1ID3C

Crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
110
structure length
110
Chain Sequence
QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PALINDROMIC 146BP DNA FRAGMENT
publication title Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 110
sequence length 110
chains with identical sequence G
ec nomenclature
pdb deposition date 2001-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1id3C00
4J8XB 4WU8D 4KUDB 4G91B 1P3PA 5BS7C 5B2JB 5AV6B 1U35D 1M1AB 4KGCD 5AV8D 4X23D 3AZID 3MGQD 3KUYA 5GXQC 5B0YD 3RELA 5AY8B 3UT9C 3AZNC 4H9QA 3AZKA 3LELD 5AV9B 3MVDC 5BNXB 3X1TB 3MGPB 5B2IA 3AV1C 3MGSB 1P3LA 2YFWA 4ZBJC 4G92C 3VH6A 3REJD 3KXBB 4AWLB 1S32D 4XZQC 2PYOD 2RVQC 4QLCC 2NZDD 4HGAC 2IO5C 1EQZC 3O62C 5B33A 5GXQD 2BYMA 4UUZA 5B0ZD 3X1UB 3AN2A 1BH9B 3AZND 4H9PA 2HIOD 3LZ1C 3W96C 5F99A 5B32A 5B1MA 4H9SC 5CHLB 5DNNB 5JRGC 4J8XC 3AZMA 3KWQB 2JSSA 2AROB 3MVDD 4KUDC 4G91C 5B2JC 4JJNA 5AV6C 1P3PB 4WU9D 4YS3B 4XUJA 3A6NA 2F8NK 4XZQD 1F1EA 4Z5TA 5AY8C 1P3AA 3KUYB 2RVQD 3RELB 3W98C 3WA9A 5JA4A 4H9QB 1EQZD 5AV9C 3AZKB 3X1TC 1P3MD 3AV2A 2F8ND 1P3OA 3VH5T 4LD9B 3LZ1D 3MGSC 3W96D 1Q9CA 3B0BA 5B2IB 5B31A 3REKD 3X1VD 3B6GC 4J8XD 1P3LB 2YFWB 1P3FD 1P34B 4EO5B 4E45A 5B2JD 3AZGA 3B0DC 5CPJD 4CAYB 3AZEA 3C1BA 5AY8D 3X1UC 5AVCC 5B33B 5GSUA 1M18A 5BNVB 5AVBA 3AYWD 2BYMB 4UUZB 3W98D 3AN2B 1P3BA 4H9PB 1KX3A 5DNNC 3KWQC 1ULYA 5F99B 5CPKD 2AROC 3X1TD 5B32B 4WV4B 1TZYD 5B1MB 4Z66D 3AZMB 3MGSD 2CV5A 1P3PC 4JJNB 1M1AA 1HQ3C 3B6GD 5E5AA 3AZFA 4XUJB 3A6NB 3KUYC 4J8VA 1H3OA 4NE3A 4ZUXC 2FJ7D 1TAFA 3WA9B 5JA4B 3AZKC 3X1UD 5AVCD 3LZ0A 3MGPA 4WZSB 3AV2B 1P3OB 5B2IC 3WTPB 5DNMA 3KXBA 2AROD 3R45A 5B31B 1P3KB 4EO5C 4WNNA 3B6FB 4DRAA 1HQ3D 3UTBA 3UTAA 3W99A 1ZLAA 3KUYD 1BH9A 5B33C 3AZEB 3MGRC 3AN2C 4YM6D 1M18B 5GSUB 3REIA 5AVBB 5CPID 1P3ID 3W97A 4ZUXD 4R8PA 1P3BB 5F99C 3AZKD 2NQBC 1F66C 5B32C 5B1MC 1KX3B 3AZMC 4NFTA 3WAAD 2BYKA 4JJNC 3TU4A 4YS3A 5C3IB 2CV5B 1HTAA 4XUJC 3A6NC 5B24A 5E5AB 3AFAA 1ID3A 3AZFB 5B1LD 4Z5TC 1P3AC 4J8VB 1P3GB 3WA9C 1H3OB 5KDMA 1TAFB 3X1SA 4LD9A 3MGRD 3AV2C 3AN2D 1P3OC 3LZ0B 5GT0A 2NQBD 1F66D 5B1MD 3AZJA 5DNMB 1P34A 3AZMD 2F8NG 3MNNA 3NQUB 3R45B 3AZGC 4WNNB 4CAYA 3VH6T 3A6ND 1AOIA 3AZEC 3C1BC 5BNVA 3UTBB 3UTAB 4Z5TD 3W99B 4NE6A 1P3AD 1ZLAB 1M18C 5AV5A 5GSUC 3REHB 3UT9D 1P3BC 3WA9D 4WU8A 3VH5W 3LJAC 3REIB 1KX3C 3W97B 4R8PB 1JFIA 1KU5A 3AV2D 4KGCA 5C3IC 3AV1D 2CV5C 2BYKB 3MGQA 1B6WA 1M1AC 3TU4B 5E5AC 3AZFC 5B24B 3AFAB 1ID3B 3AZGD 4QLCD 3WKJB 3LELA 3AZED 3C1BD 3O62D 4Z2MG 3AZLA 5KDMB 3X1SB 3LZ0C 3MGPC 3WTPA 1S32A 3LJAD 4DRBA 5DNMC 3NQJA 5JRGD 5GT0B 1P3KA 3KXBC 4AWLC 2PYOA 3AZJB 5B40A 4KUDD 2NZDA 3B6FA 3MNNB 5AV6D 2CV5D 1M1AD 5B0ZA 3VH5A 1KX5A 3AZNA 3UTAC 3W99C 2HIOA 1AOIB 1N1JA 1ZLAC 5AV5B 3REIC 3W97C 5AV9D 4WU8B 2F8NH 1JFIB 3MGPD 4WU9A 3TU4C 4YS3C 5CP6A 4X23B 4KGCB 3KXBD 3MGQB 5B24C 3AFAC 1ID3C 3RELC 1P3GA 3B0CT 1P3MA 3LELB 4J8WA 3W99D 2L5AA 3W96A 3X1SC 4LD9C 3AZLB 3REKA 3X1VA 4CSRA 1P3FA 3W97D 5GT0C 5DNND 1S32B 1P3LC 3KWQD 3AZJC 3NQUA 3NQJB 1P34C 2PYOB 3MNNC 5B40B 5CPJA 2NZDB 5BT1C 3TU4D 4YS3D 1P3PD 5B32G 5GXQB 3AYWA 1AOIC 4Z2MH 5B0ZB 1KX5B 1ID3D 3AZNB 3REHA 2HIOB 3RELD 1N1JB 5AV5C 5CPKA 1TZYA 4Z66A 4WU8C 3MVDB 4LD9D 3B6GA 4ZBJB 4G92B 4WU9B 4KGCC 5B2ID 3MGQC 1P3LD 3KSYA 3C1CA 4XZQB 5CP6B 1P34D 3VH6W 2FJ7A 3WKJA 5BT1D 1EQZB 5B31G 4J8UA 1AOID 1P3MB 5B33D 3AZLC 4J8WB 1M19A 3LZ1B 3AZHA 3W96B 5AV5D 3WTPC 3REKB 3X1VB 1S32C 4CSRB 5F99D 5GT3A 1P3FB 5B32D 4H9NA 5B31C 1P3KC 2PYOC 1HQ3A 3V9RA 5B40C 2NZDC 3B6FC 4JJND 5CPJB 4XUJD 5B0ZC 4YM6A 1KX5C 3AYWB 2HIOC 5CPIA 4ZUXA 1P3IA 3W98B 1KX4A 5AVBC 5CPKB 1TZYB 4Z66B 3WAAA 3AZLD 1U35A 1P3OD 4WU9C 3WTPD 5AV8A 4X23A 3B6GB 3AZIA 5CP6C 5B1LA 5B0YA 5B31D 2CWEA 1P3KD 3C1CB 5B40D 4J8VC 3B6FD 3B0DB 2FJ7B 1P3GC 3MGRA 1P3MC 1KX5D 5AVCB 4J8UB 4J8WC 2NQBA 1M18D 5GSUD 1B67A 1M19B 5AVBD 1F66A 2HUEB 3REJA 3X1VC 3REKC 3AZHB 1P3BD 1P3FC 5FUGA 1KX3D 5GT3B 5BS7A 4H9NB 4H9RA 1HQ3B 3V9RB 1A7WA 5CPJC 5CP6D 5GXQA 1BH8A 5BO0A 5E5AD 3B0CW 3AYWC 3UT9A 3UTBC 3AZFD 4YM6B 4J8VD 3REHC 5CPIB 1P3IB 4ZUXB 1P3GD 4M6BA 5CPKC 1KX4B 3MVDA 1TZYC 4Z66C 4R8PC 4H9OA 4J8WD 4KHAA 3AV1A 3WAAB 3LZ0D 2YFVA 1U35B 4NE5A 5AV8B 4XZQA 5DNMD 3AZIB 5G49A 3C1CC 5B1LB 5B0YB 4QLCA 2FJ7C 1EQZA 3WKJC 3O62A 2LY8A 2F8NA 4J8UC 3UTBD 3MGRB 3UTAD 3LZ1A 1ZLAD 3LJAA 3REHD 1M19C 2HUEC 4H9SA 5JRGA 3AZHC 4J8XA 2NQBB 1F66B 3REID 3REJB 4KUDA 4R8PD 5GT3C 5B2JA 5FUGB 5AV6A 4H9RB 1R4VA 5AY8A 3C1CD 4Z5TB 5B24D 1BH8B 5BO0B 4YM6C 3AFAD 1P3AB 3W98A 3UT9B 5CPIC 1P3IC 3WKJD 5AV9A 1KX4C 5BNXA 3X1TA 4J8UD 1WWIA 3WAAC 3MGSA 3X1SD 4H9OB 1M19D 4KHAB 3AV1B 3AZHD 1U35C 5AV8C 4X23C 2YFVB 3AZIC 5GT0D 5GT3D 3WTPE 5B1LC 5B0YC 3AZJD 5G49B 1BFMA 3AZGB 3MNND 1WWSA 4QLCB 4HGAB 2IO5B 3X1UA 3C1BB 5AVCA 3O62B 3LELC 4E44A 2F8NB 5DNNA 3KWQA 1KX4D 3LJAB 2AROA 3REJC 5JRGB
chains in the Genus database with same CATH superfamily
4J8XB 4WU8D 3A1KA 4KUDB 3H0MC 4G91B 1P3PA 5BS7C 5B2JB 5AV6B 2Y2MA 1U35D 1M1AB 4KGCD 5AV8D 4X23D 3AZID 3MGQD 3KUYA 5GXQC 5B0YD 3RELA 5AY8B 3UT9C 3AZNC 4H9QA 3AZKA 3LELD 5AV9B 3MVDC 5BNXB 3X1TB 2ZY3A 3EPHA 3MGPB 5B2IA 3AV1C 3MGSB 1P3LA 2YFWA 1W2EA 4ZBJC 4G92C 3VH6A 3REJD 3KXBB 4AWLB 1S32D 4XZQC 3F6TA 2PYOD 2RVQC 2XD5A 4QLCC 2NZDD 4HGAC 2IO5C 1EQZC 3O62C 5B33A 5GXQD 2BYMA 4UUZA 5B0ZD 3X1UB 3AN2A 1BH9B 3AZND 4H9PA 2HIOD 3LZ1C 3W96C 5F99A 5B32A 5B1MA 4H9SC 5CHLB 5DNNB 5JRGC 4J8XC 3AZMA 3KWQB 2JSSA 2AROB 3MVDD 4KUDC 4G91C 2RIQA 5B2JC 4JJNA 5AV6C 1P3PB 4WU9D 4YS3B 4XUJA 3A6NA 2F8NK 4XZQD 1F1EA 4Z5TA 5AY8C 1P3AA 3KUYB 2RVQD 3H0RC 3RELB 3W98C 3WA9A 5JA4A 4H9QB 1EQZD 5AV9C 3AZKB 3X1TC 1P3MD 3AV2A 2F8ND 1P3OA 3VH5T 4LD9B 3LZ1D 3MGSC 3W96D 5B2IB 1Q9CA 3B0BA 2ZY2A 5B31A 3REKD 3X1VD 4J8XD 1P3LB 2YFWB 3B6GC 1P3FD 1P34B 2Y2OA 4E45A 4EO5B 5B2JD 3AZGA 3B0DC 5CPJD 4CAYB 3AZEA 3C1BA 5AY8D 3X1UC 5AVCC 5B33B 5GSUA 1M18A 5BNVB 5AVBA 3AYWD 2Y2GA 2BYMB 4UUZB 3W98D 3AN2B 1P3BA 4H9PB 1KX3A 5DNNC 3KWQC 1ULYA 5F99B 5CPKD 2AROC 3X1TD 5B32B 4WV4B 1TZYD 5B1MB 4Z66D 3AZMB 2UWXA 3MGSD 2CV5A 1P3PC 4JJNB 1M1AA 1HQ3C 3B6GD 2Y2JA 5E5AA 3AZFA 4XUJB 3A6NB 2XD1A 3KUYC 4J8VA 1H3OA 4NE3A 4ZUXC 2FJ7D 1TAFA 3WA9B 5JA4B 3AZKC 3X1UD 5AVCD 3LZ0A 3MGPA 4WZSB 3AV2B 1P3OB 5B2IC 3WTPB 5DNMA 3KXBA 2AROD 3R45A 5B31B 2F2AC 1P3KB 4EO5C 4WNNA 3B6FB 3EPJA 4DRAA 1HQ3D 3UTBA 3UTAA 3W99A 1ZLAA 3KUYD 1BH9A 5B33C 3AZEB 3MGRC 3AN2C 4YM6D 1M18B 5GSUB 3REIA 5AVBB 5CPID 1P3ID 2Y2HA 3W97A 4ZUXD 4R8PA 1P3BB 5F99C 3AZKD 2NQBC 1F66C 5B32C 5B1MC 1KX3B 3AZMC 4NFTA 3WAAD 2BYKA 4JJNC 3TU4A 4YS3A 5C3IB 2CV5B 1HTAA 2Y2LA 4XUJC 3A6NC 5B24A 5E5AB 3AFAA 1ID3A 3AZFB 5B1LD 4Z5TC 1P3AC 4J8VB 1P3GB 3WA9C 1H3OB 2JCHA 5KDMA 1TAFB 3X1SA 4LD9A 3MGRD 3AV2C 3AN2D 1P3OC 3LZ0B 5GT0A 2NQBD 1F66D 5B1MD 3AZJA 5DNMB 1P34A 3AZMD 2F8NG 1PZRA 3MNNA 3NQUB 3R45B 3AZGC 4WNNB 4CAYA 1T3UA 3VH6T 3A6ND 1AOIA 3AZEC 3C1BC 5BNVA 3UTBB 3UTAB 4Z5TD 3W99B 4NE6A 1P3AD 4DQYB 1ZLAB 1M18C 5AV5A 5GSUC 3REHB 2FFFB 3UT9D 1P3BC 3WA9D 4WU8A 3VH5W 3LJAC 3REIB 1KX3C 3W97B 4R8PB 1JFIA 1KU5A 1Z2CB 3AV2D 2Y2IA 4KGCA 5C3IC 3AV1D 2CV5C 2BYKB 3MGQA 1B6WA 1M1AC 3TU4B 2ZY5A 5E5AC 3AZFC 5B24B 3AFAB 1ID3B 3AZGD 4QLCD 3WKJB 3LELA 3AZED 4UPKA 3O62D 3C1BD 4Z2MG 3AZLA 5KDMB 3X1SB 3LZ0C 3MGPC 3WTPA 2Y2PA 1S32A 3LJAD 4DRBA 5DNMC 3NQJA 5JRGD 5GT0B 1P3KA 3KXBC 4AWLC 2PYOA 3KFUG 3AZJB 5B40A 4KUDD 2NZDA 3B6FA 3MNNB 5AV6D 2CV5D 1M1AD 5B0ZA 3VH5A 1KX5A 3AZNA 3UTAC 3W99C 2HIOA 1AOIB 1N1JA 1ZLAC 2DF4C 5AV5B 3REIC 3W97C 5AV9D 4WU8B 2F8NH 1JFIB 3MGPD 2G5IC 4WU9A 3TU4C 4YS3C 5CP6A 4X23B 4KGCB 3KXBD 3MGQB 5B24C 3AFAC 1ID3C 3RELC 1P3GA 3B0CT 1P3MA 3LELB 4J8WA 3W99D 2L5AA 2Y2NA 3W96A 3X1SC 4LD9C 3AZLB 3REKA 3X1VA 4CSRA 3A1IA 1P3FA 3W97D 5GT0C 5DNND 1S32B 1P3LC 3KWQD 2W8SA 3AZJC 3NQUA 3NQJB 1P34C 2PYOB 3MNNC 5B40B 5CPJA 2NZDB 5BT1C 3TU4D 4YS3D 1P3PD 5B32G 5GXQB 3AYWA 1AOIC 4Z2MH 5B0ZB 1KX5B 1ID3D 3P5JB 3REHA 3AZNB 2HIOB 3RELD 1N1JB 5AV5C 5CPKA 1TZYA 4Z66A 4WU8C 3MVDB 4LD9D 3B6GA 4ZBJB 4G92B 4WU9B 4KGCC 5B2ID 3MGQC 1P3LD 3KSYA 3C1CA 4XZQB 2G5HC 5CP6B 1P34D 3VH6W 2FJ7A 3WKJA 5BT1D 3EG5B 2Y2QA 1EQZB 5B31G 4J8UA 1AOID 1P3MB 2BG1A 5B33D 2ZY4A 3AZLC 4J8WB 1M19A 3LZ1B 3EPLA 3AZHA 3W96B 5AV5D 3WTPC 3REKB 3X1VB 1S32C 4CSRB 5F99D 5GT3A 1P3FB 5B32D 4H9NA 5B31C 1P3KC 2PYOC 1HQ3A 3V9RA 5B40C 2NZDC 3B6FC 4JJND 5CPJB 2ZM5A 4XUJD 5B0ZC 4YM6A 1KX5C 3AYWB 2HIOC 5CPIA 4ZUXA 1P3IA 3W98B 1KX4A 5AVBC 5CPKB 1TZYB 4Z66B 3WAAA 3AZLD 1U35A 1P3OD 4WU9C 3WTPD 5AV8A 4X23A 3B6GB 2J8PA 3AZIA 5CP6C 5B1LA 5B0YA 1F66A 5B31D 2CWEA 1P3KD 3C1CB 3AL0C 5B40D 4J8VC 3B6FD 3B0DB 2FJ7B 1P3GC 3MGRA 1P3MC 1KX5D 5AVCB 4J8UB 4J8WC 2NQBA 3H0LC 5GSUD 1B67A 1M19B 5AVBD 1M18D 2HUEB 3REJA 3X1VC 3REKC 3AZHB 1P3BD 1P3FC 5FUGA 1KX3D 5GT3B 5BS7A 4H9NB 4H9RA 1HQ3B 3V9RB 1A7WA 5CPJC 5CP6D 5GXQA 1BH8A 5BO0A 5E5AD 3B0CW 3AYWC 3UT9A 3UTBC 3AZFD 4YM6B 4J8VD 3REHC 5CPIB 1P3IB 4ZUXB 1P3GD 4M6BA 5CPKC 3EPKA 1KX4B 3MVDA 1TZYC 4Z66C 2DQNC 4R8PC 4H9OA 4J8WD 4KHAA 3AV1A 3WAAB 3LZ0D 2YFVA 1U35B 4NE5A 5AV8B 4XZQA 5DNMD 3AZIB 5G49A 3C1CC 5B1LB 5B0YB 4QLCA 2FJ7C 1EQZA 3WKJC 3O62A 2LY8A 3FDDA 2F8NA 4J8UC 3UTBD 3MGRB 3UTAD 3LZ1A 1ZLAD 3LJAA 3REHD 1M19C 2HUEC 4H9SA 5JRGA 3AZHC 4J8XA 2NQBB 1F66B 3REID 3REJB 4KUDA 4R8PD 5GT3C 2Y2KA 5B2JA 5FUGB 5AV6A 4H9RB 3IP4C 1R4VA 5AY8A 2VQRA 3C1CD 4Z5TB 5B24D 1BH8B 5BO0B 4YM6C 3AFAD 1P3AB 3W98A 3UT9B 5CPIC 1P3IC 3WKJD 5AV9A 1KX4C 5BNXA 3X1TA 4J8UD 1WWIA 3WAAC 3MGSA 3X1SD 4H9OB 1M19D 4KHAB 3AV1B 3AZHD 1U35C 5AV8C 4X23C 2YFVB 3AZIC 5GT0D 5GT3D 3WTPE 5B1LC 5B0YC 3AZJD 5G49B 1BFMA 3AZGB 3MNND 1WWSA 4QLCB 4HGAB 2IO5B 3X1UA 3C1BB 5AVCA 3O62B 3LELC 4WJ3C 4E44A 2F8NB 2JE5A 5DNNA 3KWQA 1KX4D 3LJAB 2AROA 3REJC 5JRGB
chains in the Genus database with same CATH topology
4J8XB 4WU8D 3A1KA 4KUDB 3H0MC 4G91B 1P3PA 5BS7C 5B2JB 5AV6B 2Y2MA 1U35D 1M1AB 4KGCD 5AV8D 4X23D 3AZID 3MGQD 3KUYA 5GXQC 5B0YD 3RELA 5AY8B 3UT9C 3AZNC 4H9QA 3AZKA 3LELD 5AV9B 3MVDC 5BNXB 3X1TB 2ZY3A 3EPHA 3MGPB 5B2IA 3AV1C 3MGSB 1P3LA 2YFWA 1W2EA 4ZBJC 4G92C 3VH6A 3REJD 3KXBB 4AWLB 1S32D 4XZQC 3F6TA 2PYOD 2RVQC 2XD5A 4QLCC 2NZDD 4HGAC 2IO5C 1EQZC 3O62C 5B33A 5GXQD 2BYMA 4UUZA 5B0ZD 3X1UB 3AN2A 1BH9B 3AZND 4H9PA 2HIOD 3LZ1C 3W96C 5F99A 5B32A 5B1MA 4H9SC 5CHLB 5DNNB 5JRGC 4J8XC 3AZMA 3KWQB 2JSSA 2AROB 3MVDD 4KUDC 4G91C 2RIQA 5B2JC 4JJNA 5AV6C 1P3PB 4WU9D 4YS3B 4XUJA 3A6NA 2F8NK 4XZQD 1F1EA 4Z5TA 5AY8C 1P3AA 3KUYB 2RVQD 3H0RC 3RELB 3W98C 3WA9A 5JA4A 4H9QB 1EQZD 5AV9C 3AZKB 3X1TC 1P3MD 3AV2A 2F8ND 1P3OA 3VH5T 4LD9B 3LZ1D 3MGSC 3W96D 5B2IB 1Q9CA 3B0BA 2ZY2A 5B31A 3REKD 3X1VD 4J8XD 1P3LB 2YFWB 3B6GC 1P3FD 1P34B 2Y2OA 4E45A 4EO5B 5B2JD 3AZGA 3B0DC 5CPJD 4CAYB 3AZEA 3C1BA 5AY8D 3X1UC 5AVCC 5B33B 5GSUA 1M18A 5BNVB 5AVBA 3AYWD 2Y2GA 2BYMB 4UUZB 3W98D 3AN2B 1P3BA 4H9PB 1KX3A 5DNNC 3KWQC 1ULYA 5F99B 5CPKD 2AROC 3X1TD 5B32B 4WV4B 1TZYD 5B1MB 4Z66D 3AZMB 2UWXA 3MGSD 2CV5A 1P3PC 4JJNB 1M1AA 1HQ3C 3B6GD 2Y2JA 5E5AA 3AZFA 4XUJB 3A6NB 2XD1A 3KUYC 4J8VA 1H3OA 4NE3A 4ZUXC 2FJ7D 1TAFA 3WA9B 5JA4B 3AZKC 3X1UD 5AVCD 3LZ0A 3MGPA 4WZSB 3AV2B 1P3OB 5B2IC 3WTPB 5DNMA 3KXBA 2AROD 3R45A 5B31B 2F2AC 1P3KB 4EO5C 4WNNA 3B6FB 3EPJA 4DRAA 1HQ3D 3UTBA 3UTAA 3W99A 1ZLAA 3KUYD 1BH9A 5B33C 3AZEB 3MGRC 3AN2C 4YM6D 1M18B 5GSUB 3REIA 5AVBB 5CPID 1P3ID 2Y2HA 3W97A 4ZUXD 4R8PA 1P3BB 5F99C 3AZKD 2NQBC 1F66C 5B32C 5B1MC 1KX3B 3AZMC 4NFTA 3WAAD 2BYKA 4JJNC 3TU4A 4YS3A 5C3IB 2CV5B 1HTAA 2Y2LA 4XUJC 3A6NC 5B24A 5E5AB 3AFAA 1ID3A 3AZFB 5B1LD 4Z5TC 1P3AC 4J8VB 1P3GB 3WA9C 1H3OB 2JCHA 5KDMA 1TAFB 3X1SA 4LD9A 3MGRD 3AV2C 3AN2D 1P3OC 3LZ0B 5GT0A 2NQBD 1F66D 5B1MD 3AZJA 5DNMB 1P34A 3AZMD 2F8NG 1PZRA 3MNNA 3NQUB 3R45B 3AZGC 4WNNB 4CAYA 1T3UA 3VH6T 3A6ND 1AOIA 3AZEC 3C1BC 5BNVA 3UTBB 3UTAB 4Z5TD 3W99B 4NE6A 1P3AD 4DQYB 1ZLAB 1M18C 5AV5A 5GSUC 3REHB 2FFFB 3UT9D 1P3BC 3WA9D 4WU8A 3VH5W 3LJAC 3REIB 1KX3C 3W97B 4R8PB 1JFIA 1KU5A 1Z2CB 3AV2D 2Y2IA 4KGCA 5C3IC 3AV1D 2CV5C 2BYKB 3MGQA 1B6WA 1M1AC 3TU4B 2ZY5A 5E5AC 3AZFC 5B24B 3AFAB 1ID3B 3AZGD 4QLCD 3WKJB 3LELA 3AZED 4UPKA 3O62D 3C1BD 4Z2MG 3AZLA 5KDMB 3X1SB 3LZ0C 3MGPC 3WTPA 2Y2PA 1S32A 3LJAD 4DRBA 5DNMC 3NQJA 5JRGD 5GT0B 1P3KA 3KXBC 4AWLC 2PYOA 3KFUG 3AZJB 5B40A 4KUDD 2NZDA 3B6FA 3MNNB 5AV6D 2CV5D 1M1AD 5B0ZA 3VH5A 1KX5A 3AZNA 3UTAC 3W99C 2HIOA 1AOIB 1N1JA 1ZLAC 2DF4C 5AV5B 3REIC 3W97C 5AV9D 4WU8B 2F8NH 1JFIB 3MGPD 2G5IC 4WU9A 3TU4C 4YS3C 5CP6A 4X23B 4KGCB 3KXBD 3MGQB 5B24C 3AFAC 1ID3C 3RELC 1P3GA 3B0CT 1P3MA 3LELB 4J8WA 3W99D 2L5AA 2Y2NA 3W96A 3X1SC 4LD9C 3AZLB 3REKA 3X1VA 4CSRA 3A1IA 1P3FA 3W97D 5GT0C 5DNND 1S32B 1P3LC 3KWQD 2W8SA 3AZJC 3NQUA 3NQJB 1P34C 2PYOB 3MNNC 5B40B 5CPJA 2NZDB 5BT1C 3TU4D 4YS3D 1P3PD 5B32G 5GXQB 3AYWA 1AOIC 4Z2MH 5B0ZB 1KX5B 1ID3D 3P5JB 3REHA 3AZNB 2HIOB 3RELD 1N1JB 5AV5C 5CPKA 1TZYA 4Z66A 4WU8C 3MVDB 4LD9D 3B6GA 4ZBJB 4G92B 4WU9B 4KGCC 5B2ID 3MGQC 1P3LD 3KSYA 3C1CA 4XZQB 2G5HC 5CP6B 1P34D 3VH6W 2FJ7A 3WKJA 5BT1D 3EG5B 2Y2QA 1EQZB 5B31G 4J8UA 1AOID 1P3MB 2BG1A 5B33D 2ZY4A 3AZLC 4J8WB 1M19A 3LZ1B 3EPLA 3AZHA 3W96B 5AV5D 3WTPC 3REKB 3X1VB 1S32C 4CSRB 5F99D 5GT3A 1P3FB 5B32D 4H9NA 5B31C 1P3KC 2PYOC 1HQ3A 3V9RA 5B40C 2NZDC 3B6FC 4JJND 5CPJB 2ZM5A 4XUJD 5B0ZC 4YM6A 1KX5C 3AYWB 2HIOC 5CPIA 4ZUXA 1P3IA 3W98B 1KX4A 5AVBC 5CPKB 1TZYB 4Z66B 3WAAA 3AZLD 1U35A 1P3OD 4WU9C 3WTPD 5AV8A 4X23A 3B6GB 2J8PA 3AZIA 5CP6C 5B1LA 5B0YA 1F66A 5B31D 2CWEA 1P3KD 3C1CB 3AL0C 5B40D 4J8VC 3B6FD 3B0DB 2FJ7B 1P3GC 3MGRA 1P3MC 1KX5D 5AVCB 4J8UB 4J8WC 2NQBA 3H0LC 5GSUD 1B67A 1M19B 5AVBD 1M18D 2HUEB 3REJA 3X1VC 3REKC 3AZHB 1P3BD 1P3FC 5FUGA 1KX3D 5GT3B 5BS7A 4H9NB 4H9RA 1HQ3B 3V9RB 1A7WA 5CPJC 5CP6D 5GXQA 1BH8A 5BO0A 5E5AD 3B0CW 3AYWC 3UT9A 3UTBC 3AZFD 4YM6B 4J8VD 3REHC 5CPIB 1P3IB 4ZUXB 1P3GD 4M6BA 5CPKC 3EPKA 1KX4B 3MVDA 1TZYC 4Z66C 2DQNC 4R8PC 4H9OA 4J8WD 4KHAA 3AV1A 3WAAB 3LZ0D 2YFVA 1U35B 4NE5A 5AV8B 4XZQA 5DNMD 3AZIB 5G49A 3C1CC 5B1LB 5B0YB 4QLCA 2FJ7C 1EQZA 3WKJC 3O62A 2LY8A 3FDDA 2F8NA 4J8UC 3UTBD 3MGRB 3UTAD 3LZ1A 1ZLAD 3LJAA 3REHD 1M19C 2HUEC 4H9SA 5JRGA 3AZHC 4J8XA 2NQBB 1F66B 3REID 3REJB 4KUDA 4R8PD 5GT3C 2Y2KA 5B2JA 5FUGB 5AV6A 4H9RB 3IP4C 1R4VA 5AY8A 2VQRA 3C1CD 4Z5TB 5B24D 1BH8B 5BO0B 4YM6C 3AFAD 1P3AB 3W98A 3UT9B 5CPIC 1P3IC 3WKJD 5AV9A 1KX4C 5BNXA 3X1TA 4J8UD 1WWIA 3WAAC 3MGSA 3X1SD 4H9OB 1M19D 4KHAB 3AV1B 3AZHD 1U35C 5AV8C 4X23C 2YFVB 3AZIC 5GT0D 5GT3D 3WTPE 5B1LC 5B0YC 3AZJD 5G49B 1BFMA 3AZGB 3MNND 1WWSA 4QLCB 4HGAB 2IO5B 3X1UA 3C1BB 5AVCA 3O62B 3LELC 4WJ3C 4E44A 2F8NB 2JE5A 5DNNA 3KWQA 1KX4D 3LJAB 2AROA 3REJC 5JRGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8X B;  4WU8 D;  4KUD B;  4G91 B;  1P3P A;  5BS7 C;  5B2J B;  5AV6 B;  1U35 D;  1M1A B;  4KGC D;  5AV8 D;  4X23 D;  3AZI D;  3MGQ D;  3KUY A;  5GXQ C;  5B0Y D;  3REL A;  5AY8 B;  3UT9 C;  3AZN C;  4H9Q A;  3AZK A;  3LEL D;  5AV9 B;  3MVD C;  5BNX B;  3X1T B;  3MGP B;  5B2I A;  3AV1 C;  3MGS B;  1P3L A;  2YFW A;  4ZBJ C;  4G92 C;  3VH6 A;  3REJ D;  3KXB B;  4AWL B;  1S32 D;  4XZQ C;  2PYO D;  2RVQ C;  4QLC C;  2NZD D;  4HGA C;  2IO5 C;  1EQZ C;  3O62 C;  5B33 A;  5GXQ D;  2BYM A;  4UUZ A;  5B0Z D;  3X1U B;  3AN2 A;  1BH9 B;  3AZN D;  4H9P A;  2HIO D;  3LZ1 C;  3W96 C;  5F99 A;  5B32 A;  5B1M A;  4H9S C;  5CHL B;  5DNN B;  5JRG C;  4J8X C;  3AZM A;  3KWQ B;  2JSS A;  2ARO B;  3MVD D;  4KUD C;  4G91 C;  5B2J C;  4JJN A;  5AV6 C;  1P3P B;  4WU9 D;  4YS3 B;  4XUJ A;  3A6N A;  2F8N K;  4XZQ D;  1F1E A;  4Z5T A;  5AY8 C;  1P3A A;  3KUY B;  2RVQ D;  3REL B;  3W98 C;  3WA9 A;  5JA4 A;  4H9Q B;  1EQZ D;  5AV9 C;  3AZK B;  3X1T C;  1P3M D;  3AV2 A;  2F8N D;  1P3O A;  3VH5 T;  4LD9 B;  3LZ1 D;  3MGS C;  3W96 D;  1Q9C A;  3B0B A;  5B2I B;  5B31 A;  3REK D;  3X1V D;  3B6G C;  4J8X D;  1P3L B;  2YFW B;  1P3F D;  1P34 B;  4EO5 B;  4E45 A;  5B2J D;  3AZG A;  3B0D C;  5CPJ D;  4CAY B;  3AZE A;  3C1B A;  5AY8 D;  3X1U C;  5AVC C;  5B33 B;  5GSU A;  1M18 A;  5BNV B;  5AVB A;  3AYW D;  2BYM B;  4UUZ B;  3W98 D;  3AN2 B;  1P3B A;  4H9P B;  1KX3 A;  5DNN C;  3KWQ C;  1ULY A;  5F99 B;  5CPK D;  2ARO C;  3X1T D;  5B32 B;  4WV4 B;  1TZY D;  5B1M B;  4Z66 D;  3AZM B;  3MGS D;  2CV5 A;  1P3P C;  4JJN B;  1M1A A;  1HQ3 C;  3B6G D;  5E5A A;  3AZF A;  4XUJ B;  3A6N B;  3KUY C;  4J8V A;  1H3O A;  4NE3 A;  4ZUX C;  2FJ7 D;  1TAF A;  3WA9 B;  5JA4 B;  3AZK C;  3X1U D;  5AVC D;  3LZ0 A;  3MGP A;  4WZS B;  3AV2 B;  1P3O B;  5B2I C;  3WTP B;  5DNM A;  3KXB A;  2ARO D;  3R45 A;  5B31 B;  1P3K B;  4EO5 C;  4WNN A;  3B6F B;  4DRA A;  1HQ3 D;  3UTB A;  3UTA A;  3W99 A;  1ZLA A;  3KUY D;  1BH9 A;  5B33 C;  3AZE B;  3MGR C;  3AN2 C;  4YM6 D;  1M18 B;  5GSU B;  3REI A;  5AVB B;  5CPI D;  1P3I D;  3W97 A;  4ZUX D;  4R8P A;  1P3B B;  5F99 C;  3AZK D;  2NQB C;  1F66 C;  5B32 C;  5B1M C;  1KX3 B;  3AZM C;  4NFT A;  3WAA D;  2BYK A;  4JJN C;  3TU4 A;  4YS3 A;  5C3I B;  2CV5 B;  1HTA A;  4XUJ C;  3A6N C;  5B24 A;  5E5A B;  3AFA A;  1ID3 A;  3AZF B;  5B1L D;  4Z5T C;  1P3A C;  4J8V B;  1P3G B;  3WA9 C;  1H3O B;  5KDM A;  1TAF B;  3X1S A;  4LD9 A;  3MGR D;  3AV2 C;  3AN2 D;  1P3O C;  3LZ0 B;  5GT0 A;  2NQB D;  1F66 D;  5B1M D;  3AZJ A;  5DNM B;  1P34 A;  3AZM D;  2F8N G;  3MNN A;  3NQU B;  3R45 B;  3AZG C;  4WNN B;  4CAY A;  3VH6 T;  3A6N D;  1AOI A;  3AZE C;  3C1B C;  5BNV A;  3UTB B;  3UTA B;  4Z5T D;  3W99 B;  4NE6 A;  1P3A D;  1ZLA B;  1M18 C;  5AV5 A;  5GSU C;  3REH B;  3UT9 D;  1P3B C;  3WA9 D;  4WU8 A;  3VH5 W;  3LJA C;  3REI B;  1KX3 C;  3W97 B;  4R8P B;  1JFI A;  1KU5 A;  3AV2 D;  4KGC A;  5C3I C;  3AV1 D;  2CV5 C;  2BYK B;  3MGQ A;  1B6W A;  1M1A C;  3TU4 B;  5E5A C;  3AZF C;  5B24 B;  3AFA B;  1ID3 B;  3AZG D;  4QLC D;  3WKJ B;  3LEL A;  3AZE D;  3C1B D;  3O62 D;  4Z2M G;  3AZL A;  5KDM B;  3X1S B;  3LZ0 C;  3MGP C;  3WTP A;  1S32 A;  3LJA D;  4DRB A;  5DNM C;  3NQJ A;  5JRG D;  5GT0 B;  1P3K A;  3KXB C;  4AWL C;  2PYO A;  3AZJ B;  5B40 A;  4KUD D;  2NZD A;  3B6F A;  3MNN B;  5AV6 D;  2CV5 D;  1M1A D;  5B0Z A;  3VH5 A;  1KX5 A;  3AZN A;  3UTA C;  3W99 C;  2HIO A;  1AOI B;  1N1J A;  1ZLA C;  5AV5 B;  3REI C;  3W97 C;  5AV9 D;  4WU8 B;  2F8N H;  1JFI B;  3MGP D;  4WU9 A;  3TU4 C;  4YS3 C;  5CP6 A;  4X23 B;  4KGC B;  3KXB D;  3MGQ B;  5B24 C;  3AFA C;  1ID3 C;  3REL C;  1P3G A;  3B0C T;  1P3M A;  3LEL B;  4J8W A;  3W99 D;  2L5A A;  3W96 A;  3X1S C;  4LD9 C;  3AZL B;  3REK A;  3X1V A;  4CSR A;  1P3F A;  3W97 D;  5GT0 C;  5DNN D;  1S32 B;  1P3L C;  3KWQ D;  3AZJ C;  3NQU A;  3NQJ B;  1P34 C;  2PYO B;  3MNN C;  5B40 B;  5CPJ A;  2NZD B;  5BT1 C;  3TU4 D;  4YS3 D;  1P3P D;  5B32 G;  5GXQ B;  3AYW A;  1AOI C;  4Z2M H;  5B0Z B;  1KX5 B;  1ID3 D;  3AZN B;  3REH A;  2HIO B;  3REL D;  1N1J B;  5AV5 C;  5CPK A;  1TZY A;  4Z66 A;  4WU8 C;  3MVD B;  4LD9 D;  3B6G A;  4ZBJ B;  4G92 B;  4WU9 B;  4KGC C;  5B2I D;  3MGQ C;  1P3L D;  3KSY A;  3C1C A;  4XZQ B;  5CP6 B;  1P34 D;  3VH6 W;  2FJ7 A;  3WKJ A;  5BT1 D;  1EQZ B;  5B31 G;  4J8U A;  1AOI D;  1P3M B;  5B33 D;  3AZL C;  4J8W B;  1M19 A;  3LZ1 B;  3AZH A;  3W96 B;  5AV5 D;  3WTP C;  3REK B;  3X1V B;  1S32 C;  4CSR B;  5F99 D;  5GT3 A;  1P3F B;  5B32 D;  4H9N A;  5B31 C;  1P3K C;  2PYO C;  1HQ3 A;  3V9R A;  5B40 C;  2NZD C;  3B6F C;  4JJN D;  5CPJ B;  4XUJ D;  5B0Z C;  4YM6 A;  1KX5 C;  3AYW B;  2HIO C;  5CPI A;  4ZUX A;  1P3I A;  3W98 B;  1KX4 A;  5AVB C;  5CPK B;  1TZY B;  4Z66 B;  3WAA A;  3AZL D;  1U35 A;  1P3O D;  4WU9 C;  3WTP D;  5AV8 A;  4X23 A;  3B6G B;  3AZI A;  5CP6 C;  5B1L A;  5B0Y A;  5B31 D;  2CWE A;  1P3K D;  3C1C B;  5B40 D;  4J8V C;  3B6F D;  3B0D B;  2FJ7 B;  1P3G C;  3MGR A;  1P3M C;  1KX5 D;  5AVC B;  4J8U B;  4J8W C;  2NQB A;  1M18 D;  5GSU D;  1B67 A;  1M19 B;  5AVB D;  1F66 A;  2HUE B;  3REJ A;  3X1V C;  3REK C;  3AZH B;  1P3B D;  1P3F C;  5FUG A;  1KX3 D;  5GT3 B;  5BS7 A;  4H9N B;  4H9R A;  1HQ3 B;  3V9R B;  1A7W A;  5CPJ C;  5CP6 D;  5GXQ A;  1BH8 A;  5BO0 A;  5E5A D;  3B0C W;  3AYW C;  3UT9 A;  3UTB C;  3AZF D;  4YM6 B;  4J8V D;  3REH C;  5CPI B;  1P3I B;  4ZUX B;  1P3G D;  4M6B A;  5CPK C;  1KX4 B;  3MVD A;  1TZY C;  4Z66 C;  4R8P C;  4H9O A;  4J8W D;  4KHA A;  3AV1 A;  3WAA B;  3LZ0 D;  2YFV A;  1U35 B;  4NE5 A;  5AV8 B;  4XZQ A;  5DNM D;  3AZI B;  5G49 A;  3C1C C;  5B1L B;  5B0Y B;  4QLC A;  2FJ7 C;  1EQZ A;  3WKJ C;  3O62 A;  2LY8 A;  2F8N A;  4J8U C;  3UTB D;  3MGR B;  3UTA D;  3LZ1 A;  1ZLA D;  3LJA A;  3REH D;  1M19 C;  2HUE C;  4H9S A;  5JRG A;  3AZH C;  4J8X A;  2NQB B;  1F66 B;  3REI D;  3REJ B;  4KUD A;  4R8P D;  5GT3 C;  5B2J A;  5FUG B;  5AV6 A;  4H9R B;  1R4V A;  5AY8 A;  3C1C D;  4Z5T B;  5B24 D;  1BH8 B;  5BO0 B;  4YM6 C;  3AFA D;  1P3A B;  3W98 A;  3UT9 B;  5CPI C;  1P3I C;  3WKJ D;  5AV9 A;  1KX4 C;  5BNX A;  3X1T A;  4J8U D;  1WWI A;  3WAA C;  3MGS A;  3X1S D;  4H9O B;  1M19 D;  4KHA B;  3AV1 B;  3AZH D;  1U35 C;  5AV8 C;  4X23 C;  2YFV B;  3AZI C;  5GT0 D;  5GT3 D;  3WTP E;  5B1L C;  5B0Y C;  3AZJ D;  5G49 B;  1BFM A;  3AZG B;  3MNN D;  1WWS A;  4QLC B;  4HGA B;  2IO5 B;  3X1U A;  3C1B B;  5AVC A;  3O62 B;  3LEL C;  4E44 A;  2F8N B;  5DNN A;  3KWQ A;  1KX4 D;  3LJA B;  2ARO A;  3REJ C;  5JRG B; 
#chains in the Genus database with same CATH topology
 4J8X B;  4WU8 D;  3A1K A;  4KUD B;  3H0M C;  4G91 B;  1P3P A;  5BS7 C;  5B2J B;  5AV6 B;  2Y2M A;  1U35 D;  1M1A B;  4KGC D;  5AV8 D;  4X23 D;  3AZI D;  3MGQ D;  3KUY A;  5GXQ C;  5B0Y D;  3REL A;  5AY8 B;  3UT9 C;  3AZN C;  4H9Q A;  3AZK A;  3LEL D;  5AV9 B;  3MVD C;  5BNX B;  3X1T B;  2ZY3 A;  3EPH A;  3MGP B;  5B2I A;  3AV1 C;  3MGS B;  1P3L A;  2YFW A;  1W2E A;  4ZBJ C;  4G92 C;  3VH6 A;  3REJ D;  3KXB B;  4AWL B;  1S32 D;  4XZQ C;  3F6T A;  2PYO D;  2RVQ C;  2XD5 A;  4QLC C;  2NZD D;  4HGA C;  2IO5 C;  1EQZ C;  3O62 C;  5B33 A;  5GXQ D;  2BYM A;  4UUZ A;  5B0Z D;  3X1U B;  3AN2 A;  1BH9 B;  3AZN D;  4H9P A;  2HIO D;  3LZ1 C;  3W96 C;  5F99 A;  5B32 A;  5B1M A;  4H9S C;  5CHL B;  5DNN B;  5JRG C;  4J8X C;  3AZM A;  3KWQ B;  2JSS A;  2ARO B;  3MVD D;  4KUD C;  4G91 C;  2RIQ A;  5B2J C;  4JJN A;  5AV6 C;  1P3P B;  4WU9 D;  4YS3 B;  4XUJ A;  3A6N A;  2F8N K;  4XZQ D;  1F1E A;  4Z5T A;  5AY8 C;  1P3A A;  3KUY B;  2RVQ D;  3H0R C;  3REL B;  3W98 C;  3WA9 A;  5JA4 A;  4H9Q B;  1EQZ D;  5AV9 C;  3AZK B;  3X1T C;  1P3M D;  3AV2 A;  2F8N D;  1P3O A;  3VH5 T;  4LD9 B;  3LZ1 D;  3MGS C;  3W96 D;  5B2I B;  1Q9C A;  3B0B A;  2ZY2 A;  5B31 A;  3REK D;  3X1V D;  4J8X D;  1P3L B;  2YFW B;  3B6G C;  1P3F D;  1P34 B;  2Y2O A;  4E45 A;  4EO5 B;  5B2J D;  3AZG A;  3B0D C;  5CPJ D;  4CAY B;  3AZE A;  3C1B A;  5AY8 D;  3X1U C;  5AVC C;  5B33 B;  5GSU A;  1M18 A;  5BNV B;  5AVB A;  3AYW D;  2Y2G A;  2BYM B;  4UUZ B;  3W98 D;  3AN2 B;  1P3B A;  4H9P B;  1KX3 A;  5DNN C;  3KWQ C;  1ULY A;  5F99 B;  5CPK D;  2ARO C;  3X1T D;  5B32 B;  4WV4 B;  1TZY D;  5B1M B;  4Z66 D;  3AZM B;  2UWX A;  3MGS D;  2CV5 A;  1P3P C;  4JJN B;  1M1A A;  1HQ3 C;  3B6G D;  2Y2J A;  5E5A A;  3AZF A;  4XUJ B;  3A6N B;  2XD1 A;  3KUY C;  4J8V A;  1H3O A;  4NE3 A;  4ZUX C;  2FJ7 D;  1TAF A;  3WA9 B;  5JA4 B;  3AZK C;  3X1U D;  5AVC D;  3LZ0 A;  3MGP A;  4WZS B;  3AV2 B;  1P3O B;  5B2I C;  3WTP B;  5DNM A;  3KXB A;  2ARO D;  3R45 A;  5B31 B;  2F2A C;  1P3K B;  4EO5 C;  4WNN A;  3B6F B;  3EPJ A;  4DRA A;  1HQ3 D;  3UTB A;  3UTA A;  3W99 A;  1ZLA A;  3KUY D;  1BH9 A;  5B33 C;  3AZE B;  3MGR C;  3AN2 C;  4YM6 D;  1M18 B;  5GSU B;  3REI A;  5AVB B;  5CPI D;  1P3I D;  2Y2H A;  3W97 A;  4ZUX D;  4R8P A;  1P3B B;  5F99 C;  3AZK D;  2NQB C;  1F66 C;  5B32 C;  5B1M C;  1KX3 B;  3AZM C;  4NFT A;  3WAA D;  2BYK A;  4JJN C;  3TU4 A;  4YS3 A;  5C3I B;  2CV5 B;  1HTA A;  2Y2L A;  4XUJ C;  3A6N C;  5B24 A;  5E5A B;  3AFA A;  1ID3 A;  3AZF B;  5B1L D;  4Z5T C;  1P3A C;  4J8V B;  1P3G B;  3WA9 C;  1H3O B;  2JCH A;  5KDM A;  1TAF B;  3X1S A;  4LD9 A;  3MGR D;  3AV2 C;  3AN2 D;  1P3O C;  3LZ0 B;  5GT0 A;  2NQB D;  1F66 D;  5B1M D;  3AZJ A;  5DNM B;  1P34 A;  3AZM D;  2F8N G;  1PZR A;  3MNN A;  3NQU B;  3R45 B;  3AZG C;  4WNN B;  4CAY A;  1T3U A;  3VH6 T;  3A6N D;  1AOI A;  3AZE C;  3C1B C;  5BNV A;  3UTB B;  3UTA B;  4Z5T D;  3W99 B;  4NE6 A;  1P3A D;  4DQY B;  1ZLA B;  1M18 C;  5AV5 A;  5GSU C;  3REH B;  2FFF B;  3UT9 D;  1P3B C;  3WA9 D;  4WU8 A;  3VH5 W;  3LJA C;  3REI B;  1KX3 C;  3W97 B;  4R8P B;  1JFI A;  1KU5 A;  1Z2C B;  3AV2 D;  2Y2I A;  4KGC A;  5C3I C;  3AV1 D;  2CV5 C;  2BYK B;  3MGQ A;  1B6W A;  1M1A C;  3TU4 B;  2ZY5 A;  5E5A C;  3AZF C;  5B24 B;  3AFA B;  1ID3 B;  3AZG D;  4QLC D;  3WKJ B;  3LEL A;  3AZE D;  4UPK A;  3O62 D;  3C1B D;  4Z2M G;  3AZL A;  5KDM B;  3X1S B;  3LZ0 C;  3MGP C;  3WTP A;  2Y2P A;  1S32 A;  3LJA D;  4DRB A;  5DNM C;  3NQJ A;  5JRG D;  5GT0 B;  1P3K A;  3KXB C;  4AWL C;  2PYO A;  3KFU G;  3AZJ B;  5B40 A;  4KUD D;  2NZD A;  3B6F A;  3MNN B;  5AV6 D;  2CV5 D;  1M1A D;  5B0Z A;  3VH5 A;  1KX5 A;  3AZN A;  3UTA C;  3W99 C;  2HIO A;  1AOI B;  1N1J A;  1ZLA C;  2DF4 C;  5AV5 B;  3REI C;  3W97 C;  5AV9 D;  4WU8 B;  2F8N H;  1JFI B;  3MGP D;  2G5I C;  4WU9 A;  3TU4 C;  4YS3 C;  5CP6 A;  4X23 B;  4KGC B;  3KXB D;  3MGQ B;  5B24 C;  3AFA C;  1ID3 C;  3REL C;  1P3G A;  3B0C T;  1P3M A;  3LEL B;  4J8W A;  3W99 D;  2L5A A;  2Y2N A;  3W96 A;  3X1S C;  4LD9 C;  3AZL B;  3REK A;  3X1V A;  4CSR A;  3A1I A;  1P3F A;  3W97 D;  5GT0 C;  5DNN D;  1S32 B;  1P3L C;  3KWQ D;  2W8S A;  3AZJ C;  3NQU A;  3NQJ B;  1P34 C;  2PYO B;  3MNN C;  5B40 B;  5CPJ A;  2NZD B;  5BT1 C;  3TU4 D;  4YS3 D;  1P3P D;  5B32 G;  5GXQ B;  3AYW A;  1AOI C;  4Z2M H;  5B0Z B;  1KX5 B;  1ID3 D;  3P5J B;  3REH A;  3AZN B;  2HIO B;  3REL D;  1N1J B;  5AV5 C;  5CPK A;  1TZY A;  4Z66 A;  4WU8 C;  3MVD B;  4LD9 D;  3B6G A;  4ZBJ B;  4G92 B;  4WU9 B;  4KGC C;  5B2I D;  3MGQ C;  1P3L D;  3KSY A;  3C1C A;  4XZQ B;  2G5H C;  5CP6 B;  1P34 D;  3VH6 W;  2FJ7 A;  3WKJ A;  5BT1 D;  3EG5 B;  2Y2Q A;  1EQZ B;  5B31 G;  4J8U A;  1AOI D;  1P3M B;  2BG1 A;  5B33 D;  2ZY4 A;  3AZL C;  4J8W B;  1M19 A;  3LZ1 B;  3EPL A;  3AZH A;  3W96 B;  5AV5 D;  3WTP C;  3REK B;  3X1V B;  1S32 C;  4CSR B;  5F99 D;  5GT3 A;  1P3F B;  5B32 D;  4H9N A;  5B31 C;  1P3K C;  2PYO C;  1HQ3 A;  3V9R A;  5B40 C;  2NZD C;  3B6F C;  4JJN D;  5CPJ B;  2ZM5 A;  4XUJ D;  5B0Z C;  4YM6 A;  1KX5 C;  3AYW B;  2HIO C;  5CPI A;  4ZUX A;  1P3I A;  3W98 B;  1KX4 A;  5AVB C;  5CPK B;  1TZY B;  4Z66 B;  3WAA A;  3AZL D;  1U35 A;  1P3O D;  4WU9 C;  3WTP D;  5AV8 A;  4X23 A;  3B6G B;  2J8P A;  3AZI A;  5CP6 C;  5B1L A;  5B0Y A;  1F66 A;  5B31 D;  2CWE A;  1P3K D;  3C1C B;  3AL0 C;  5B40 D;  4J8V C;  3B6F D;  3B0D B;  2FJ7 B;  1P3G C;  3MGR A;  1P3M C;  1KX5 D;  5AVC B;  4J8U B;  4J8W C;  2NQB A;  3H0L C;  5GSU D;  1B67 A;  1M19 B;  5AVB D;  1M18 D;  2HUE B;  3REJ A;  3X1V C;  3REK C;  3AZH B;  1P3B D;  1P3F C;  5FUG A;  1KX3 D;  5GT3 B;  5BS7 A;  4H9N B;  4H9R A;  1HQ3 B;  3V9R B;  1A7W A;  5CPJ C;  5CP6 D;  5GXQ A;  1BH8 A;  5BO0 A;  5E5A D;  3B0C W;  3AYW C;  3UT9 A;  3UTB C;  3AZF D;  4YM6 B;  4J8V D;  3REH C;  5CPI B;  1P3I B;  4ZUX B;  1P3G D;  4M6B A;  5CPK C;  3EPK A;  1KX4 B;  3MVD A;  1TZY C;  4Z66 C;  2DQN C;  4R8P C;  4H9O A;  4J8W D;  4KHA A;  3AV1 A;  3WAA B;  3LZ0 D;  2YFV A;  1U35 B;  4NE5 A;  5AV8 B;  4XZQ A;  5DNM D;  3AZI B;  5G49 A;  3C1C C;  5B1L B;  5B0Y B;  4QLC A;  2FJ7 C;  1EQZ A;  3WKJ C;  3O62 A;  2LY8 A;  3FDD A;  2F8N A;  4J8U C;  3UTB D;  3MGR B;  3UTA D;  3LZ1 A;  1ZLA D;  3LJA A;  3REH D;  1M19 C;  2HUE C;  4H9S A;  5JRG A;  3AZH C;  4J8X A;  2NQB B;  1F66 B;  3REI D;  3REJ B;  4KUD A;  4R8P D;  5GT3 C;  2Y2K A;  5B2J A;  5FUG B;  5AV6 A;  4H9R B;  3IP4 C;  1R4V A;  5AY8 A;  2VQR A;  3C1C D;  4Z5T B;  5B24 D;  1BH8 B;  5BO0 B;  4YM6 C;  3AFA D;  1P3A B;  3W98 A;  3UT9 B;  5CPI C;  1P3I C;  3WKJ D;  5AV9 A;  1KX4 C;  5BNX A;  3X1T A;  4J8U D;  1WWI A;  3WAA C;  3MGS A;  3X1S D;  4H9O B;  1M19 D;  4KHA B;  3AV1 B;  3AZH D;  1U35 C;  5AV8 C;  4X23 C;  2YFV B;  3AZI C;  5GT0 D;  5GT3 D;  3WTP E;  5B1L C;  5B0Y C;  3AZJ D;  5G49 B;  1BFM A;  3AZG B;  3MNN D;  1WWS A;  4QLC B;  4HGA B;  2IO5 B;  3X1U A;  3C1B B;  5AVC A;  3O62 B;  3LEL C;  4WJ3 C;  4E44 A;  2F8N B;  2JE5 A;  5DNN A;  3KWQ A;  1KX4 D;  3LJA B;  2ARO A;  3REJ C;  5JRG B; 
#chains in the Genus database with same CATH homology
 4J8X B;  4WU8 D;  3A1K A;  4KUD B;  3H0M C;  4G91 B;  1P3P A;  5BS7 C;  5B2J B;  5AV6 B;  2Y2M A;  1U35 D;  1M1A B;  4KGC D;  5AV8 D;  4X23 D;  3AZI D;  3MGQ D;  3KUY A;  5GXQ C;  5B0Y D;  3REL A;  5AY8 B;  3UT9 C;  3AZN C;  4H9Q A;  3AZK A;  3LEL D;  5AV9 B;  3MVD C;  5BNX B;  3X1T B;  2ZY3 A;  3EPH A;  3MGP B;  5B2I A;  3AV1 C;  3MGS B;  1P3L A;  2YFW A;  1W2E A;  4ZBJ C;  4G92 C;  3VH6 A;  3REJ D;  3KXB B;  4AWL B;  1S32 D;  4XZQ C;  3F6T A;  2PYO D;  2RVQ C;  2XD5 A;  4QLC C;  2NZD D;  4HGA C;  2IO5 C;  1EQZ C;  3O62 C;  5B33 A;  5GXQ D;  2BYM A;  4UUZ A;  5B0Z D;  3X1U B;  3AN2 A;  1BH9 B;  3AZN D;  4H9P A;  2HIO D;  3LZ1 C;  3W96 C;  5F99 A;  5B32 A;  5B1M A;  4H9S C;  5CHL B;  5DNN B;  5JRG C;  4J8X C;  3AZM A;  3KWQ B;  2JSS A;  2ARO B;  3MVD D;  4KUD C;  4G91 C;  2RIQ A;  5B2J C;  4JJN A;  5AV6 C;  1P3P B;  4WU9 D;  4YS3 B;  4XUJ A;  3A6N A;  2F8N K;  4XZQ D;  1F1E A;  4Z5T A;  5AY8 C;  1P3A A;  3KUY B;  2RVQ D;  3H0R C;  3REL B;  3W98 C;  3WA9 A;  5JA4 A;  4H9Q B;  1EQZ D;  5AV9 C;  3AZK B;  3X1T C;  1P3M D;  3AV2 A;  2F8N D;  1P3O A;  3VH5 T;  4LD9 B;  3LZ1 D;  3MGS C;  3W96 D;  5B2I B;  1Q9C A;  3B0B A;  2ZY2 A;  5B31 A;  3REK D;  3X1V D;  4J8X D;  1P3L B;  2YFW B;  3B6G C;  1P3F D;  1P34 B;  2Y2O A;  4E45 A;  4EO5 B;  5B2J D;  3AZG A;  3B0D C;  5CPJ D;  4CAY B;  3AZE A;  3C1B A;  5AY8 D;  3X1U C;  5AVC C;  5B33 B;  5GSU A;  1M18 A;  5BNV B;  5AVB A;  3AYW D;  2Y2G A;  2BYM B;  4UUZ B;  3W98 D;  3AN2 B;  1P3B A;  4H9P B;  1KX3 A;  5DNN C;  3KWQ C;  1ULY A;  5F99 B;  5CPK D;  2ARO C;  3X1T D;  5B32 B;  4WV4 B;  1TZY D;  5B1M B;  4Z66 D;  3AZM B;  2UWX A;  3MGS D;  2CV5 A;  1P3P C;  4JJN B;  1M1A A;  1HQ3 C;  3B6G D;  2Y2J A;  5E5A A;  3AZF A;  4XUJ B;  3A6N B;  2XD1 A;  3KUY C;  4J8V A;  1H3O A;  4NE3 A;  4ZUX C;  2FJ7 D;  1TAF A;  3WA9 B;  5JA4 B;  3AZK C;  3X1U D;  5AVC D;  3LZ0 A;  3MGP A;  4WZS B;  3AV2 B;  1P3O B;  5B2I C;  3WTP B;  5DNM A;  3KXB A;  2ARO D;  3R45 A;  5B31 B;  2F2A C;  1P3K B;  4EO5 C;  4WNN A;  3B6F B;  3EPJ A;  4DRA A;  1HQ3 D;  3UTB A;  3UTA A;  3W99 A;  1ZLA A;  3KUY D;  1BH9 A;  5B33 C;  3AZE B;  3MGR C;  3AN2 C;  4YM6 D;  1M18 B;  5GSU B;  3REI A;  5AVB B;  5CPI D;  1P3I D;  2Y2H A;  3W97 A;  4ZUX D;  4R8P A;  1P3B B;  5F99 C;  3AZK D;  2NQB C;  1F66 C;  5B32 C;  5B1M C;  1KX3 B;  3AZM C;  4NFT A;  3WAA D;  2BYK A;  4JJN C;  3TU4 A;  4YS3 A;  5C3I B;  2CV5 B;  1HTA A;  2Y2L A;  4XUJ C;  3A6N C;  5B24 A;  5E5A B;  3AFA A;  1ID3 A;  3AZF B;  5B1L D;  4Z5T C;  1P3A C;  4J8V B;  1P3G B;  3WA9 C;  1H3O B;  2JCH A;  5KDM A;  1TAF B;  3X1S A;  4LD9 A;  3MGR D;  3AV2 C;  3AN2 D;  1P3O C;  3LZ0 B;  5GT0 A;  2NQB D;  1F66 D;  5B1M D;  3AZJ A;  5DNM B;  1P34 A;  3AZM D;  2F8N G;  1PZR A;  3MNN A;  3NQU B;  3R45 B;  3AZG C;  4WNN B;  4CAY A;  1T3U A;  3VH6 T;  3A6N D;  1AOI A;  3AZE C;  3C1B C;  5BNV A;  3UTB B;  3UTA B;  4Z5T D;  3W99 B;  4NE6 A;  1P3A D;  4DQY B;  1ZLA B;  1M18 C;  5AV5 A;  5GSU C;  3REH B;  2FFF B;  3UT9 D;  1P3B C;  3WA9 D;  4WU8 A;  3VH5 W;  3LJA C;  3REI B;  1KX3 C;  3W97 B;  4R8P B;  1JFI A;  1KU5 A;  1Z2C B;  3AV2 D;  2Y2I A;  4KGC A;  5C3I C;  3AV1 D;  2CV5 C;  2BYK B;  3MGQ A;  1B6W A;  1M1A C;  3TU4 B;  2ZY5 A;  5E5A C;  3AZF C;  5B24 B;  3AFA B;  1ID3 B;  3AZG D;  4QLC D;  3WKJ B;  3LEL A;  3AZE D;  4UPK A;  3O62 D;  3C1B D;  4Z2M G;  3AZL A;  5KDM B;  3X1S B;  3LZ0 C;  3MGP C;  3WTP A;  2Y2P A;  1S32 A;  3LJA D;  4DRB A;  5DNM C;  3NQJ A;  5JRG D;  5GT0 B;  1P3K A;  3KXB C;  4AWL C;  2PYO A;  3KFU G;  3AZJ B;  5B40 A;  4KUD D;  2NZD A;  3B6F A;  3MNN B;  5AV6 D;  2CV5 D;  1M1A D;  5B0Z A;  3VH5 A;  1KX5 A;  3AZN A;  3UTA C;  3W99 C;  2HIO A;  1AOI B;  1N1J A;  1ZLA C;  2DF4 C;  5AV5 B;  3REI C;  3W97 C;  5AV9 D;  4WU8 B;  2F8N H;  1JFI B;  3MGP D;  2G5I C;  4WU9 A;  3TU4 C;  4YS3 C;  5CP6 A;  4X23 B;  4KGC B;  3KXB D;  3MGQ B;  5B24 C;  3AFA C;  1ID3 C;  3REL C;  1P3G A;  3B0C T;  1P3M A;  3LEL B;  4J8W A;  3W99 D;  2L5A A;  2Y2N A;  3W96 A;  3X1S C;  4LD9 C;  3AZL B;  3REK A;  3X1V A;  4CSR A;  3A1I A;  1P3F A;  3W97 D;  5GT0 C;  5DNN D;  1S32 B;  1P3L C;  3KWQ D;  2W8S A;  3AZJ C;  3NQU A;  3NQJ B;  1P34 C;  2PYO B;  3MNN C;  5B40 B;  5CPJ A;  2NZD B;  5BT1 C;  3TU4 D;  4YS3 D;  1P3P D;  5B32 G;  5GXQ B;  3AYW A;  1AOI C;  4Z2M H;  5B0Z B;  1KX5 B;  1ID3 D;  3P5J B;  3REH A;  3AZN B;  2HIO B;  3REL D;  1N1J B;  5AV5 C;  5CPK A;  1TZY A;  4Z66 A;  4WU8 C;  3MVD B;  4LD9 D;  3B6G A;  4ZBJ B;  4G92 B;  4WU9 B;  4KGC C;  5B2I D;  3MGQ C;  1P3L D;  3KSY A;  3C1C A;  4XZQ B;  2G5H C;  5CP6 B;  1P34 D;  3VH6 W;  2FJ7 A;  3WKJ A;  5BT1 D;  3EG5 B;  2Y2Q A;  1EQZ B;  5B31 G;  4J8U A;  1AOI D;  1P3M B;  2BG1 A;  5B33 D;  2ZY4 A;  3AZL C;  4J8W B;  1M19 A;  3LZ1 B;  3EPL A;  3AZH A;  3W96 B;  5AV5 D;  3WTP C;  3REK B;  3X1V B;  1S32 C;  4CSR B;  5F99 D;  5GT3 A;  1P3F B;  5B32 D;  4H9N A;  5B31 C;  1P3K C;  2PYO C;  1HQ3 A;  3V9R A;  5B40 C;  2NZD C;  3B6F C;  4JJN D;  5CPJ B;  2ZM5 A;  4XUJ D;  5B0Z C;  4YM6 A;  1KX5 C;  3AYW B;  2HIO C;  5CPI A;  4ZUX A;  1P3I A;  3W98 B;  1KX4 A;  5AVB C;  5CPK B;  1TZY B;  4Z66 B;  3WAA A;  3AZL D;  1U35 A;  1P3O D;  4WU9 C;  3WTP D;  5AV8 A;  4X23 A;  3B6G B;  2J8P A;  3AZI A;  5CP6 C;  5B1L A;  5B0Y A;  1F66 A;  5B31 D;  2CWE A;  1P3K D;  3C1C B;  3AL0 C;  5B40 D;  4J8V C;  3B6F D;  3B0D B;  2FJ7 B;  1P3G C;  3MGR A;  1P3M C;  1KX5 D;  5AVC B;  4J8U B;  4J8W C;  2NQB A;  3H0L C;  5GSU D;  1B67 A;  1M19 B;  5AVB D;  1M18 D;  2HUE B;  3REJ A;  3X1V C;  3REK C;  3AZH B;  1P3B D;  1P3F C;  5FUG A;  1KX3 D;  5GT3 B;  5BS7 A;  4H9N B;  4H9R A;  1HQ3 B;  3V9R B;  1A7W A;  5CPJ C;  5CP6 D;  5GXQ A;  1BH8 A;  5BO0 A;  5E5A D;  3B0C W;  3AYW C;  3UT9 A;  3UTB C;  3AZF D;  4YM6 B;  4J8V D;  3REH C;  5CPI B;  1P3I B;  4ZUX B;  1P3G D;  4M6B A;  5CPK C;  3EPK A;  1KX4 B;  3MVD A;  1TZY C;  4Z66 C;  2DQN C;  4R8P C;  4H9O A;  4J8W D;  4KHA A;  3AV1 A;  3WAA B;  3LZ0 D;  2YFV A;  1U35 B;  4NE5 A;  5AV8 B;  4XZQ A;  5DNM D;  3AZI B;  5G49 A;  3C1C C;  5B1L B;  5B0Y B;  4QLC A;  2FJ7 C;  1EQZ A;  3WKJ C;  3O62 A;  2LY8 A;  3FDD A;  2F8N A;  4J8U C;  3UTB D;  3MGR B;  3UTA D;  3LZ1 A;  1ZLA D;  3LJA A;  3REH D;  1M19 C;  2HUE C;  4H9S A;  5JRG A;  3AZH C;  4J8X A;  2NQB B;  1F66 B;  3REI D;  3REJ B;  4KUD A;  4R8P D;  5GT3 C;  2Y2K A;  5B2J A;  5FUG B;  5AV6 A;  4H9R B;  3IP4 C;  1R4V A;  5AY8 A;  2VQR A;  3C1C D;  4Z5T B;  5B24 D;  1BH8 B;  5BO0 B;  4YM6 C;  3AFA D;  1P3A B;  3W98 A;  3UT9 B;  5CPI C;  1P3I C;  3WKJ D;  5AV9 A;  1KX4 C;  5BNX A;  3X1T A;  4J8U D;  1WWI A;  3WAA C;  3MGS A;  3X1S D;  4H9O B;  1M19 D;  4KHA B;  3AV1 B;  3AZH D;  1U35 C;  5AV8 C;  4X23 C;  2YFV B;  3AZI C;  5GT0 D;  5GT3 D;  3WTP E;  5B1L C;  5B0Y C;  3AZJ D;  5G49 B;  1BFM A;  3AZG B;  3MNN D;  1WWS A;  4QLC B;  4HGA B;  2IO5 B;  3X1U A;  3C1B B;  5AVC A;  3O62 B;  3LEL C;  4WJ3 C;  4E44 A;  2F8N B;  2JE5 A;  5DNN A;  3KWQ A;  1KX4 D;  3LJA B;  2ARO A;  3REJ C;  5JRG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...