H9NA 1AOID 4WU9A 1BH9B 5GXQA 4Z5TD 3WAAD 1P3FA 1F66C 2RVQD 5B24D 3AYWC 5B24B 1U35C 4ZBJB 3MGRA 3AZGD 3MGQB 4AWLB 4X23B 5B31C 2HIOA 3KWQA 3W99B 4DQYB 3AZHD 1P3GD 2G5HC 3REJA 3WTPE 3AZNA 2JCHA 2ZY2A 4WNNB 3LZ0A 2Y2LA 4UUZB 5B2ID 3REHB 4J8UD 5G49B 1PZRA 5JRGA 5B2IB 1KX4A 1AOIC 3W98A 5BT1D 3IP4C 3O62D 2FJ7D 4Z5TC 3AZID 3WAAC 3O62B 2RVQC 5AVCA 3AZIB 1ZLAA 3AV1B 4AWLC 3VH6A 3AZGC 2Y2IA 4XUJD 3MGSA 4J8VA 3REKA 1WWIA 3AZHC 1P3GC 1T3UA 4H9SC 4XZQA 4J8WD 5CPIA 2CV5A 1TZYB 4CSRA 2HUEC 1P3PD 3H0LC 4J8UC 1P3AD 1W2EA 1P3PB 3AZKA 1P3AB 2DF4C 2Y2NA 5BT1C 5E5AA 3O62C 5B40D 3MNND 2AROA 5DNNA 3AZIC 2FJ7C 5GT0D 5B33B 4WU8D 5GT0B 4WU8B 2ZY3A 1H3OA 5GT3D 4XUJC 4KUDD 5GT3B 1M18D 3UTBD 1JFIA 1F66A 4J8WC 1M18B 3AYWA 3EG5B 5AVBD 3X1SB 1KU5A 3W98D 1U35A 1P3PC 4KHAA 4KGCD 1P3AC 5AVBB 1P3FC 5B31A 4KGCB 4H9OB 5B40C 3MNNC 4H9PB 5GT0C 1P3ID 4WU8C 1P3IB 4JJNA 2NZDD 5GT3C 5B32B 1BH9A 2CV5D 4KUDC 3EPJA 3AZNC 4Z5TA 3UTBC 3WAAA 3B0DB 5B24A 1F1EA 5B31G 5AVBC 3MGQA 3W98C 5E5AD 4KGCC 3AZGA 4NE3A 4LD9D 5CPJD 3W96D 3X1VB 4LD9B 4H9SA 5CPJB 3W96B 5BNXB 1P3IC 5AV9D 4WNNA 1TAFB 4UUZA 3A6ND 3MGSC 3REHA 3W97D 5AV9B 2NZDC 2Y2QA 3A6NB 5B2IA 3WA9D 4J8UA 3W97B 4H9RB 3X1UD 2CV5C 3WA9B 1A7WA 5KDMB 2IO5B 3X1UB 3O62A 3AZIA 2JE5A 3AZMD 3KXBD 2BYMB 3AZMB 3KXBB 5E5AC 5DNNC 1B6WA 5BNVA 5AY8D 2Y2OA 4LD9C 4YM6B 3R45B 2J8PA 3W96C 5CPJC 5AY8B 2Y2HA 2L5AA 4JJND 1TZYA 4DRBA 4J8WA 5AV9C 2UWXA 3A6NC 3VH5W 3W97C 4ZUXB 1P3PA 1M1AD 1P3AA 3KFUG 2IO5C 3X1UC 1M1AB 3B6FD 4WV4B 5B40A 3MNNA 3MGQD 1KX3D 2YFVA 5GT0A 4X23D 3B6FB 4WU8A 1KX3B 3W99D 3AZMC 3KXBC 4J8XB 5B0YD 5GT3A 5B1LB 4KUDA 5B0YB 3REHD 5F99D 1M18A 4JJNC 3KUYD 3UTBA 4R8PB 5F99B 3KUYB 3AZLD 3B0BA 1N1JB 5AVBA 3AZLB 3P5JB 4KGCA 4Z66D 1M1AC 4H9OA 3AV1D 3RELD 4Z66B 4H9PA 5B24C 4ZBJC 3B6FC 3RELB 1KX3C 3MGQC 4X23C 1P3IA 3AZFD 3W99C 3A1IA 1Q9CA 3AZFB 2NZDA 2BG1A 5B32A 2F8ND 4YS3B 5CPKD 1TZYD 2ZY5A 2F8NB 3TU4D 5CPKB 4H9QB 3TU4B 3REHC 3KUYC 3VH6W 5B2IC 1EQZA 3B6GD 3AZLC 1R4VA 3B6GB 5GSUB 3LZ1B 5C3IB 5B33D 4Z66C 3X1VA 5JA4B 4LD9A 3AV1C 3RELC 5CPJA 3W96A 5AV8D 3VH5T 1HQ3D 1TAFA 5AV8B 5B2JD 5B32G 5AV9A 1HQ3B 1BH8B 3AL0C 5B2JB 2Y2MA 3A6NA 3W97A 4H9RA 5FUGB 1S32B 4CAYB 3WA9A 5CPKC 1TZYC 2XD1A 3X1UA 3TU4C 4HGAB 3X1SD 3AN2D 1P3OD 3AN2B 3WKJD 5GXQB 2BYMA 3AV2D 3C1BD 1P3OB 3WKJB 3AZMA 3KXBA 3AV2B 3WTPB 3C1BB 5B33C 4YM6A 3R45A 5CHLB 5AY8A 1HQ3C 5B32D 5B2JC 1ID3D 5AV5D 4Z2MH 3REJB 1ID3B 5AV5B 1M1AA 1M18C 3X1SC 3AN2C 3EPLA 1KX4B 3B6FA 1KX3A 1P3OC 4X23A 3C1BC 3X1VD 3W99A 5AVCB 3X1TD 4Z2MG 3VH6T 5B0YA 3X1TB 3AZED 5CP6D 1WWSA 3MVDB 3REKB 4G92B 5F99A 2Y2JA 5CP6B 3AZEB 3KUYA 1P34D 5B32C 5G49A 2F8NK 1N1JA 1P34B 5AV5C 3AZLA 3B0DC 5BO0B 4Z66A 3AV1A 3RELA 4E45A 3F6TA 3UTAD 5B1MD 2VQRA 3UT9D 3NQJB 3UTAB 4YM6D 3AZFA 4G91B 5B1MB 3X1VC 3C1CB 1M19D 3UT9B 1EQZD 4YS3A 1M19B 2F8NA 3X1TC 1EQZB 5CPKA 4H9QA 3TU4A 2FFFB 4G92C 5AV6B 4ZUXD 3AZEC 3AZJD 2F8NH 2Y2GA 1P34C 3AZJB 3WA9C 3FDDA 3B6GA 5GSUA 5JA4A 5B33A 3NQUB 4J8XD 4NE6A 3VH5A 1P3LD 5AV8A 2PYOD 3UTAC 1P3LB 1HQ3A 5B1MC 4WZSB 5B1LD 5B2JA 3UT9C 2F8NG 4YM6C 4NFTA 2PYOB 2BYKB 5FUGA 5AY8C 1S32A 1EQZC 4CAYA 4R8PD 4QLCD 1KX5D 3EPKA 3X1SA 4ZUXC 4QLCB 3AZJC 3AN2A 1KX5B 1AOIB 3LJAD 1P3OA 3LELD 3WKJA 4Z5TB 3WTPA 3LJAB 3C1BA 3AV2A 5B0ZD 3LELB 3WAAB 2NQBD 5B0ZB 2NQBB 1BFMA 3AZGB 4J8XC 1P3LC 2XD5A 2PYOC 4YS3D 3REID 3AZHB 1P3GB 5B1LC 1ID3A 3REIB 5AV5A 5B0YC 1P3BD 2HUEB 4DRAA 1P3BB 4R8PC 2YFWB 4UPKA 5F99C 4QLCC 1KX5C 4J8UB 5GSUD 3LZ1D 3KSYA 2DQNC 3LJAC 3LELC 2FJ7B 3H0MC 5B0ZC 3MGPD 2NQBC 3V9RB 1P3KD 5BNXA 3MGPB 3X1TA 1P3KB 3MVDA 5DNMD 2G5IC 5CP6A 5BNVB 3AFAD 4XUJB 3AZEA 3AZFC 1P3MD 1S32D 5DNMB 1P34A 4YS3C 3AFAB 3REIC 1P3MB 5BS7C 5KDMA 1P3BC 4J8WB 4WU9D 5BO0A 2F2AC 5GXQD 4H9NB 4WU9B 4EO5B 1P3FD 3WTPD 3B6GC 5GSUC 3LZ1C 1P3FB 2CWEA 3B0CW 3NQJA 5C3IC 3UTAA 5B1MA 3C1CA 3UT9A 3MGRD 5B40B 3MNNB 2YFVB 1M19A 3MGPC 2HIOD 3KWQD 3MGRB 1P3KC
chains in the Genus database with same CATH topology
5AV8C 2HIOB 3KWQB 5AV6A 3REJD 5DNMC 2W8SA 4ZUXA 3AFAC 3AZJA 3AZND 1P3MC 4KUDB 1S32C 3LZ0D 3AZNB 3A1KA 3LZ0B 4HGAC 3UTBB 5JRGD 1KX4D 4WU9C 4EO5C 3NQUA 5GXQC 5JRGB 4WJ3C 3W98B 3WKJC 2Y2PA 5AVCD 3WTPC 4J8XA 3AV2C 1P3LA 1ZLAD 2PYOA 2BYKA 1ZLAB 5B1LA 3MGRC 2ZY4A 3MVDD 3MGSD 4J8VD 3REKD 2HIOC 3KWQC 3MGSB 4J8VB 4R8PA 4E44A 4QLCA 4XZQD 2JSSA 1KX5A 2ZM5A 2NZDB 5CPID 1AOIA 3REJC 1ID3C 4XZQB 1Z2CB 1ULYA 2CV5B 5CPIB 3LZ0C 3LJAA 1B67A 4CSRB 3LELA 4M6BA 5B0ZA 5JRGC 1KX4C 3AZKD 2NQBA 3AZKB 2AROD 5DNND 3C1CD 5E5AB 2AROB 5DNNB 5AVCC 3AZHA 1ZLAC 1P3GA 3H0RC 3REIA 5BS7A 5AV6D 3MVDC 4J8VC 3REKC 1H3OB 1P3BA 2YFWA 5CP6C 3B0CT 4XZQC 1F66D 5CPIC 1JFIB 3AYWD 3LZ1A 1F66B 2FJ7A 3AYWB 4NE5A 1U35D 2LY8A 3EPHA 3V9RA 1U35B 2Y2KA 5B31D 3MGPA 4KHAB 3AZKC 1P3KA 5B31B 2AROC 4G91C 1BH8A 4XUJA 1HTAA 3C1CC 5DNMA 3AFAA 1P3MA 1M19C 2RIQA 4JJNB 5AV6C 4H9NA 1AOID 4WU9A 1BH9B 5GXQA 4Z5TD 3WAAD 1P3FA 1F66C 2RVQD 5B24D 3AYWC 5B24B 1U35C 4ZBJB 3MGRA 3AZGD 3MGQB 4AWLB 4X23B 5B31C 2HIOA 3KWQA 3W99B 4DQYB 3AZHD 1P3GD 2G5HC 3REJA 3WTPE 3AZNA 2JCHA 2ZY2A 4WNNB 3LZ0A 2Y2LA 4UUZB 5B2ID 3REHB 4J8UD 5G49B 1PZRA 5JRGA 5B2IB 1KX4A 1AOIC 3W98A 5BT1D 3IP4C 3O62D 2FJ7D 4Z5TC 3AZID 3WAAC 3O62B 2RVQC 5AVCA 3AZIB 1ZLAA 3AV1B 4AWLC 3VH6A 3AZGC 2Y2IA 4XUJD 3MGSA 4J8VA 3REKA 1WWIA 3AZHC 1P3GC 1T3UA 4H9SC 4XZQA 4J8WD 5CPIA 2CV5A 1TZYB 4CSRA 2HUEC 1P3PD 3H0LC 4J8UC 1P3AD 1W2EA 1P3PB 3AZKA 1P3AB 2DF4C 2Y2NA 5BT1C 5E5AA 3O62C 5B40D 3MNND 2AROA 5DNNA 3AZIC 2FJ7C 5GT0D 5B33B 4WU8D 5GT0B 4WU8B 2ZY3A 1H3OA 5GT3D 4XUJC 4KUDD 5GT3B 1M18D 3UTBD 1JFIA 1F66A 4J8WC 1M18B 3AYWA 3EG5B 5AVBD 3X1SB 1KU5A 3W98D 1U35A 1P3PC 4KHAA 4KGCD 1P3AC 5AVBB 1P3FC 5B31A 4KGCB 4H9OB 5B40C 3MNNC 4H9PB 5GT0C 1P3ID 4WU8C 1P3IB 4JJNA 2NZDD 5GT3C 5B32B 1BH9A 2CV5D 4KUDC 3EPJA 3AZNC 4Z5TA 3UTBC 3WAAA 3B0DB 5B24A 1F1EA 5B31G 5AVBC 3MGQA 3W98C 5E5AD 4KGCC 3AZGA 4NE3A 4LD9D 5CPJD 3W96D 3X1VB 4LD9B 4H9SA 5CPJB 3W96B 5BNXB 1P3IC 5AV9D 4WNNA 1TAFB 4UUZA 3A6ND 3MGSC 3REHA 3W97D 5AV9B 2NZDC 2Y2QA 3A6NB 5B2IA 3WA9D 4J8UA 3W97B 4H9RB 3X1UD 2CV5C 3WA9B 1A7WA 5KDMB 2IO5B 3X1UB 3O62A 3AZIA 2JE5A 3AZMD 3KXBD 2BYMB 3AZMB 3KXBB 5E5AC 5DNNC 1B6WA 5BNVA 5AY8D 2Y2OA 4LD9C 4YM6B 3R45B 2J8PA 3W96C 5CPJC 5AY8B 2Y2HA 2L5AA 4JJND 1TZYA 4DRBA 4J8WA 5AV9C 2UWXA 3A6NC 3VH5W 3W97C 4ZUXB 1P3PA 1M1AD 1P3AA 3KFUG 2IO5C 3X1UC 1M1AB 3B6FD 4WV4B 5B40A 3MNNA 3MGQD 1KX3D 2YFVA 5GT0A 4X23D 3B6FB 4WU8A 1KX3B 3W99D 3AZMC 3KXBC 4J8XB 5B0YD 5GT3A 5B1LB 4KUDA 5B0YB 3REHD 5F99D 1M18A 4JJNC 3KUYD 3UTBA 4R8PB 5F99B 3KUYB 3AZLD 3B0BA 1N1JB 5AVBA 3AZLB 3P5JB 4KGCA 4Z66D 1M1AC 4H9OA 3AV1D 3RELD 4Z66B 4H9PA 5B24C 4ZBJC 3B6FC 3RELB 1KX3C 3MGQC 4X23C 1P3IA 3AZFD 3W99C 3A1IA 1Q9CA 3AZFB 2NZDA 2BG1A 5B32A 2F8ND 4YS3B 5CPKD 1TZYD 2ZY5A 2F8NB 3TU4D 5CPKB 4H9QB 3TU4B 3REHC 3KUYC 3VH6W 5B2IC 1EQZA 3B6GD 3AZLC 1R4VA 3B6GB 5GSUB 3LZ1B 5C3IB 5B33D 4Z66C 3X1VA 5JA4B 4LD9A 3AV1C 3RELC 5CPJA 3W96A 5AV8D 3VH5T 1HQ3D 1TAFA 5AV8B 5B2JD 5B32G 5AV9A 1HQ3B 1BH8B 3AL0C 5B2JB 2Y2MA 3A6NA 3W97A 4H9RA 5FUGB 1S32B 4CAYB 3WA9A 5CPKC 1TZYC 2XD1A 3X1UA 3TU4C 4HGAB 3X1SD 3AN2D 1P3OD 3AN2B 3WKJD 5GXQB 2BYMA 3AV2D 3C1BD 1P3OB 3WKJB 3AZMA 3KXBA 3AV2B 3WTPB 3C1BB 5B33C 4YM6A 3R45A 5CHLB 5AY8A 1HQ3C 5B32D 5B2JC 1ID3D 5AV5D 4Z2MH 3REJB 1ID3B 5AV5B 1M1AA 1M18C 3X1SC 3AN2C 3EPLA 1KX4B 3B6FA 1KX3A 1P3OC 4X23A 3C1BC 3X1VD 3W99A 5AVCB 3X1TD 4Z2MG 3VH6T 5B0YA 3X1TB 3AZED 5CP6D 1WWSA 3MVDB 3REKB 4G92B 5F99A 2Y2JA 5CP6B 3AZEB 3KUYA 1P34D 5B32C 5G49A 2F8NK 1N1JA 1P34B 5AV5C 3AZLA 3B0DC 5BO0B 4Z66A 3AV1A 3RELA 4E45A 3F6TA 3UTAD 5B1MD 2VQRA 3UT9D 3NQJB 3UTAB 4YM6D 3AZFA 4G91B 5B1MB 3X1VC 3C1CB 1M19D 3UT9B 1EQZD 4YS3A 1M19B 2F8NA 3X1TC 1EQZB 5CPKA 4H9QA 3TU4A 2FFFB 4G92C 5AV6B 4ZUXD 3AZEC 3AZJD 2F8NH 2Y2GA 1P34C 3AZJB 3WA9C 3FDDA 3B6GA 5GSUA 5JA4A 5B33A 3NQUB 4J8XD 4NE6A 3VH5A 1P3LD 5AV8A 2PYOD 3UTAC 1P3LB 1HQ3A 5B1MC 4WZSB 5B1LD 5B2JA 3UT9C 2F8NG 4YM6C 4NFTA 2PYOB 2BYKB 5FUGA 5AY8C 1S32A 1EQZC 4CAYA 4R8PD 4QLCD 1KX5D 3EPKA 3X1SA 4ZUXC 4QLCB 3AZJC 3AN2A 1KX5B 1AOIB 3LJAD 1P3OA 3LELD 3WKJA 4Z5TB 3WTPA 3LJAB 3C1BA 3AV2A 5B0ZD 3LELB 3WAAB 2NQBD 5B0ZB 2NQBB 1BFMA 3AZGB 4J8XC 1P3LC 2XD5A 2PYOC 4YS3D 3REID 3AZHB 1P3GB 5B1LC 1ID3A 3REIB 5AV5A 5B0YC 1P3BD 2HUEB 4DRAA 1P3BB 4R8PC 2YFWB 4UPKA 5F99C 4QLCC 1KX5C 4J8UB 5GSUD 3LZ1D 3KSYA 2DQNC 3LJAC 3LELC 2FJ7B 3H0MC 5B0ZC 3MGPD 2NQBC 3V9RB 1P3KD 5BNXA 3MGPB 3X1TA 1P3KB 3MVDA 5DNMD 2G5IC 5CP6A 5BNVB 3AFAD 4XUJB 3AZEA 3AZFC 1P3MD 1S32D 5DNMB 1P34A 4YS3C 3AFAB 3REIC 1P3MB 5BS7C 5KDMA 1P3BC 4J8WB 4WU9D 5BO0A 2F2AC 5GXQD 4H9NB 4WU9B 4EO5B 1P3FD 3WTPD 3B6GC 5GSUC 3LZ1C 1P3FB 2CWEA 3B0CW 3NQJA 5C3IC 3UTAA 5B1MA 3C1CA 3UT9A 3MGRD 5B40B 3MNNB 2YFVB 1M19A 3MGPC 2HIOD 3KWQD 3MGRB 1P3KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV8 C;  2HIO B;  3KWQ B;  5AV6 A;  3REJ D;  5DNM C;  4ZUX A;  3AFA C;  3AZJ A;  3AZN D;  1P3M C;  4KUD B;  1S32 C;  3LZ0 D;  3AZN B;  3LZ0 B;  3UTB B;  4HGA C;  5JRG D;  1KX4 D;  4WU9 C;  4EO5 C;  3NQU A;  5GXQ C;  5JRG B;  3W98 B;  3WKJ C;  5AVC D;  3WTP C;  4J8X A;  3AV2 C;  1P3L A;  1ZLA D;  2PYO A;  2BYK A;  1ZLA B;  5B1L A;  3MGR C;  3MVD D;  3MGS D;  4J8V D;  3REK D;  2HIO C;  3KWQ C;  3MGS B;  4J8V B;  4R8P A;  4E44 A;  4QLC A;  4XZQ D;  2JSS A;  1KX5 A;  2NZD B;  5CPI D;  1AOI A;  3REJ C;  1ID3 C;  4XZQ B;  1ULY A;  2CV5 B;  5CPI B;  3LZ0 C;  3LJA A;  1B67 A;  4CSR B;  3LEL A;  4M6B A;  5B0Z A;  5JRG C;  1KX4 C;  3AZK D;  2NQB A;  3AZK B;  2ARO D;  5DNN D;  3C1C D;  5E5A B;  2ARO B;  5DNN B;  5AVC C;  3AZH A;  1ZLA C;  1P3G A;  3REI A;  5BS7 A;  5AV6 D;  3MVD C;  4J8V C;  3REK C;  1H3O B;  1P3B A;  2YFW A;  5CP6 C;  3B0C T;  4XZQ C;  1F66 D;  5CPI C;  1JFI B;  3AYW D;  3LZ1 A;  1F66 B;  2FJ7 A;  3AYW B;  4NE5 A;  1U35 D;  2LY8 A;  3V9R A;  1U35 B;  5B31 D;  3MGP A;  4KHA B;  3AZK C;  1P3K A;  5B31 B;  2ARO C;  4G91 C;  1BH8 A;  4XUJ A;  1HTA A;  3C1C C;  5DNM A;  3AFA A;  1P3M A;  1M19 C;  4JJN B;  5AV6 C;  4H9N A;  1AOI D;  4WU9 A;  1BH9 B;  5GXQ A;  4Z5T D;  3WAA D;  1P3F A;  1F66 C;  2RVQ D;  5B24 D;  3AYW C;  5B24 B;  1U35 C;  4ZBJ B;  3MGR A;  3AZG D;  3MGQ B;  4AWL B;  4X23 B;  5B31 C;  2HIO A;  3KWQ A;  3W99 B;  3AZH D;  1P3G D;  3REJ A;  3WTP E;  3AZN A;  4WNN B;  3LZ0 A;  4UUZ B;  5B2I D;  3REH B;  4J8U D;  5G49 B;  5JRG A;  5B2I B;  1KX4 A;  1AOI C;  3W98 A;  5BT1 D;  3O62 D;  2FJ7 D;  4Z5T C;  3AZI D;  3WAA C;  3O62 B;  2RVQ C;  5AVC A;  3AZI B;  1ZLA A;  3AV1 B;  4AWL C;  3VH6 A;  3AZG C;  4XUJ D;  3MGS A;  4J8V A;  3REK A;  1WWI A;  3AZH C;  1P3G C;  4H9S C;  4XZQ A;  4J8W D;  5CPI A;  2CV5 A;  1TZY B;  4CSR A;  2HUE C;  1P3P D;  4J8U C;  1P3A D;  1P3P B;  3AZK A;  1P3A B;  5BT1 C;  5E5A A;  3O62 C;  5B40 D;  3MNN D;  2ARO A;  5DNN A;  3AZI C;  2FJ7 C;  5GT0 D;  5B33 B;  4WU8 D;  5GT0 B;  4WU8 B;  1H3O A;  5GT3 D;  4XUJ C;  4KUD D;  5GT3 B;  1M18 D;  3UTB D;  1JFI A;  1F66 A;  4J8W C;  1M18 B;  3AYW A;  5AVB D;  3X1S B;  1KU5 A;  3W98 D;  1U35 A;  1P3P C;  4KHA A;  4KGC D;  1P3A C;  5AVB B;  1P3F C;  5B31 A;  4KGC B;  4H9O B;  5B40 C;  3MNN C;  4H9P B;  5GT0 C;  1P3I D;  4WU8 C;  1P3I B;  4JJN A;  2NZD D;  5GT3 C;  5B32 B;  1BH9 A;  2CV5 D;  4KUD C;  3AZN C;  4Z5T A;  3UTB C;  3WAA A;  3B0D B;  5B24 A;  1F1E A;  5B31 G;  5AVB C;  3MGQ A;  3W98 C;  5E5A D;  4KGC C;  3AZG A;  4NE3 A;  4LD9 D;  5CPJ D;  3W96 D;  3X1V B;  4LD9 B;  4H9S A;  5CPJ B;  3W96 B;  5BNX B;  1P3I C;  5AV9 D;  4WNN A;  1TAF B;  4UUZ A;  3A6N D;  3MGS C;  3REH A;  3W97 D;  5AV9 B;  2NZD C;  3A6N B;  5B2I A;  3WA9 D;  4J8U A;  3W97 B;  4H9R B;  3X1U D;  2CV5 C;  3WA9 B;  1A7W A;  5KDM B;  2IO5 B;  3X1U B;  3O62 A;  3AZI A;  3AZM D;  3KXB D;  2BYM B;  3AZM B;  3KXB B;  5E5A C;  5DNN C;  1B6W A;  5AY8 D;  5BNV A;  4LD9 C;  4YM6 B;  3R45 B;  3W96 C;  5CPJ C;  5AY8 B;  2L5A A;  4JJN D;  1TZY A;  4DRB A;  4J8W A;  5AV9 C;  3A6N C;  3VH5 W;  3W97 C;  4ZUX B;  1P3P A;  1M1A D;  1P3A A;  2IO5 C;  3X1U C;  1M1A B;  3B6F D;  4WV4 B;  5B40 A;  3MNN A;  3MGQ D;  1KX3 D;  2YFV A;  5GT0 A;  4X23 D;  3B6F B;  4WU8 A;  1KX3 B;  3W99 D;  3AZM C;  3KXB C;  4J8X B;  5B0Y D;  5GT3 A;  5B1L B;  4KUD A;  5B0Y B;  3REH D;  5F99 D;  1M18 A;  4JJN C;  3KUY D;  3UTB A;  4R8P B;  5F99 B;  3KUY B;  3AZL D;  3B0B A;  1N1J B;  5AVB A;  3AZL B;  4KGC A;  4Z66 D;  1M1A C;  4H9O A;  3AV1 D;  3REL D;  4Z66 B;  4H9P A;  5B24 C;  4ZBJ C;  3B6F C;  3REL B;  1KX3 C;  3MGQ C;  4X23 C;  1P3I A;  3AZF D;  3W99 C;  1Q9C A;  3AZF B;  2NZD A;  5B32 A;  2F8N D;  4YS3 B;  5CPK D;  1TZY D;  2F8N B;  3TU4 D;  5CPK B;  4H9Q B;  3TU4 B;  3REH C;  3KUY C;  3VH6 W;  5B2I C;  1EQZ A;  3B6G D;  3AZL C;  1R4V A;  3B6G B;  5GSU B;  3LZ1 B;  5C3I B;  5B33 D;  4Z66 C;  3X1V A;  5JA4 B;  4LD9 A;  3AV1 C;  3REL C;  5CPJ A;  3W96 A;  5AV8 D;  3VH5 T;  1HQ3 D;  1TAF A;  5AV8 B;  5B2J D;  5B32 G;  5AV9 A;  1HQ3 B;  1BH8 B;  5B2J B;  3A6N A;  3W97 A;  4H9R A;  5FUG B;  1S32 B;  4CAY B;  3WA9 A;  5CPK C;  1TZY C;  3X1U A;  3TU4 C;  4HGA B;  3X1S D;  3AN2 D;  1P3O D;  3AN2 B;  3WKJ D;  5GXQ B;  2BYM A;  3AV2 D;  3C1B D;  1P3O B;  3WKJ B;  3AZM A;  3KXB A;  3AV2 B;  3WTP B;  3C1B B;  5B33 C;  4YM6 A;  3R45 A;  5CHL B;  5AY8 A;  1HQ3 C;  5B32 D;  5B2J C;  1ID3 D;  5AV5 D;  4Z2M H;  3REJ B;  1ID3 B;  5AV5 B;  1M1A A;  1M18 C;  3X1S C;  3AN2 C;  1KX4 B;  3B6F A;  1KX3 A;  1P3O C;  4X23 A;  3C1B C;  3X1V D;  3W99 A;  5AVC B;  3X1T D;  4Z2M G;  3VH6 T;  5B0Y A;  3X1T B;  3AZE D;  5CP6 D;  1WWS A;  3MVD B;  3REK B;  4G92 B;  5F99 A;  3AZE B;  5CP6 B;  1P34 D;  3KUY A;  2F8N K;  5B32 C;  5G49 A;  1N1J A;  1P34 B;  5AV5 C;  3AZL A;  3B0D C;  5BO0 B;  4Z66 A;  3AV1 A;  3REL A;  4E45 A;  3UTA D;  5B1M D;  3UT9 D;  3NQJ B;  3UTA B;  4YM6 D;  3AZF A;  4G91 B;  5B1M B;  3X1V C;  3C1C B;  1M19 D;  3UT9 B;  1EQZ D;  4YS3 A;  1M19 B;  2F8N A;  3X1T C;  1EQZ B;  5CPK A;  4H9Q A;  3TU4 A;  4G92 C;  5AV6 B;  4ZUX D;  3AZE C;  3AZJ D;  2F8N H;  1P34 C;  3AZJ B;  3WA9 C;  3B6G A;  5GSU A;  5JA4 A;  5B33 A;  3NQU B;  4J8X D;  4NE6 A;  3VH5 A;  1P3L D;  5AV8 A;  2PYO D;  3UTA C;  1P3L B;  1HQ3 A;  5B1M C;  4WZS B;  5B1L D;  5B2J A;  3UT9 C;  2F8N G;  4YM6 C;  4NFT A;  2PYO B;  2BYK B;  5FUG A;  5AY8 C;  1S32 A;  1EQZ C;  4CAY A;  4R8P D;  4QLC D;  1KX5 D;  3X1S A;  4ZUX C;  4QLC B;  3AZJ C;  3AN2 A;  1KX5 B;  1AOI B;  3LJA D;  1P3O A;  3LEL D;  3WKJ A;  4Z5T B;  3WTP A;  3LJA B;  3C1B A;  3AV2 A;  5B0Z D;  3LEL B;  3WAA B;  2NQB D;  5B0Z B;  2NQB B;  1BFM A;  3AZG B;  4J8X C;  1P3L C;  2PYO C;  4YS3 D;  3REI D;  3AZH B;  1P3G B;  5B1L C;  1ID3 A;  3REI B;  5AV5 A;  5B0Y C;  1P3B D;  2HUE B;  4DRA A;  1P3B B;  4R8P C;  2YFW B;  5F99 C;  4QLC C;  1KX5 C;  4J8U B;  5GSU D;  3LZ1 D;  3KSY A;  3LJA C;  3LEL C;  2FJ7 B;  5B0Z C;  3MGP D;  2NQB C;  3V9R B;  1P3K D;  5BNX A;  3MGP B;  3X1T A;  1P3K B;  3MVD A;  5DNM D;  3AZE A;  5CP6 A;  5BNV B;  3AFA D;  4XUJ B;  3AZF C;  1P3M D;  1S32 D;  5DNM B;  1P34 A;  4YS3 C;  3AFA B;  3REI C;  1P3M B;  5BS7 C;  5KDM A;  1P3B C;  4J8W B;  4WU9 D;  5BO0 A;  5GXQ D;  4H9N B;  4WU9 B;  4EO5 B;  1P3F D;  3WTP D;  3B6G C;  5GSU C;  3LZ1 C;  1P3F B;  2CWE A;  3B0C W;  3NQJ A;  5C3I C;  3UTA A;  5B1M A;  3C1C A;  3UT9 A;  3MGR D;  5B40 B;  3MNN B;  2YFV B;  1M19 A;  3MGP C;  2HIO D;  3KWQ D;  3MGR B;  1P3K C; 
#chains in the Genus database with same CATH topology
 5AV8 C;  2HIO B;  3KWQ B;  5AV6 A;  3REJ D;  5DNM C;  2W8S A;  4ZUX A;  3AFA C;  3AZJ A;  3AZN D;  1P3M C;  4KUD B;  1S32 C;  3LZ0 D;  3AZN B;  3A1K A;  3LZ0 B;  4HGA C;  3UTB B;  5JRG D;  1KX4 D;  4WU9 C;  4EO5 C;  3NQU A;  5GXQ C;  5JRG B;  4WJ3 C;  3W98 B;  3WKJ C;  2Y2P A;  5AVC D;  3WTP C;  4J8X A;  3AV2 C;  1P3L A;  1ZLA D;  2PYO A;  2BYK A;  1ZLA B;  5B1L A;  3MGR C;  2ZY4 A;  3MVD D;  3MGS D;  4J8V D;  3REK D;  2HIO C;  3KWQ C;  3MGS B;  4J8V B;  4R8P A;  4E44 A;  4QLC A;  4XZQ D;  2JSS A;  1KX5 A;  2ZM5 A;  2NZD B;  5CPI D;  1AOI A;  3REJ C;  1ID3 C;  4XZQ B;  1Z2C B;  1ULY A;  2CV5 B;  5CPI B;  3LZ0 C;  3LJA A;  1B67 A;  4CSR B;  3LEL A;  4M6B A;  5B0Z A;  5JRG C;  1KX4 C;  3AZK D;  2NQB A;  3AZK B;  2ARO D;  5DNN D;  3C1C D;  5E5A B;  2ARO B;  5DNN B;  5AVC C;  3AZH A;  1ZLA C;  1P3G A;  3H0R C;  3REI A;  5BS7 A;  5AV6 D;  3MVD C;  4J8V C;  3REK C;  1H3O B;  1P3B A;  2YFW A;  5CP6 C;  3B0C T;  4XZQ C;  1F66 D;  5CPI C;  1JFI B;  3AYW D;  3LZ1 A;  1F66 B;  2FJ7 A;  3AYW B;  4NE5 A;  1U35 D;  2LY8 A;  3EPH A;  3V9R A;  1U35 B;  2Y2K A;  5B31 D;  3MGP A;  4KHA B;  3AZK C;  1P3K A;  5B31 B;  2ARO C;  4G91 C;  1BH8 A;  4XUJ A;  1HTA A;  3C1C C;  5DNM A;  3AFA A;  1P3M A;  1M19 C;  2RIQ A;  4JJN B;  5AV6 C;  4H9N A;  1AOI D;  4WU9 A;  1BH9 B;  5GXQ A;  4Z5T D;  3WAA D;  1P3F A;  1F66 C;  2RVQ D;  5B24 D;  3AYW C;  5B24 B;  1U35 C;  4ZBJ B;  3MGR A;  3AZG D;  3MGQ B;  4AWL B;  4X23 B;  5B31 C;  2HIO A;  3KWQ A;  3W99 B;  4DQY B;  3AZH D;  1P3G D;  2G5H C;  3REJ A;  3WTP E;  3AZN A;  2JCH A;  2ZY2 A;  4WNN B;  3LZ0 A;  2Y2L A;  4UUZ B;  5B2I D;  3REH B;  4J8U D;  5G49 B;  1PZR A;  5JRG A;  5B2I B;  1KX4 A;  1AOI C;  3W98 A;  5BT1 D;  3IP4 C;  3O62 D;  2FJ7 D;  4Z5T C;  3AZI D;  3WAA C;  3O62 B;  2RVQ C;  5AVC A;  3AZI B;  1ZLA A;  3AV1 B;  4AWL C;  3VH6 A;  3AZG C;  2Y2I A;  4XUJ D;  3MGS A;  4J8V A;  3REK A;  1WWI A;  3AZH C;  1P3G C;  1T3U A;  4H9S C;  4XZQ A;  4J8W D;  5CPI A;  2CV5 A;  1TZY B;  4CSR A;  2HUE C;  1P3P D;  3H0L C;  4J8U C;  1P3A D;  1W2E A;  1P3P B;  3AZK A;  1P3A B;  2DF4 C;  2Y2N A;  5BT1 C;  5E5A A;  3O62 C;  5B40 D;  3MNN D;  2ARO A;  5DNN A;  3AZI C;  2FJ7 C;  5GT0 D;  5B33 B;  4WU8 D;  5GT0 B;  4WU8 B;  2ZY3 A;  1H3O A;  5GT3 D;  4XUJ C;  4KUD D;  5GT3 B;  1M18 D;  3UTB D;  1JFI A;  1F66 A;  4J8W C;  1M18 B;  3AYW A;  3EG5 B;  5AVB D;  3X1S B;  1KU5 A;  3W98 D;  1U35 A;  1P3P C;  4KHA A;  4KGC D;  1P3A C;  5AVB B;  1P3F C;  5B31 A;  4KGC B;  4H9O B;  5B40 C;  3MNN C;  4H9P B;  5GT0 C;  1P3I D;  4WU8 C;  1P3I B;  4JJN A;  2NZD D;  5GT3 C;  5B32 B;  1BH9 A;  2CV5 D;  4KUD C;  3EPJ A;  3AZN C;  4Z5T A;  3UTB C;  3WAA A;  3B0D B;  5B24 A;  1F1E A;  5B31 G;  5AVB C;  3MGQ A;  3W98 C;  5E5A D;  4KGC C;  3AZG A;  4NE3 A;  4LD9 D;  5CPJ D;  3W96 D;  3X1V B;  4LD9 B;  4H9S A;  5CPJ B;  3W96 B;  5BNX B;  1P3I C;  5AV9 D;  4WNN A;  1TAF B;  4UUZ A;  3A6N D;  3MGS C;  3REH A;  3W97 D;  5AV9 B;  2NZD C;  2Y2Q A;  3A6N B;  5B2I A;  3WA9 D;  4J8U A;  3W97 B;  4H9R B;  3X1U D;  2CV5 C;  3WA9 B;  1A7W A;  5KDM B;  2IO5 B;  3X1U B;  3O62 A;  3AZI A;  2JE5 A;  3AZM D;  3KXB D;  2BYM B;  3AZM B;  3KXB B;  5E5A C;  5DNN C;  1B6W A;  5BNV A;  5AY8 D;  2Y2O A;  4LD9 C;  4YM6 B;  3R45 B;  2J8P A;  3W96 C;  5CPJ C;  5AY8 B;  2Y2H A;  2L5A A;  4JJN D;  1TZY A;  4DRB A;  4J8W A;  5AV9 C;  2UWX A;  3A6N C;  3VH5 W;  3W97 C;  4ZUX B;  1P3P A;  1M1A D;  1P3A A;  3KFU G;  2IO5 C;  3X1U C;  1M1A B;  3B6F D;  4WV4 B;  5B40 A;  3MNN A;  3MGQ D;  1KX3 D;  2YFV A;  5GT0 A;  4X23 D;  3B6F B;  4WU8 A;  1KX3 B;  3W99 D;  3AZM C;  3KXB C;  4J8X B;  5B0Y D;  5GT3 A;  5B1L B;  4KUD A;  5B0Y B;  3REH D;  5F99 D;  1M18 A;  4JJN C;  3KUY D;  3UTB A;  4R8P B;  5F99 B;  3KUY B;  3AZL D;  3B0B A;  1N1J B;  5AVB A;  3AZL B;  3P5J B;  4KGC A;  4Z66 D;  1M1A C;  4H9O A;  3AV1 D;  3REL D;  4Z66 B;  4H9P A;  5B24 C;  4ZBJ C;  3B6F C;  3REL B;  1KX3 C;  3MGQ C;  4X23 C;  1P3I A;  3AZF D;  3W99 C;  3A1I A;  1Q9C A;  3AZF B;  2NZD A;  2BG1 A;  5B32 A;  2F8N D;  4YS3 B;  5CPK D;  1TZY D;  2ZY5 A;  2F8N B;  3TU4 D;  5CPK B;  4H9Q B;  3TU4 B;  3REH C;  3KUY C;  3VH6 W;  5B2I C;  1EQZ A;  3B6G D;  3AZL C;  1R4V A;  3B6G B;  5GSU B;  3LZ1 B;  5C3I B;  5B33 D;  4Z66 C;  3X1V A;  5JA4 B;  4LD9 A;  3AV1 C;  3REL C;  5CPJ A;  3W96 A;  5AV8 D;  3VH5 T;  1HQ3 D;  1TAF A;  5AV8 B;  5B2J D;  5B32 G;  5AV9 A;  1HQ3 B;  1BH8 B;  3AL0 C;  5B2J B;  2Y2M A;  3A6N A;  3W97 A;  4H9R A;  5FUG B;  1S32 B;  4CAY B;  3WA9 A;  5CPK C;  1TZY C;  2XD1 A;  3X1U A;  3TU4 C;  4HGA B;  3X1S D;  3AN2 D;  1P3O D;  3AN2 B;  3WKJ D;  5GXQ B;  2BYM A;  3AV2 D;  3C1B D;  1P3O B;  3WKJ B;  3AZM A;  3KXB A;  3AV2 B;  3WTP B;  3C1B B;  5B33 C;  4YM6 A;  3R45 A;  5CHL B;  5AY8 A;  1HQ3 C;  5B32 D;  5B2J C;  1ID3 D;  5AV5 D;  4Z2M H;  3REJ B;  1ID3 B;  5AV5 B;  1M1A A;  1M18 C;  3X1S C;  3AN2 C;  3EPL A;  1KX4 B;  3B6F A;  1KX3 A;  1P3O C;  4X23 A;  3C1B C;  3X1V D;  3W99 A;  5AVC B;  3X1T D;  4Z2M G;  3VH6 T;  5B0Y A;  3X1T B;  3AZE D;  5CP6 D;  1WWS A;  3MVD B;  3REK B;  4G92 B;  5F99 A;  2Y2J A;  5CP6 B;  3AZE B;  3KUY A;  1P34 D;  5B32 C;  5G49 A;  2F8N K;  1N1J A;  1P34 B;  5AV5 C;  3AZL A;  3B0D C;  5BO0 B;  4Z66 A;  3AV1 A;  3REL A;  4E45 A;  3F6T A;  3UTA D;  5B1M D;  2VQR A;  3UT9 D;  3NQJ B;  3UTA B;  4YM6 D;  3AZF A;  4G91 B;  5B1M B;  3X1V C;  3C1C B;  1M19 D;  3UT9 B;  1EQZ D;  4YS3 A;  1M19 B;  2F8N A;  3X1T C;  1EQZ B;  5CPK A;  4H9Q A;  3TU4 A;  2FFF B;  4G92 C;  5AV6 B;  4ZUX D;  3AZE C;  3AZJ D;  2F8N H;  2Y2G A;  1P34 C;  3AZJ B;  3WA9 C;  3FDD A;  3B6G A;  5GSU A;  5JA4 A;  5B33 A;  3NQU B;  4J8X D;  4NE6 A;  3VH5 A;  1P3L D;  5AV8 A;  2PYO D;  3UTA C;  1P3L B;  1HQ3 A;  5B1M C;  4WZS B;  5B1L D;  5B2J A;  3UT9 C;  2F8N G;  4YM6 C;  4NFT A;  2PYO B;  2BYK B;  5FUG A;  5AY8 C;  1S32 A;  1EQZ C;  4CAY A;  4R8P D;  4QLC D;  1KX5 D;  3EPK A;  3X1S A;  4ZUX C;  4QLC B;  3AZJ C;  3AN2 A;  1KX5 B;  1AOI B;  3LJA D;  1P3O A;  3LEL D;  3WKJ A;  4Z5T B;  3WTP A;  3LJA B;  3C1B A;  3AV2 A;  5B0Z D;  3LEL B;  3WAA B;  2NQB D;  5B0Z B;  2NQB B;  1BFM A;  3AZG B;  4J8X C;  1P3L C;  2XD5 A;  2PYO C;  4YS3 D;  3REI D;  3AZH B;  1P3G B;  5B1L C;  1ID3 A;  3REI B;  5AV5 A;  5B0Y C;  1P3B D;  2HUE B;  4DRA A;  1P3B B;  4R8P C;  2YFW B;  4UPK A;  5F99 C;  4QLC C;  1KX5 C;  4J8U B;  5GSU D;  3LZ1 D;  3KSY A;  2DQN C;  3LJA C;  3LEL C;  2FJ7 B;  3H0M C;  5B0Z C;  3MGP D;  2NQB C;  3V9R B;  1P3K D;  5BNX A;  3MGP B;  3X1T A;  1P3K B;  3MVD A;  5DNM D;  2G5I C;  5CP6 A;  5BNV B;  3AFA D;  4XUJ B;  3AZE A;  3AZF C;  1P3M D;  1S32 D;  5DNM B;  1P34 A;  4YS3 C;  3AFA B;  3REI C;  1P3M B;  5BS7 C;  5KDM A;  1P3B C;  4J8W B;  4WU9 D;  5BO0 A;  2F2A C;  5GXQ D;  4H9N B;  4WU9 B;  4EO5 B;  1P3F D;  3WTP D;  3B6G C;  5GSU C;  3LZ1 C;  1P3F B;  2CWE A;  3B0C W;  3NQJ A;  5C3I C;  3UTA A;  5B1M A;  3C1C A;  3UT9 A;  3MGR D;  5B40 B;  3MNN B;  2YFV B;  1M19 A;  3MGP C;  2HIO D;  3KWQ D;  3MGR B;  1P3K C; 
#chains in the Genus database with same CATH homology
 5AV8 C;  2HIO B;  3KWQ B;  5AV6 A;  3REJ D;  5DNM C;  2W8S A;  4ZUX A;  3AFA C;  3AZJ A;  3AZN D;  1P3M C;  4KUD B;  1S32 C;  3LZ0 D;  3AZN B;  3A1K A;  3LZ0 B;  4HGA C;  3UTB B;  5JRG D;  1KX4 D;  4WU9 C;  4EO5 C;  3NQU A;  5GXQ C;  5JRG B;  4WJ3 C;  3W98 B;  3WKJ C;  2Y2P A;  5AVC D;  3WTP C;  4J8X A;  3AV2 C;  1P3L A;  1ZLA D;  2PYO A;  2BYK A;  1ZLA B;  5B1L A;  3MGR C;  2ZY4 A;  3MVD D;  3MGS D;  4J8V D;  3REK D;  2HIO C;  3KWQ C;  3MGS B;  4J8V B;  4R8P A;  4E44 A;  4QLC A;  4XZQ D;  2JSS A;  1KX5 A;  2ZM5 A;  2NZD B;  5CPI D;  1AOI A;  3REJ C;  1ID3 C;  4XZQ B;  1Z2C B;  1ULY A;  2CV5 B;  5CPI B;  3LZ0 C;  3LJA A;  1B67 A;  4CSR B;  3LEL A;  4M6B A;  5B0Z A;  5JRG C;  1KX4 C;  3AZK D;  2NQB A;  3AZK B;  2ARO D;  5DNN D;  3C1C D;  5E5A B;  2ARO B;  5DNN B;  5AVC C;  3AZH A;  1ZLA C;  1P3G A;  3H0R C;  3REI A;  5BS7 A;  5AV6 D;  3MVD C;  4J8V C;  3REK C;  1H3O B;  1P3B A;  2YFW A;  5CP6 C;  3B0C T;  4XZQ C;  1F66 D;  5CPI C;  1JFI B;  3AYW D;  3LZ1 A;  1F66 B;  2FJ7 A;  3AYW B;  4NE5 A;  1U35 D;  2LY8 A;  3EPH A;  3V9R A;  1U35 B;  2Y2K A;  5B31 D;  3MGP A;  4KHA B;  3AZK C;  1P3K A;  5B31 B;  2ARO C;  4G91 C;  1BH8 A;  4XUJ A;  1HTA A;  3C1C C;  5DNM A;  3AFA A;  1P3M A;  1M19 C;  2RIQ A;  4JJN B;  5AV6 C;  4H9N A;  1AOI D;  4WU9 A;  1BH9 B;  5GXQ A;  4Z5T D;  3WAA D;  1P3F A;  1F66 C;  2RVQ D;  5B24 D;  3AYW C;  5B24 B;  1U35 C;  4ZBJ B;  3MGR A;  3AZG D;  3MGQ B;  4AWL B;  4X23 B;  5B31 C;  2HIO A;  3KWQ A;  3W99 B;  4DQY B;  3AZH D;  1P3G D;  2G5H C;  3REJ A;  3WTP E;  3AZN A;  2JCH A;  2ZY2 A;  4WNN B;  3LZ0 A;  2Y2L A;  4UUZ B;  5B2I D;  3REH B;  4J8U D;  5G49 B;  1PZR A;  5JRG A;  5B2I B;  1KX4 A;  1AOI C;  3W98 A;  5BT1 D;  3IP4 C;  3O62 D;  2FJ7 D;  4Z5T C;  3AZI D;  3WAA C;  3O62 B;  2RVQ C;  5AVC A;  3AZI B;  1ZLA A;  3AV1 B;  4AWL C;  3VH6 A;  3AZG C;  2Y2I A;  4XUJ D;  3MGS A;  4J8V A;  3REK A;  1WWI A;  3AZH C;  1P3G C;  1T3U A;  4H9S C;  4XZQ A;  4J8W D;  5CPI A;  2CV5 A;  1TZY B;  4CSR A;  2HUE C;  1P3P D;  3H0L C;  4J8U C;  1P3A D;  1W2E A;  1P3P B;  3AZK A;  1P3A B;  2DF4 C;  2Y2N A;  5BT1 C;  5E5A A;  3O62 C;  5B40 D;  3MNN D;  2ARO A;  5DNN A;  3AZI C;  2FJ7 C;  5GT0 D;  5B33 B;  4WU8 D;  5GT0 B;  4WU8 B;  2ZY3 A;  1H3O A;  5GT3 D;  4XUJ C;  4KUD D;  5GT3 B;  1M18 D;  3UTB D;  1JFI A;  1F66 A;  4J8W C;  1M18 B;  3AYW A;  3EG5 B;  5AVB D;  3X1S B;  1KU5 A;  3W98 D;  1U35 A;  1P3P C;  4KHA A;  4KGC D;  1P3A C;  5AVB B;  1P3F C;  5B31 A;  4KGC B;  4H9O B;  5B40 C;  3MNN C;  4H9P B;  5GT0 C;  1P3I D;  4WU8 C;  1P3I B;  4JJN A;  2NZD D;  5GT3 C;  5B32 B;  1BH9 A;  2CV5 D;  4KUD C;  3EPJ A;  3AZN C;  4Z5T A;  3UTB C;  3WAA A;  3B0D B;  5B24 A;  1F1E A;  5B31 G;  5AVB C;  3MGQ A;  3W98 C;  5E5A D;  4KGC C;  3AZG A;  4NE3 A;  4LD9 D;  5CPJ D;  3W96 D;  3X1V B;  4LD9 B;  4H9S A;  5CPJ B;  3W96 B;  5BNX B;  1P3I C;  5AV9 D;  4WNN A;  1TAF B;  4UUZ A;  3A6N D;  3MGS C;  3REH A;  3W97 D;  5AV9 B;  2NZD C;  2Y2Q A;  3A6N B;  5B2I A;  3WA9 D;  4J8U A;  3W97 B;  4H9R B;  3X1U D;  2CV5 C;  3WA9 B;  1A7W A;  5KDM B;  2IO5 B;  3X1U B;  3O62 A;  3AZI A;  2JE5 A;  3AZM D;  3KXB D;  2BYM B;  3AZM B;  3KXB B;  5E5A C;  5DNN C;  1B6W A;  5BNV A;  5AY8 D;  2Y2O A;  4LD9 C;  4YM6 B;  3R45 B;  2J8P A;  3W96 C;  5CPJ C;  5AY8 B;  2Y2H A;  2L5A A;  4JJN D;  1TZY A;  4DRB A;  4J8W A;  5AV9 C;  2UWX A;  3A6N C;  3VH5 W;  3W97 C;  4ZUX B;  1P3P A;  1M1A D;  1P3A A;  3KFU G;  2IO5 C;  3X1U C;  1M1A B;  3B6F D;  4WV4 B;  5B40 A;  3MNN A;  3MGQ D;  1KX3 D;  2YFV A;  5GT0 A;  4X23 D;  3B6F B;  4WU8 A;  1KX3 B;  3W99 D;  3AZM C;  3KXB C;  4J8X B;  5B0Y D;  5GT3 A;  5B1L B;  4KUD A;  5B0Y B;  3REH D;  5F99 D;  1M18 A;  4JJN C;  3KUY D;  3UTB A;  4R8P B;  5F99 B;  3KUY B;  3AZL D;  3B0B A;  1N1J B;  5AVB A;  3AZL B;  3P5J B;  4KGC A;  4Z66 D;  1M1A C;  4H9O A;  3AV1 D;  3REL D;  4Z66 B;  4H9P A;  5B24 C;  4ZBJ C;  3B6F C;  3REL B;  1KX3 C;  3MGQ C;  4X23 C;  1P3I A;  3AZF D;  3W99 C;  3A1I A;  1Q9C A;  3AZF B;  2NZD A;  2BG1 A;  5B32 A;  2F8N D;  4YS3 B;  5CPK D;  1TZY D;  2ZY5 A;  2F8N B;  3TU4 D;  5CPK B;  4H9Q B;  3TU4 B;  3REH C;  3KUY C;  3VH6 W;  5B2I C;  1EQZ A;  3B6G D;  3AZL C;  1R4V A;  3B6G B;  5GSU B;  3LZ1 B;  5C3I B;  5B33 D;  4Z66 C;  3X1V A;  5JA4 B;  4LD9 A;  3AV1 C;  3REL C;  5CPJ A;  3W96 A;  5AV8 D;  3VH5 T;  1HQ3 D;  1TAF A;  5AV8 B;  5B2J D;  5B32 G;  5AV9 A;  1HQ3 B;  1BH8 B;  3AL0 C;  5B2J B;  2Y2M A;  3A6N A;  3W97 A;  4H9R A;  5FUG B;  1S32 B;  4CAY B;  3WA9 A;  5CPK C;  1TZY C;  2XD1 A;  3X1U A;  3TU4 C;  4HGA B;  3X1S D;  3AN2 D;  1P3O D;  3AN2 B;  3WKJ D;  5GXQ B;  2BYM A;  3AV2 D;  3C1B D;  1P3O B;  3WKJ B;  3AZM A;  3KXB A;  3AV2 B;  3WTP B;  3C1B B;  5B33 C;  4YM6 A;  3R45 A;  5CHL B;  5AY8 A;  1HQ3 C;  5B32 D;  5B2J C;  1ID3 D;  5AV5 D;  4Z2M H;  3REJ B;  1ID3 B;  5AV5 B;  1M1A A;  1M18 C;  3X1S C;  3AN2 C;  3EPL A;  1KX4 B;  3B6F A;  1KX3 A;  1P3O C;  4X23 A;  3C1B C;  3X1V D;  3W99 A;  5AVC B;  3X1T D;  4Z2M G;  3VH6 T;  5B0Y A;  3X1T B;  3AZE D;  5CP6 D;  1WWS A;  3MVD B;  3REK B;  4G92 B;  5F99 A;  2Y2J A;  5CP6 B;  3AZE B;  3KUY A;  1P34 D;  5B32 C;  5G49 A;  2F8N K;  1N1J A;  1P34 B;  5AV5 C;  3AZL A;  3B0D C;  5BO0 B;  4Z66 A;  3AV1 A;  3REL A;  4E45 A;  3F6T A;  3UTA D;  5B1M D;  2VQR A;  3UT9 D;  3NQJ B;  3UTA B;  4YM6 D;  3AZF A;  4G91 B;  5B1M B;  3X1V C;  3C1C B;  1M19 D;  3UT9 B;  1EQZ D;  4YS3 A;  1M19 B;  2F8N A;  3X1T C;  1EQZ B;  5CPK A;  4H9Q A;  3TU4 A;  2FFF B;  4G92 C;  5AV6 B;  4ZUX D;  3AZE C;  3AZJ D;  2F8N H;  2Y2G A;  1P34 C;  3AZJ B;  3WA9 C;  3FDD A;  3B6G A;  5GSU A;  5JA4 A;  5B33 A;  3NQU B;  4J8X D;  4NE6 A;  3VH5 A;  1P3L D;  5AV8 A;  2PYO D;  3UTA C;  1P3L B;  1HQ3 A;  5B1M C;  4WZS B;  5B1L D;  5B2J A;  3UT9 C;  2F8N G;  4YM6 C;  4NFT A;  2PYO B;  2BYK B;  5FUG A;  5AY8 C;  1S32 A;  1EQZ C;  4CAY A;  4R8P D;  4QLC D;  1KX5 D;  3EPK A;  3X1S A;  4ZUX C;  4QLC B;  3AZJ C;  3AN2 A;  1KX5 B;  1AOI B;  3LJA D;  1P3O A;  3LEL D;  3WKJ A;  4Z5T B;  3WTP A;  3LJA B;  3C1B A;  3AV2 A;  5B0Z D;  3LEL B;  3WAA B;  2NQB D;  5B0Z B;  2NQB B;  1BFM A;  3AZG B;  4J8X C;  1P3L C;  2XD5 A;  2PYO C;  4YS3 D;  3REI D;  3AZH B;  1P3G B;  5B1L C;  1ID3 A;  3REI B;  5AV5 A;  5B0Y C;  1P3B D;  2HUE B;  4DRA A;  1P3B B;  4R8P C;  2YFW B;  4UPK A;  5F99 C;  4QLC C;  1KX5 C;  4J8U B;  5GSU D;  3LZ1 D;  3KSY A;  2DQN C;  3LJA C;  3LEL C;  2FJ7 B;  3H0M C;  5B0Z C;  3MGP D;  2NQB C;  3V9R B;  1P3K D;  5BNX A;  3MGP B;  3X1T A;  1P3K B;  3MVD A;  5DNM D;  2G5I C;  5CP6 A;  5BNV B;  3AFA D;  4XUJ B;  3AZE A;  3AZF C;  1P3M D;  1S32 D;  5DNM B;  1P34 A;  4YS3 C;  3AFA B;  3REI C;  1P3M B;  5BS7 C;  5KDM A;  1P3B C;  4J8W B;  4WU9 D;  5BO0 A;  2F2A C;  5GXQ D;  4H9N B;  4WU9 B;  4EO5 B;  1P3F D;  3WTP D;  3B6G C;  5GSU C;  3LZ1 C;  1P3F B;  2CWE A;  3B0C W;  3NQJ A;  5C3I C;  3UTA A;  5B1M A;  3C1C A;  3UT9 A;  3MGR D;  5B40 B;  3MNN B;  2YFV B;  1M19 A;  3MGP C;  2HIO D;  3KWQ D;  3MGR B;  1P3K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...