1ID3C

Crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
110
structure length
110
Chain Sequence
b'QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PALINDROMIC 146BP DNA FRAGMENT
publication title Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 110
sequence length 110
chains with identical sequence G
ec nomenclature
pdb deposition date 2001-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1id3C00
3X1SC 3AV2A 3AN2A 4J8VB 3V9RB 1P3IB 1KU5A 3X1VA 1KX5A 5CPKA 2AROD 3WTPE 3A6NA 5AVBD 4G92B 1P3MB 2HUEB 2CV5A 4YM6C 5CP6D 4R8PB 3MGSC 3AYWA 5GXQD 2YFVA 5B31B 3W97B 5DNMA 1EQZC 5CPJB 3AV1C 2PYOA 1KX4B 2HIOB 4Z66B 4WV4B 5BNXA 3AZLB 3R45A 4X23C 4J8VC 3LZ1B 4LD9C 5JRGB 1TZYB 5B0ZA 4KUDB 5GSUC 4G92C 3UTAA 1B6WA 3LZ0A 5AY8D 4R8PC 4J8XC 3W99D 3X1SA 3O62D 1P3KC 3X1UD 2JSSA 1N1JA 3RELC 3W96B 3AZLC 5B32D 4WU8B 3WAAD 3LZ1C 5JRGC 3MGPD 4DRBA 4YM6A 4WZSB 3MGSA 1AOIC 3AZHD 3WKJD 4H9NB 1EQZA 5E5AC 1S32D 3AV1A 5FUGB 4JJNC 4DRAA 4X23A 4J8VA 1P3BB 4LD9A 3AZKD 3AZGD 4CSRA 3B6FB 1BFMA 3AZNC 5B32G 1P34C 5AV9D 3KUYD 5GSUA 1P3LB 4NFTA 3REID 4XZQB 3UT9C 4KGCB 4R8PA 5F99B 1HQ3C 4J8XA 1P3AC 1F66B 4XUJC 4J8WC 4QLCB 1P3GD 5B1MB 3AV2B 1P3KA 3AN2B 2F8ND 3RELA 4ZBJB 3AZIB 3X1VB 4Z5TD 3AZLA 3LZ1A 5CPKB 5JRGA 3MVDC 5B40C 1P3PD 2NZDD 3A6NB 1AOIA 2CV5B 3AYWB 5E5AA 2YFVB 4JJNA 5B31D 5DNMB 3MGQC 3W97D 5GT3C 2PYOB 4YS3D 5JA4A 5BNXB 5DNND 3R45B 5B24D 3WTPB 3AZIC 4EO5B 1P3FB 5GT0D 3AZNA 1P34A 4H9QA 3AZED 3UT9A 2AROC 3WA9C 1HQ3A 4H9PB 1P3AA 4H9RA 3NQJB 4XUJA 4J8WA 3AZMB 3LZ0B 5AVBC 3X1SB 5CP6C 1WWSA 3VH6T 5GXQC 5B31G 4ZUXD 4HGAC 3KWQD 3X1TD 3REJD 3MVDA 5B40A 3WTPC 3NQUA 4EO5C 1WWIA 3MGSB 3W98D 2F8NH 5B2ID 3C1BD 5B2JD 3MNNB 3AZMC 1EQZB 3MGQA 5GT3A 3AZJD 3C1CD 3VH5A 1BH9B 5AY8C 3W99C 4X23B 3LELD 3AZIA 4LD9B 3O62C 5AV6D 4WU9D 3REHB 5BO0A 4CSRB 5AV5C 1M18D 3B6FD 2AROA 3WA9A 5B32C 5GSUB 3WAAC 1KX3B 5AVBA 4J8XB 4KGCD 1BH8B 2RVQC 3MGPC 3REKD 3TU4B 5CP6A 2BYKA 4E44A 1F66D 3MNNC 1ID3D 3LJAD 3B6GD 5GXQA 1P3KB 3AFAD 1P3OD 3RELB 3B0DC 3AN2D 1F1EA 1S32C 2NQBB 3WTPA 1KX5D 3REHC 5AV8D 5B0YD 3A6ND 5CPIB 1AOIB 4WNNA 4H9PA 3AZFC 3NQJA 3AZMA 5E5AB 5B33D 3KUYC 1M1AB 3AYWD 3VH5W 4JJNB 1KX3C 3REIC 1U35D 5AY8A 3TU4C 3MGRD 3W99A 5JA4B 1P3GC 3UTBD 1ZLAB 3O62A 5BT1D 5AV5A 2NQBC 3AZNB 1P34B 5B32A 4H9QB 3WAAA 3UT9B 5B0ZD 1ULYA 1HQ3B 5CPIC 3MGPA 4H9RB 4XUJB 1P3AB 4J8WB 1P3PC 2NZDC 3UTAD 4H9SC 3MNNA 1M19D 1M1AC 5AVCB 3X1SD 1BH9A 4UUZA 1S32A 5KDMB 2FJ7D 1ZLAC 3MVDB 5B40B 3REHA 4J8UB 4AWLC 3NQUB 5DNNC 3KXBB 3AZFA 4YM6D 5GT0C 3B0CW 1KX3A 3KUYA 3AZEC 1BH8A 3REIA 3MGQB 5B1LB 5G49A 3TU4A 1JFIA 5GT3B 3AV1D 1P3FD 4KHAB 5AVCC 1P3GA 4X23D 4J8VD 1P3ID 2F8NA 2NQBA 5BO0B 4ZUXC 4CAYA 4J8UC 3X1TC 2AROB 1A7WA 3REJC 3WA9B 5CPIA 3KXBC 1P3PA 2NZDA 1P3MD 5AVBB 4H9SA 4R8PD 1M1AA 5CP6B 2BYKB 5GXQB 5B1LC 5CPJD 5B2JC 1P3KD 4HGAB 1KX4D 2HIOD 1ZLAA 3AZJC 3B0BA 4Z66D 4NE5A 3AZLD 5DNNA 3LZ1D 5JRGD 5GT0A 1TZYD 4WNNB 3AZEA 1M18C 2IO5C 4KUDD 5AY8B 5AVCA 3W99B 5KDMA 1H3OA 1ID3C 3O62B 3LJAC 3X1UB 5BS7C 4ZUXA 3AFAC 1P3OC 4H9OA 5AV5B 3W96D 4NE3A 4J8UA 4WU8D 3X1TA 3REJA 5B32B 3KXBA 3WAAB 3KSYA 5AV8C 3MGPB 2F8NK 5B0YC 5B1LA 5C3IC 3AZHB 4M6BA 3WKJB 5B2JA 4UUZB 3B0DB 5B33C 1S32B 4KHAA 3AZJA 1U35C 3MGRC 1P3BD 2YFWA 3X1UC 5B40D 3UTBC 3AZGB 5BT1C 1M18A 3AZFB 1P3LD 5AV9B 3KUYB 4XZQD 3REIB 5F99D 5G49B 4QLCD 1JFIB 5B1MD 3AZHC 3WKJC 1P3GB 1ID3A 3LJAA 3AV2D 1M19C 5BS7A 3AFAA 1P3OA 2F8NB 3AZID 3X1VD 2FJ7C 4Z5TB 5CPKD 4CAYB 3AZKC 3WA9D 5AV8A 1P3PB 3AZGC 4E45A 2NZDB 1HTAA 2CV5D 5B0YA 4G91C 5AV9C 5B33A 5DNMD 1U35A 3MGRA 2PYOD 4YS3B 1P3FC 3X1UA 4AWLB 1R4VA 3UTBA 3WTPD 5DNNB 5B24B 3VH6A 2CWEA 4Z5TC 1P3IC 4Z2MG 5GT0B 3AZEB 2BYMB 3AZMD 3LZ0D 1P3MC 2HUEC 3AZHA 3WKJA 1M19A 1H3OB 5B31C 4NE6A 3W97C 5CPJC 4ZUXB 2FJ7A 4YS3C 4H9OB 1KX4C 2HIOC 5AV5D 3KWQB 3X1TB 3REJB 1TAFA 4Z66C 5B24C 5BNVA 3AZKA 3AZGA 3MGSD 2RVQD 5AV9A 3W98B 5B2IB 1TZYC 4Z2MH 3MNND 1EQZD 4KUDC 3C1BB 5B2JB 3AZJB 3C1CB 2L5AA 1P3FA 3VH6W 2YFWB 4LD9D 3LELB 3REHD 3V9RA 4Z5TA 1P3IA 5AV6B 4WU9B 3KWQC 3W96C 1M18B 2IO5B 4WU8C 5GSUD 3AZFD 1KX3D 4J8XD 1P3MA 3VH5T 2LY8A 3W98C 5B2IC 3TU4D 3REKB 3C1BC 5B31A 1ID3B 3LJAB 3B6GB 3W97A 5CPJA 3AFAB 3RELD 1P3OB 4YS3A 3C1CC 1KX4A 2HIOA 2NQBD 4Z66A 5B24A 3LELC 1P3BC 5AV6C 4WU9C 1KX5B 5AV8B 1AOID 5CPID 5B0YB 3B6FC 2BYMA 1TZYA 5C3IB 4KUDA 5E5AD 1P3LC 1M1AD 4JJND 1B67A 5B33B 4XZQC 4KGCC 5F99C 3REKC 1U35B 5CHLB 1F66C 3MGRB 4QLCC 3B6GC 1ZLAD 5B1MC 3UTBB 3AV2C 3AN2C 3KWQA 4ZBJC 3W96A 2F8NG 3X1VC 3AZND 1P34D 4WU8A 1KX5C 3UT9D 5CPKC 3B0CT 1HQ3D 1P3AD 5B0ZB 4XUJD 3W98A 3A6NC 4J8WD 5B2IA 3UTAB 2CV5C 3C1BA 1Q9CA 4H9NA 5AVCD 1M19B 3AYWC 3C1CA 5FUGA 5DNMC 2FJ7B 2PYOC 3MVDD 3LELA 1N1JB 1P3BA 4J8UD 5AV6A 1TAFB 3AZKB 4WU9A 5BNVB 3KXBD 4G91B 3B6FA 4YM6B 1P3LA 5B0ZC 4XZQA 4KGCA 3MGQD 5B1LD 5F99A 3REKA 5GT3D 3UTAC 1F66A 4QLCA 3LZ0C 3AV1B 3B6GA 5B1MA
chains in the Genus database with same CATH superfamily
3X1SC 3AV2A 3AN2A 4J8VB 3V9RB 1P3IB 1KU5A 3X1VA 2XD1A 2JCHA 1KX5A 5CPKA 2AROD 3WTPE 3A6NA 5AVBD 4G92B 1P3MB 2HUEB 2CV5A 4YM6C 5CP6D 4R8PB 3MGSC 3AYWA 5GXQD 2YFVA 5B31B 3W97B 5DNMA 1EQZC 5CPJB 3AV1C 2PYOA 1KX4B 2HIOB 2ZM5A 4Z66B 4WV4B 5BNXA 3AZLB 3R45A 4X23C 4J8VC 3LZ1B 4LD9C 5JRGB 3EG5B 1TZYB 5B0ZA 4KUDB 5GSUC 4G92C 3UTAA 1B6WA 3LZ0A 5AY8D 4R8PC 3A1KA 4J8XC 3W99D 3X1SA 3O62D 1P3KC 3X1UD 2JSSA 1N1JA 3RELC 3W96B 3AZLC 5B32D 4WU8B 3WAAD 3LZ1C 5JRGC 3MGPD 4DRBA 4YM6A 4WZSB 3MGSA 2G5HC 1AOIC 2Y2NA 3AZHD 3WKJD 4H9NB 1EQZA 5E5AC 1S32D 3AV1A 5FUGB 4JJNC 4DRAA 4X23A 4J8VA 1P3BB 4LD9A 3AZKD 3AZGD 4CSRA 3B6FB 1BFMA 3AZNC 5B32G 1P34C 5AV9D 3KUYD 5GSUA 1P3LB 4NFTA 3REID 4XZQB 3UT9C 4KGCB 4R8PA 5F99B 1HQ3C 4J8XA 1P3AC 1F66B 4XUJC 4J8WC 4QLCB 2FFFB 1P3GD 5B1MB 3AV2B 1P3KA 3AN2B 2F8ND 3RELA 2Y2QA 4ZBJB 3AZIB 3X1VB 4Z5TD 3AZLA 3LZ1A 5CPKB 5JRGA 3MVDC 5B40C 1P3PD 2NZDD 3A6NB 1AOIA 2CV5B 3AYWB 5E5AA 2YFVB 4JJNA 5B31D 5DNMB 3MGQC 3W97D 2DQNC 5GT3C 2PYOB 4YS3D 5JA4A 5BNXB 5DNND 3R45B 5B24D 3WTPB 3AZIC 4WJ3C 4EO5B 1P3FB 5GT0D 3AZNA 1P34A 4H9QA 3AZED 3UT9A 2AROC 3WA9C 1HQ3A 4H9PB 1P3AA 4H9RA 3NQJB 4XUJA 4J8WA 3AZMB 3LZ0B 5AVBC 1Z2CB 3X1SB 5CP6C 2J8PA 1WWSA 3VH6T 5GXQC 5B31G 4ZUXD 2Y2MA 4HGAC 3FDDA 3KWQD 3X1TD 3REJD 3MVDA 2UWXA 5B40A 3WTPC 3NQUA 4EO5C 1WWIA 2Y2PA 3MGSB 2F8NH 3W98D 5B2ID 3EPLA 3C1BD 5B2JD 3MNNB 3AZMC 1EQZB 3MGQA 5GT3A 3AZJD 3C1CD 3VH5A 1BH9B 5AY8C 3W99C 4X23B 3LELD 3AZIA 4LD9B 3O62C 5AV6D 4WU9D 3REHB 5BO0A 4CSRB 3EPJA 5AV5C 1M18D 3B6FD 2AROA 3WA9A 5B32C 5GSUB 3WAAC 1KX3B 5AVBA 4J8XB 4KGCD 1BH8B 2RVQC 3MGPC 3REKD 3TU4B 5CP6A 2BYKA 4E44A 1F66D 3MNNC 1ID3D 3LJAD 3B6GD 5GXQA 1P3KB 3AFAD 1P3OD 3RELB 3B0DC 3AN2D 1F1EA 1S32C 3P5JB 2NQBB 2JE5A 3WTPA 1KX5D 3H0MC 3REHC 5AV8D 5B0YD 3A6ND 5CPIB 1AOIB 4WNNA 4H9PA 3AZFC 3NQJA 3AZMA 5E5AB 5B33D 3KUYC 1M1AB 3AYWD 2Y2IA 3VH5W 4JJNB 3REIC 1KX3C 1U35D 5AY8A 3TU4C 3MGRD 3W99A 5JA4B 1P3GC 3UTBD 1ZLAB 3O62A 2ZY5A 2BG1A 5BT1D 5AV5A 2NQBC 3H0RC 3AZNB 1P34B 5B32A 4H9QB 3WAAA 3UT9B 5B0ZD 1ULYA 1HQ3B 5CPIC 3MGPA 4H9RB 4XUJB 1P3AB 4J8WB 1P3PC 2NZDC 3UTAD 4H9SC 3MNNA 1M19D 1M1AC 5AVCB 3X1SD 2ZY2A 1BH9A 4UUZA 1S32A 4DQYB 5KDMB 2FJ7D 1ZLAC 3MVDB 5B40B 3REHA 4J8UB 4AWLC 3NQUB 5DNNC 3KXBB 3AZFA 4YM6D 5GT0C 3B0CW 2F2AC 1KX3A 3KUYA 3AZEC 1BH8A 3REIA 3MGQB 5B1LB 5G49A 3TU4A 3H0LC 1JFIA 5GT3B 3AV1D 1P3FD 4KHAB 5AVCC 1P3GA 4X23D 4J8VD 1P3ID 2Y2KA 2F8NA 2NQBA 5BO0B 4ZUXC 1PZRA 2W8SA 4CAYA 4J8UC 3X1TC 2AROB 1A7WA 3REJC 3WA9B 5CPIA 3KXBC 1P3PA 2NZDA 1P3MD 5AVBB 4H9SA 4R8PD 1M1AA 5CP6B 2BYKB 5GXQB 5B1LC 5CPJD 5B2JC 1P3KD 4HGAB 1KX4D 2HIOD 2Y2GA 3AZJC 3B0BA 1ZLAA 2XD5A 4Z66D 4NE5A 3AZLD 5DNNA 3LZ1D 5JRGD 3KFUG 5GT0A 1TZYD 4WNNB 3AZEA 1M18C 2IO5C 4KUDD 5AY8B 5AVCA 3W99B 5KDMA 1H3OA 1ID3C 3O62B 3LJAC 3X1UB 5BS7C 4ZUXA 3AFAC 3EPKA 4H9OA 1P3OC 5AV5B 3W96D 4NE3A 4J8UA 4WU8D 3X1TA 3REJA 5B32B 3KXBA 3WAAB 3KSYA 2ZY4A 5AV8C 3MGPB 2F8NK 5B0YC 5B1LA 5C3IC 3AZHB 4M6BA 3WKJB 5B2JA 4UUZB 3B0DB 5B33C 1S32B 4KHAA 3AZJA 1U35C 3MGRC 1W2EA 1P3BD 2YFWA 3X1UC 5B40D 3UTBC 3AZGB 5BT1C 1M18A 3AZFB 1P3LD 5AV9B 3KUYB 4XZQD 3REIB 5F99D 5G49B 4QLCD 1JFIB 5B1MD 3AZHC 3WKJC 1P3GB 1ID3A 3LJAA 3AV2D 1M19C 5BS7A 3AFAA 1P3OA 2F8NB 3AZID 3X1VD 2FJ7C 4Z5TB 3EPHA 5CPKD 4CAYB 2Y2OA 3AZKC 3WA9D 5AV8A 1P3PB 3AZGC 4E45A 2NZDB 1HTAA 2CV5D 5B0YA 4G91C 2Y2JA 5AV9C 2DF4C 5B33A 5DNMD 1U35A 3MGRA 2PYOD 4YS3B 2Y2LA 1P3FC 3X1UA 4AWLB 1R4VA 3UTBA 3WTPD 5DNNB 5B24B 3VH6A 2CWEA 4Z5TC 1P3IC 2G5IC 4Z2MG 5GT0B 4UPKA 3AZEB 2BYMB 3A1IA 3AZMD 3LZ0D 1P3MC 2HUEC 3AZHA 3WKJA 1M19A 1H3OB 5B31C 4NE6A 3W97C 5CPJC 4ZUXB 2FJ7A 4YS3C 4H9OB 1KX4C 2HIOC 5AV5D 3KWQB 3X1TB 3REJB 1TAFA 4Z66C 5B24C 5BNVA 3AZKA 3AZGA 3MGSD 2RVQD 5AV9A 3W98B 3AL0C 5B2IB 1TZYC 4Z2MH 3MNND 1EQZD 4KUDC 3C1BB 2ZY3A 5B2JB 3AZJB 3C1CB 2L5AA 1P3FA 3VH6W 2YFWB 4LD9D 3LELB 3REHD 3V9RA 4Z5TA 1P3IA 5AV6B 4WU9B 2Y2HA 3KWQC 3W96C 1M18B 2IO5B 4WU8C 5GSUD 3AZFD 1KX3D 4J8XD 1P3MA 3VH5T 2LY8A 3W98C 5B2IC 3TU4D 3REKB 3C1BC 5B31A 1ID3B 3LJAB 3B6GB 3W97A 5CPJA 3AFAB 3RELD 1P3OB 4YS3A 3C1CC 1KX4A 2HIOA 2NQBD 3IP4C 4Z66A 5B24A 3LELC 1P3BC 5AV6C 4WU9C 1KX5B 5AV8B 1AOID 5CPID 5B0YB 2RIQA 3B6FC 2BYMA 1TZYA 5C3IB 4KUDA 5E5AD 2VQRA 1P3LC 1M1AD 4JJND 1B67A 5B33B 4XZQC 4KGCC 5F99C 3REKC 1U35B 5CHLB 1F66C 3MGRB 4QLCC 3B6GC 1ZLAD 5B1MC 3UTBB 3AV2C 3AN2C 3KWQA 4ZBJC 3W96A 2F8NG 3X1VC 3AZND 1P34D 4WU8A 3F6TA 1KX5C 3UT9D 5CPKC 3B0CT 1HQ3D 1P3AD 5B0ZB 4XUJD 3W98A 3A6NC 1T3UA 4J8WD 5B2IA 3UTAB 2CV5C 3C1BA 1Q9CA 4H9NA 5AVCD 1M19B 3AYWC 3C1CA 5FUGA 5DNMC 2FJ7B 2PYOC 3MVDD 3LELA 1N1JB 1P3BA 4J8UD 5AV6A 1TAFB 3AZKB 4WU9A 5BNVB 3KXBD 4G91B 3B6FA 4YM6B 1P3LA 5B0ZC 4XZQA 4KGCA 3MGQD 5B1LD 5F99A 3REKA 5GT3D 3UTAC 1F66A 4QLCA 3LZ0C 3AV1B 3B6GA 5B1MA
chains in the Genus database with same CATH topology
3X1SC 3AV2A 3AN2A 4J8VB 3V9RB 1P3IB 1KU5A 3X1VA 2XD1A 2JCHA 1KX5A 5CPKA 2AROD 3WTPE 3A6NA 5AVBD 4G92B 1P3MB 2HUEB 2CV5A 4YM6C 5CP6D 4R8PB 3MGSC 3AYWA 5GXQD 2YFVA 5B31B 3W97B 5DNMA 1EQZC 5CPJB 3AV1C 2PYOA 1KX4B 2HIOB 2ZM5A 4Z66B 4WV4B 5BNXA 3AZLB 3R45A 4X23C 4J8VC 3LZ1B 4LD9C 5JRGB 3EG5B 1TZYB 5B0ZA 4KUDB 5GSUC 4G92C 3UTAA 1B6WA 3LZ0A 5AY8D 4R8PC 3A1KA 4J8XC 3W99D 3X1SA 3O62D 1P3KC 3X1UD 2JSSA 1N1JA 3RELC 3W96B 3AZLC 5B32D 4WU8B 3WAAD 3LZ1C 5JRGC 3MGPD 4DRBA 4YM6A 4WZSB 3MGSA 2G5HC 1AOIC 2Y2NA 3AZHD 3WKJD 4H9NB 1EQZA 5E5AC 1S32D 3AV1A 5FUGB 4JJNC 4DRAA 4X23A 4J8VA 1P3BB 4LD9A 3AZKD 3AZGD 4CSRA 3B6FB 1BFMA 3AZNC 5B32G 1P34C 5AV9D 3KUYD 5GSUA 1P3LB 4NFTA 3REID 4XZQB 3UT9C 4KGCB 4R8PA 5F99B 1HQ3C 4J8XA 1P3AC 1F66B 4XUJC 4J8WC 4QLCB 2FFFB 1P3GD 5B1MB 3AV2B 1P3KA 3AN2B 2F8ND 3RELA 2Y2QA 4ZBJB 3AZIB 3X1VB 4Z5TD 3AZLA 3LZ1A 5CPKB 5JRGA 3MVDC 5B40C 1P3PD 2NZDD 3A6NB 1AOIA 2CV5B 3AYWB 5E5AA 2YFVB 4JJNA 5B31D 5DNMB 3MGQC 3W97D 2DQNC 5GT3C 2PYOB 4YS3D 5JA4A 5BNXB 5DNND 3R45B 5B24D 3WTPB 3AZIC 4WJ3C 4EO5B 1P3FB 5GT0D 3AZNA 1P34A 4H9QA 3AZED 3UT9A 2AROC 3WA9C 1HQ3A 4H9PB 1P3AA 4H9RA 3NQJB 4XUJA 4J8WA 3AZMB 3LZ0B 5AVBC 1Z2CB 3X1SB 5CP6C 2J8PA 1WWSA 3VH6T 5GXQC 5B31G 4ZUXD 2Y2MA 4HGAC 3FDDA 3KWQD 3X1TD 3REJD 3MVDA 2UWXA 5B40A 3WTPC 3NQUA 4EO5C 1WWIA 2Y2PA 3MGSB 2F8NH 3W98D 5B2ID 3EPLA 3C1BD 5B2JD 3MNNB 3AZMC 1EQZB 3MGQA 5GT3A 3AZJD 3C1CD 3VH5A 1BH9B 5AY8C 3W99C 4X23B 3LELD 3AZIA 4LD9B 3O62C 5AV6D 4WU9D 3REHB 5BO0A 4CSRB 3EPJA 5AV5C 1M18D 3B6FD 2AROA 3WA9A 5B32C 5GSUB 3WAAC 1KX3B 5AVBA 4J8XB 4KGCD 1BH8B 2RVQC 3MGPC 3REKD 3TU4B 5CP6A 2BYKA 4E44A 1F66D 3MNNC 1ID3D 3LJAD 3B6GD 5GXQA 1P3KB 3AFAD 1P3OD 3RELB 3B0DC 3AN2D 1F1EA 1S32C 3P5JB 2NQBB 2JE5A 3WTPA 1KX5D 3H0MC 3REHC 5AV8D 5B0YD 3A6ND 5CPIB 1AOIB 4WNNA 4H9PA 3AZFC 3NQJA 3AZMA 5E5AB 5B33D 3KUYC 1M1AB 3AYWD 2Y2IA 3VH5W 4JJNB 3REIC 1KX3C 1U35D 5AY8A 3TU4C 3MGRD 3W99A 5JA4B 1P3GC 3UTBD 1ZLAB 3O62A 2ZY5A 2BG1A 5BT1D 5AV5A 2NQBC 3H0RC 3AZNB 1P34B 5B32A 4H9QB 3WAAA 3UT9B 5B0ZD 1ULYA 1HQ3B 5CPIC 3MGPA 4H9RB 4XUJB 1P3AB 4J8WB 1P3PC 2NZDC 3UTAD 4H9SC 3MNNA 1M19D 1M1AC 5AVCB 3X1SD 2ZY2A 1BH9A 4UUZA 1S32A 4DQYB 5KDMB 2FJ7D 1ZLAC 3MVDB 5B40B 3REHA 4J8UB 4AWLC 3NQUB 5DNNC 3KXBB 3AZFA 4YM6D 5GT0C 3B0CW 2F2AC 1KX3A 3KUYA 3AZEC 1BH8A 3REIA 3MGQB 5B1LB 5G49A 3TU4A 3H0LC 1JFIA 5GT3B 3AV1D 1P3FD 4KHAB 5AVCC 1P3GA 4X23D 4J8VD 1P3ID 2Y2KA 2F8NA 2NQBA 5BO0B 4ZUXC 1PZRA 2W8SA 4CAYA 4J8UC 3X1TC 2AROB 1A7WA 3REJC 3WA9B 5CPIA 3KXBC 1P3PA 2NZDA 1P3MD 5AVBB 4H9SA 4R8PD 1M1AA 5CP6B 2BYKB 5GXQB 5B1LC 5CPJD 5B2JC 1P3KD 4HGAB 1KX4D 2HIOD 2Y2GA 3AZJC 3B0BA 1ZLAA 2XD5A 4Z66D 4NE5A 3AZLD 5DNNA 3LZ1D 5JRGD 3KFUG 5GT0A 1TZYD 4WNNB 3AZEA 1M18C 2IO5C 4KUDD 5AY8B 5AVCA 3W99B 5KDMA 1H3OA 1ID3C 3O62B 3LJAC 3X1UB 5BS7C 4ZUXA 3AFAC 3EPKA 4H9OA 1P3OC 5AV5B 3W96D 4NE3A 4J8UA 4WU8D 3X1TA 3REJA 5B32B 3KXBA 3WAAB 3KSYA 2ZY4A 5AV8C 3MGPB 2F8NK 5B0YC 5B1LA 5C3IC 3AZHB 4M6BA 3WKJB 5B2JA 4UUZB 3B0DB 5B33C 1S32B 4KHAA 3AZJA 1U35C 3MGRC 1W2EA 1P3BD 2YFWA 3X1UC 5B40D 3UTBC 3AZGB 5BT1C 1M18A 3AZFB 1P3LD 5AV9B 3KUYB 4XZQD 3REIB 5F99D 5G49B 4QLCD 1JFIB 5B1MD 3AZHC 3WKJC 1P3GB 1ID3A 3LJAA 3AV2D 1M19C 5BS7A 3AFAA 1P3OA 2F8NB 3AZID 3X1VD 2FJ7C 4Z5TB 3EPHA 5CPKD 4CAYB 2Y2OA 3AZKC 3WA9D 5AV8A 1P3PB 3AZGC 4E45A 2NZDB 1HTAA 2CV5D 5B0YA 4G91C 2Y2JA 5AV9C 2DF4C 5B33A 5DNMD 1U35A 3MGRA 2PYOD 4YS3B 2Y2LA 1P3FC 3X1UA 4AWLB 1R4VA 3UTBA 3WTPD 5DNNB 5B24B 3VH6A 2CWEA 4Z5TC 1P3IC 2G5IC 4Z2MG 5GT0B 4UPKA 3AZEB 2BYMB 3A1IA 3AZMD 3LZ0D 1P3MC 2HUEC 3AZHA 3WKJA 1M19A 1H3OB 5B31C 4NE6A 3W97C 5CPJC 4ZUXB 2FJ7A 4YS3C 4H9OB 1KX4C 2HIOC 5AV5D 3KWQB 3X1TB 3REJB 1TAFA 4Z66C 5B24C 5BNVA 3AZKA 3AZGA 3MGSD 2RVQD 5AV9A 3W98B 3AL0C 5B2IB 1TZYC 4Z2MH 3MNND 1EQZD 4KUDC 3C1BB 2ZY3A 5B2JB 3AZJB 3C1CB 2L5AA 1P3FA 3VH6W 2YFWB 4LD9D 3LELB 3REHD 3V9RA 4Z5TA 1P3IA 5AV6B 4WU9B 2Y2HA 3KWQC 3W96C 1M18B 2IO5B 4WU8C 5GSUD 3AZFD 1KX3D 4J8XD 1P3MA 3VH5T 2LY8A 3W98C 5B2IC 3TU4D 3REKB 3C1BC 5B31A 1ID3B 3LJAB 3B6GB 3W97A 5CPJA 3AFAB 3RELD 1P3OB 4YS3A 3C1CC 1KX4A 2HIOA 2NQBD 3IP4C 4Z66A 5B24A 3LELC 1P3BC 5AV6C 4WU9C 1KX5B 5AV8B 1AOID 5CPID 5B0YB 2RIQA 3B6FC 2BYMA 1TZYA 5C3IB 4KUDA 5E5AD 2VQRA 1P3LC 1M1AD 4JJND 1B67A 5B33B 4XZQC 4KGCC 5F99C 3REKC 1U35B 5CHLB 1F66C 3MGRB 4QLCC 3B6GC 1ZLAD 5B1MC 3UTBB 3AV2C 3AN2C 3KWQA 4ZBJC 3W96A 2F8NG 3X1VC 3AZND 1P34D 4WU8A 3F6TA 1KX5C 3UT9D 5CPKC 3B0CT 1HQ3D 1P3AD 5B0ZB 4XUJD 3W98A 3A6NC 1T3UA 4J8WD 5B2IA 3UTAB 2CV5C 3C1BA 1Q9CA 4H9NA 5AVCD 1M19B 3AYWC 3C1CA 5FUGA 5DNMC 2FJ7B 2PYOC 3MVDD 3LELA 1N1JB 1P3BA 4J8UD 5AV6A 1TAFB 3AZKB 4WU9A 5BNVB 3KXBD 4G91B 3B6FA 4YM6B 1P3LA 5B0ZC 4XZQA 4KGCA 3MGQD 5B1LD 5F99A 3REKA 5GT3D 3UTAC 1F66A 4QLCA 3LZ0C 3AV1B 3B6GA 5B1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1S C;  3AV2 A;  3AN2 A;  4J8V B;  3V9R B;  1P3I B;  1KU5 A;  3X1V A;  1KX5 A;  5CPK A;  2ARO D;  3WTP E;  3A6N A;  5AVB D;  4G92 B;  1P3M B;  2HUE B;  2CV5 A;  4YM6 C;  5CP6 D;  4R8P B;  3MGS C;  3AYW A;  5GXQ D;  2YFV A;  5B31 B;  3W97 B;  5DNM A;  1EQZ C;  5CPJ B;  3AV1 C;  2PYO A;  1KX4 B;  2HIO B;  4Z66 B;  4WV4 B;  5BNX A;  3AZL B;  3R45 A;  4X23 C;  4J8V C;  3LZ1 B;  4LD9 C;  5JRG B;  1TZY B;  5B0Z A;  4KUD B;  5GSU C;  4G92 C;  3UTA A;  1B6W A;  3LZ0 A;  5AY8 D;  4R8P C;  4J8X C;  3W99 D;  3X1S A;  3O62 D;  1P3K C;  3X1U D;  2JSS A;  1N1J A;  3REL C;  3W96 B;  3AZL C;  5B32 D;  4WU8 B;  3WAA D;  3LZ1 C;  5JRG C;  3MGP D;  4DRB A;  4YM6 A;  4WZS B;  3MGS A;  1AOI C;  3AZH D;  3WKJ D;  4H9N B;  1EQZ A;  5E5A C;  1S32 D;  3AV1 A;  5FUG B;  4JJN C;  4DRA A;  4X23 A;  4J8V A;  1P3B B;  4LD9 A;  3AZK D;  3AZG D;  4CSR A;  3B6F B;  1BFM A;  3AZN C;  5B32 G;  1P34 C;  5AV9 D;  3KUY D;  5GSU A;  1P3L B;  4NFT A;  3REI D;  4XZQ B;  3UT9 C;  4KGC B;  4R8P A;  5F99 B;  1HQ3 C;  4J8X A;  1P3A C;  1F66 B;  4XUJ C;  4J8W C;  4QLC B;  1P3G D;  5B1M B;  3AV2 B;  1P3K A;  3AN2 B;  2F8N D;  3REL A;  4ZBJ B;  3AZI B;  3X1V B;  4Z5T D;  3AZL A;  3LZ1 A;  5CPK B;  5JRG A;  3MVD C;  5B40 C;  1P3P D;  2NZD D;  3A6N B;  1AOI A;  2CV5 B;  3AYW B;  5E5A A;  2YFV B;  4JJN A;  5B31 D;  5DNM B;  3MGQ C;  3W97 D;  5GT3 C;  2PYO B;  4YS3 D;  5JA4 A;  5BNX B;  5DNN D;  3R45 B;  5B24 D;  3WTP B;  3AZI C;  4EO5 B;  1P3F B;  5GT0 D;  3AZN A;  1P34 A;  4H9Q A;  3AZE D;  3UT9 A;  2ARO C;  3WA9 C;  1HQ3 A;  4H9P B;  1P3A A;  4H9R A;  3NQJ B;  4XUJ A;  4J8W A;  3AZM B;  3LZ0 B;  5AVB C;  3X1S B;  5CP6 C;  1WWS A;  3VH6 T;  5GXQ C;  5B31 G;  4ZUX D;  4HGA C;  3KWQ D;  3X1T D;  3REJ D;  3MVD A;  5B40 A;  3WTP C;  3NQU A;  4EO5 C;  1WWI A;  3MGS B;  3W98 D;  2F8N H;  5B2I D;  3C1B D;  5B2J D;  3MNN B;  3AZM C;  1EQZ B;  3MGQ A;  5GT3 A;  3AZJ D;  3C1C D;  3VH5 A;  1BH9 B;  5AY8 C;  3W99 C;  4X23 B;  3LEL D;  3AZI A;  4LD9 B;  3O62 C;  5AV6 D;  4WU9 D;  3REH B;  5BO0 A;  4CSR B;  5AV5 C;  1M18 D;  3B6F D;  2ARO A;  3WA9 A;  5B32 C;  5GSU B;  3WAA C;  1KX3 B;  5AVB A;  4J8X B;  4KGC D;  1BH8 B;  2RVQ C;  3MGP C;  3REK D;  3TU4 B;  5CP6 A;  2BYK A;  4E44 A;  1F66 D;  3MNN C;  1ID3 D;  3LJA D;  3B6G D;  5GXQ A;  1P3K B;  3AFA D;  1P3O D;  3REL B;  3B0D C;  3AN2 D;  1F1E A;  1S32 C;  2NQB B;  3WTP A;  1KX5 D;  3REH C;  5AV8 D;  5B0Y D;  3A6N D;  5CPI B;  1AOI B;  4WNN A;  4H9P A;  3AZF C;  3NQJ A;  3AZM A;  5E5A B;  5B33 D;  3KUY C;  1M1A B;  3AYW D;  3VH5 W;  4JJN B;  1KX3 C;  3REI C;  1U35 D;  5AY8 A;  3TU4 C;  3MGR D;  3W99 A;  5JA4 B;  1P3G C;  3UTB D;  1ZLA B;  3O62 A;  5BT1 D;  5AV5 A;  2NQB C;  3AZN B;  1P34 B;  5B32 A;  4H9Q B;  3WAA A;  3UT9 B;  5B0Z D;  1ULY A;  1HQ3 B;  5CPI C;  3MGP A;  4H9R B;  4XUJ B;  1P3A B;  4J8W B;  1P3P C;  2NZD C;  3UTA D;  4H9S C;  3MNN A;  1M19 D;  1M1A C;  5AVC B;  3X1S D;  1BH9 A;  4UUZ A;  1S32 A;  5KDM B;  2FJ7 D;  1ZLA C;  3MVD B;  5B40 B;  3REH A;  4J8U B;  4AWL C;  3NQU B;  5DNN C;  3KXB B;  3AZF A;  4YM6 D;  5GT0 C;  3B0C W;  1KX3 A;  3KUY A;  3AZE C;  1BH8 A;  3REI A;  3MGQ B;  5B1L B;  5G49 A;  3TU4 A;  1JFI A;  5GT3 B;  3AV1 D;  1P3F D;  4KHA B;  5AVC C;  1P3G A;  4X23 D;  4J8V D;  1P3I D;  2F8N A;  2NQB A;  5BO0 B;  4ZUX C;  4CAY A;  4J8U C;  3X1T C;  2ARO B;  1A7W A;  3REJ C;  3WA9 B;  5CPI A;  3KXB C;  1P3P A;  2NZD A;  1P3M D;  5AVB B;  4H9S A;  4R8P D;  1M1A A;  5CP6 B;  2BYK B;  5GXQ B;  5B1L C;  5CPJ D;  5B2J C;  1P3K D;  4HGA B;  1KX4 D;  2HIO D;  1ZLA A;  3AZJ C;  3B0B A;  4Z66 D;  4NE5 A;  3AZL D;  5DNN A;  3LZ1 D;  5JRG D;  5GT0 A;  1TZY D;  4WNN B;  3AZE A;  1M18 C;  2IO5 C;  4KUD D;  5AY8 B;  5AVC A;  3W99 B;  5KDM A;  1H3O A;  1ID3 C;  3O62 B;  3LJA C;  3X1U B;  5BS7 C;  4ZUX A;  3AFA C;  1P3O C;  4H9O A;  5AV5 B;  3W96 D;  4NE3 A;  4J8U A;  4WU8 D;  3X1T A;  3REJ A;  5B32 B;  3KXB A;  3WAA B;  3KSY A;  5AV8 C;  3MGP B;  2F8N K;  5B0Y C;  5B1L A;  5C3I C;  3AZH B;  4M6B A;  3WKJ B;  5B2J A;  4UUZ B;  3B0D B;  5B33 C;  1S32 B;  4KHA A;  3AZJ A;  1U35 C;  3MGR C;  1P3B D;  2YFW A;  3X1U C;  5B40 D;  3UTB C;  3AZG B;  5BT1 C;  1M18 A;  3AZF B;  1P3L D;  5AV9 B;  3KUY B;  4XZQ D;  3REI B;  5F99 D;  5G49 B;  4QLC D;  1JFI B;  5B1M D;  3AZH C;  3WKJ C;  1P3G B;  1ID3 A;  3LJA A;  3AV2 D;  1M19 C;  5BS7 A;  3AFA A;  1P3O A;  2F8N B;  3AZI D;  3X1V D;  2FJ7 C;  4Z5T B;  5CPK D;  4CAY B;  3AZK C;  3WA9 D;  5AV8 A;  1P3P B;  3AZG C;  4E45 A;  2NZD B;  1HTA A;  2CV5 D;  5B0Y A;  4G91 C;  5AV9 C;  5B33 A;  5DNM D;  1U35 A;  3MGR A;  2PYO D;  4YS3 B;  1P3F C;  3X1U A;  4AWL B;  1R4V A;  3UTB A;  3WTP D;  5DNN B;  5B24 B;  3VH6 A;  2CWE A;  4Z5T C;  1P3I C;  4Z2M G;  5GT0 B;  3AZE B;  2BYM B;  3AZM D;  3LZ0 D;  1P3M C;  2HUE C;  3AZH A;  3WKJ A;  1M19 A;  1H3O B;  5B31 C;  4NE6 A;  3W97 C;  5CPJ C;  4ZUX B;  2FJ7 A;  4YS3 C;  4H9O B;  1KX4 C;  2HIO C;  5AV5 D;  3KWQ B;  3X1T B;  3REJ B;  1TAF A;  4Z66 C;  5B24 C;  5BNV A;  3AZK A;  3AZG A;  3MGS D;  2RVQ D;  5AV9 A;  3W98 B;  5B2I B;  1TZY C;  4Z2M H;  3MNN D;  1EQZ D;  4KUD C;  3C1B B;  5B2J B;  3AZJ B;  3C1C B;  2L5A A;  1P3F A;  3VH6 W;  2YFW B;  4LD9 D;  3LEL B;  3REH D;  3V9R A;  4Z5T A;  1P3I A;  5AV6 B;  4WU9 B;  3KWQ C;  3W96 C;  1M18 B;  2IO5 B;  4WU8 C;  5GSU D;  3AZF D;  1KX3 D;  4J8X D;  1P3M A;  3VH5 T;  2LY8 A;  3W98 C;  5B2I C;  3TU4 D;  3REK B;  3C1B C;  5B31 A;  1ID3 B;  3LJA B;  3B6G B;  3W97 A;  5CPJ A;  3AFA B;  3REL D;  1P3O B;  4YS3 A;  3C1C C;  1KX4 A;  2HIO A;  2NQB D;  4Z66 A;  5B24 A;  3LEL C;  1P3B C;  5AV6 C;  4WU9 C;  1KX5 B;  5AV8 B;  1AOI D;  5CPI D;  5B0Y B;  3B6F C;  2BYM A;  1TZY A;  5C3I B;  4KUD A;  5E5A D;  1P3L C;  1M1A D;  4JJN D;  1B67 A;  5B33 B;  4XZQ C;  4KGC C;  5F99 C;  3REK C;  1U35 B;  5CHL B;  1F66 C;  3MGR B;  4QLC C;  3B6G C;  1ZLA D;  5B1M C;  3UTB B;  3AV2 C;  3AN2 C;  3KWQ A;  4ZBJ C;  3W96 A;  2F8N G;  3X1V C;  3AZN D;  1P34 D;  4WU8 A;  1KX5 C;  3UT9 D;  5CPK C;  3B0C T;  1HQ3 D;  1P3A D;  5B0Z B;  4XUJ D;  3W98 A;  3A6N C;  4J8W D;  5B2I A;  3UTA B;  2CV5 C;  3C1B A;  1Q9C A;  4H9N A;  5AVC D;  1M19 B;  3AYW C;  3C1C A;  5FUG A;  5DNM C;  2FJ7 B;  2PYO C;  3MVD D;  3LEL A;  1N1J B;  1P3B A;  4J8U D;  5AV6 A;  1TAF B;  3AZK B;  4WU9 A;  5BNV B;  3KXB D;  4G91 B;  3B6F A;  4YM6 B;  1P3L A;  5B0Z C;  4XZQ A;  4KGC A;  3MGQ D;  5B1L D;  5F99 A;  3REK A;  5GT3 D;  3UTA C;  1F66 A;  4QLC A;  3LZ0 C;  3AV1 B;  3B6G A;  5B1M A; 
#chains in the Genus database with same CATH topology
 3X1S C;  3AV2 A;  3AN2 A;  4J8V B;  3V9R B;  1P3I B;  1KU5 A;  3X1V A;  2XD1 A;  2JCH A;  1KX5 A;  5CPK A;  2ARO D;  3WTP E;  3A6N A;  5AVB D;  4G92 B;  1P3M B;  2HUE B;  2CV5 A;  4YM6 C;  5CP6 D;  4R8P B;  3MGS C;  3AYW A;  5GXQ D;  2YFV A;  5B31 B;  3W97 B;  5DNM A;  1EQZ C;  5CPJ B;  3AV1 C;  2PYO A;  1KX4 B;  2HIO B;  2ZM5 A;  4Z66 B;  4WV4 B;  5BNX A;  3AZL B;  3R45 A;  4X23 C;  4J8V C;  3LZ1 B;  4LD9 C;  5JRG B;  3EG5 B;  1TZY B;  5B0Z A;  4KUD B;  5GSU C;  4G92 C;  3UTA A;  1B6W A;  3LZ0 A;  5AY8 D;  4R8P C;  3A1K A;  4J8X C;  3W99 D;  3X1S A;  3O62 D;  1P3K C;  3X1U D;  2JSS A;  1N1J A;  3REL C;  3W96 B;  3AZL C;  5B32 D;  4WU8 B;  3WAA D;  3LZ1 C;  5JRG C;  3MGP D;  4DRB A;  4YM6 A;  4WZS B;  3MGS A;  2G5H C;  1AOI C;  2Y2N A;  3AZH D;  3WKJ D;  4H9N B;  1EQZ A;  5E5A C;  1S32 D;  3AV1 A;  5FUG B;  4JJN C;  4DRA A;  4X23 A;  4J8V A;  1P3B B;  4LD9 A;  3AZK D;  3AZG D;  4CSR A;  3B6F B;  1BFM A;  3AZN C;  5B32 G;  1P34 C;  5AV9 D;  3KUY D;  5GSU A;  1P3L B;  4NFT A;  3REI D;  4XZQ B;  3UT9 C;  4KGC B;  4R8P A;  5F99 B;  1HQ3 C;  4J8X A;  1P3A C;  1F66 B;  4XUJ C;  4J8W C;  4QLC B;  2FFF B;  1P3G D;  5B1M B;  3AV2 B;  1P3K A;  3AN2 B;  2F8N D;  3REL A;  2Y2Q A;  4ZBJ B;  3AZI B;  3X1V B;  4Z5T D;  3AZL A;  3LZ1 A;  5CPK B;  5JRG A;  3MVD C;  5B40 C;  1P3P D;  2NZD D;  3A6N B;  1AOI A;  2CV5 B;  3AYW B;  5E5A A;  2YFV B;  4JJN A;  5B31 D;  5DNM B;  3MGQ C;  3W97 D;  2DQN C;  5GT3 C;  2PYO B;  4YS3 D;  5JA4 A;  5BNX B;  5DNN D;  3R45 B;  5B24 D;  3WTP B;  3AZI C;  4WJ3 C;  4EO5 B;  1P3F B;  5GT0 D;  3AZN A;  1P34 A;  4H9Q A;  3AZE D;  3UT9 A;  2ARO C;  3WA9 C;  1HQ3 A;  4H9P B;  1P3A A;  4H9R A;  3NQJ B;  4XUJ A;  4J8W A;  3AZM B;  3LZ0 B;  5AVB C;  1Z2C B;  3X1S B;  5CP6 C;  2J8P A;  1WWS A;  3VH6 T;  5GXQ C;  5B31 G;  4ZUX D;  2Y2M A;  4HGA C;  3FDD A;  3KWQ D;  3X1T D;  3REJ D;  3MVD A;  2UWX A;  5B40 A;  3WTP C;  3NQU A;  4EO5 C;  1WWI A;  2Y2P A;  3MGS B;  2F8N H;  3W98 D;  5B2I D;  3EPL A;  3C1B D;  5B2J D;  3MNN B;  3AZM C;  1EQZ B;  3MGQ A;  5GT3 A;  3AZJ D;  3C1C D;  3VH5 A;  1BH9 B;  5AY8 C;  3W99 C;  4X23 B;  3LEL D;  3AZI A;  4LD9 B;  3O62 C;  5AV6 D;  4WU9 D;  3REH B;  5BO0 A;  4CSR B;  3EPJ A;  5AV5 C;  1M18 D;  3B6F D;  2ARO A;  3WA9 A;  5B32 C;  5GSU B;  3WAA C;  1KX3 B;  5AVB A;  4J8X B;  4KGC D;  1BH8 B;  2RVQ C;  3MGP C;  3REK D;  3TU4 B;  5CP6 A;  2BYK A;  4E44 A;  1F66 D;  3MNN C;  1ID3 D;  3LJA D;  3B6G D;  5GXQ A;  1P3K B;  3AFA D;  1P3O D;  3REL B;  3B0D C;  3AN2 D;  1F1E A;  1S32 C;  3P5J B;  2NQB B;  2JE5 A;  3WTP A;  1KX5 D;  3H0M C;  3REH C;  5AV8 D;  5B0Y D;  3A6N D;  5CPI B;  1AOI B;  4WNN A;  4H9P A;  3AZF C;  3NQJ A;  3AZM A;  5E5A B;  5B33 D;  3KUY C;  1M1A B;  3AYW D;  2Y2I A;  3VH5 W;  4JJN B;  3REI C;  1KX3 C;  1U35 D;  5AY8 A;  3TU4 C;  3MGR D;  3W99 A;  5JA4 B;  1P3G C;  3UTB D;  1ZLA B;  3O62 A;  2ZY5 A;  2BG1 A;  5BT1 D;  5AV5 A;  2NQB C;  3H0R C;  3AZN B;  1P34 B;  5B32 A;  4H9Q B;  3WAA A;  3UT9 B;  5B0Z D;  1ULY A;  1HQ3 B;  5CPI C;  3MGP A;  4H9R B;  4XUJ B;  1P3A B;  4J8W B;  1P3P C;  2NZD C;  3UTA D;  4H9S C;  3MNN A;  1M19 D;  1M1A C;  5AVC B;  3X1S D;  2ZY2 A;  1BH9 A;  4UUZ A;  1S32 A;  4DQY B;  5KDM B;  2FJ7 D;  1ZLA C;  3MVD B;  5B40 B;  3REH A;  4J8U B;  4AWL C;  3NQU B;  5DNN C;  3KXB B;  3AZF A;  4YM6 D;  5GT0 C;  3B0C W;  2F2A C;  1KX3 A;  3KUY A;  3AZE C;  1BH8 A;  3REI A;  3MGQ B;  5B1L B;  5G49 A;  3TU4 A;  3H0L C;  1JFI A;  5GT3 B;  3AV1 D;  1P3F D;  4KHA B;  5AVC C;  1P3G A;  4X23 D;  4J8V D;  1P3I D;  2Y2K A;  2F8N A;  2NQB A;  5BO0 B;  4ZUX C;  1PZR A;  2W8S A;  4CAY A;  4J8U C;  3X1T C;  2ARO B;  1A7W A;  3REJ C;  3WA9 B;  5CPI A;  3KXB C;  1P3P A;  2NZD A;  1P3M D;  5AVB B;  4H9S A;  4R8P D;  1M1A A;  5CP6 B;  2BYK B;  5GXQ B;  5B1L C;  5CPJ D;  5B2J C;  1P3K D;  4HGA B;  1KX4 D;  2HIO D;  2Y2G A;  3AZJ C;  3B0B A;  1ZLA A;  2XD5 A;  4Z66 D;  4NE5 A;  3AZL D;  5DNN A;  3LZ1 D;  5JRG D;  3KFU G;  5GT0 A;  1TZY D;  4WNN B;  3AZE A;  1M18 C;  2IO5 C;  4KUD D;  5AY8 B;  5AVC A;  3W99 B;  5KDM A;  1H3O A;  1ID3 C;  3O62 B;  3LJA C;  3X1U B;  5BS7 C;  4ZUX A;  3AFA C;  3EPK A;  4H9O A;  1P3O C;  5AV5 B;  3W96 D;  4NE3 A;  4J8U A;  4WU8 D;  3X1T A;  3REJ A;  5B32 B;  3KXB A;  3WAA B;  3KSY A;  2ZY4 A;  5AV8 C;  3MGP B;  2F8N K;  5B0Y C;  5B1L A;  5C3I C;  3AZH B;  4M6B A;  3WKJ B;  5B2J A;  4UUZ B;  3B0D B;  5B33 C;  1S32 B;  4KHA A;  3AZJ A;  1U35 C;  3MGR C;  1W2E A;  1P3B D;  2YFW A;  3X1U C;  5B40 D;  3UTB C;  3AZG B;  5BT1 C;  1M18 A;  3AZF B;  1P3L D;  5AV9 B;  3KUY B;  4XZQ D;  3REI B;  5F99 D;  5G49 B;  4QLC D;  1JFI B;  5B1M D;  3AZH C;  3WKJ C;  1P3G B;  1ID3 A;  3LJA A;  3AV2 D;  1M19 C;  5BS7 A;  3AFA A;  1P3O A;  2F8N B;  3AZI D;  3X1V D;  2FJ7 C;  4Z5T B;  3EPH A;  5CPK D;  4CAY B;  2Y2O A;  3AZK C;  3WA9 D;  5AV8 A;  1P3P B;  3AZG C;  4E45 A;  2NZD B;  1HTA A;  2CV5 D;  5B0Y A;  4G91 C;  2Y2J A;  5AV9 C;  2DF4 C;  5B33 A;  5DNM D;  1U35 A;  3MGR A;  2PYO D;  4YS3 B;  2Y2L A;  1P3F C;  3X1U A;  4AWL B;  1R4V A;  3UTB A;  3WTP D;  5DNN B;  5B24 B;  3VH6 A;  2CWE A;  4Z5T C;  1P3I C;  2G5I C;  4Z2M G;  5GT0 B;  4UPK A;  3AZE B;  2BYM B;  3A1I A;  3AZM D;  3LZ0 D;  1P3M C;  2HUE C;  3AZH A;  3WKJ A;  1M19 A;  1H3O B;  5B31 C;  4NE6 A;  3W97 C;  5CPJ C;  4ZUX B;  2FJ7 A;  4YS3 C;  4H9O B;  1KX4 C;  2HIO C;  5AV5 D;  3KWQ B;  3X1T B;  3REJ B;  1TAF A;  4Z66 C;  5B24 C;  5BNV A;  3AZK A;  3AZG A;  3MGS D;  2RVQ D;  5AV9 A;  3W98 B;  3AL0 C;  5B2I B;  1TZY C;  4Z2M H;  3MNN D;  1EQZ D;  4KUD C;  3C1B B;  2ZY3 A;  5B2J B;  3AZJ B;  3C1C B;  2L5A A;  1P3F A;  3VH6 W;  2YFW B;  4LD9 D;  3LEL B;  3REH D;  3V9R A;  4Z5T A;  1P3I A;  5AV6 B;  4WU9 B;  2Y2H A;  3KWQ C;  3W96 C;  1M18 B;  2IO5 B;  4WU8 C;  5GSU D;  3AZF D;  1KX3 D;  4J8X D;  1P3M A;  3VH5 T;  2LY8 A;  3W98 C;  5B2I C;  3TU4 D;  3REK B;  3C1B C;  5B31 A;  1ID3 B;  3LJA B;  3B6G B;  3W97 A;  5CPJ A;  3AFA B;  3REL D;  1P3O B;  4YS3 A;  3C1C C;  1KX4 A;  2HIO A;  2NQB D;  3IP4 C;  4Z66 A;  5B24 A;  3LEL C;  1P3B C;  5AV6 C;  4WU9 C;  1KX5 B;  5AV8 B;  1AOI D;  5CPI D;  5B0Y B;  2RIQ A;  3B6F C;  2BYM A;  1TZY A;  5C3I B;  4KUD A;  5E5A D;  2VQR A;  1P3L C;  1M1A D;  4JJN D;  1B67 A;  5B33 B;  4XZQ C;  4KGC C;  5F99 C;  3REK C;  1U35 B;  5CHL B;  1F66 C;  3MGR B;  4QLC C;  3B6G C;  1ZLA D;  5B1M C;  3UTB B;  3AV2 C;  3AN2 C;  3KWQ A;  4ZBJ C;  3W96 A;  2F8N G;  3X1V C;  3AZN D;  1P34 D;  4WU8 A;  3F6T A;  1KX5 C;  3UT9 D;  5CPK C;  3B0C T;  1HQ3 D;  1P3A D;  5B0Z B;  4XUJ D;  3W98 A;  3A6N C;  1T3U A;  4J8W D;  5B2I A;  3UTA B;  2CV5 C;  3C1B A;  1Q9C A;  4H9N A;  5AVC D;  1M19 B;  3AYW C;  3C1C A;  5FUG A;  5DNM C;  2FJ7 B;  2PYO C;  3MVD D;  3LEL A;  1N1J B;  1P3B A;  4J8U D;  5AV6 A;  1TAF B;  3AZK B;  4WU9 A;  5BNV B;  3KXB D;  4G91 B;  3B6F A;  4YM6 B;  1P3L A;  5B0Z C;  4XZQ A;  4KGC A;  3MGQ D;  5B1L D;  5F99 A;  3REK A;  5GT3 D;  3UTA C;  1F66 A;  4QLC A;  3LZ0 C;  3AV1 B;  3B6G A;  5B1M A; 
#chains in the Genus database with same CATH homology
 3X1S C;  3AV2 A;  3AN2 A;  4J8V B;  3V9R B;  1P3I B;  1KU5 A;  3X1V A;  2XD1 A;  2JCH A;  1KX5 A;  5CPK A;  2ARO D;  3WTP E;  3A6N A;  5AVB D;  4G92 B;  1P3M B;  2HUE B;  2CV5 A;  4YM6 C;  5CP6 D;  4R8P B;  3MGS C;  3AYW A;  5GXQ D;  2YFV A;  5B31 B;  3W97 B;  5DNM A;  1EQZ C;  5CPJ B;  3AV1 C;  2PYO A;  1KX4 B;  2HIO B;  2ZM5 A;  4Z66 B;  4WV4 B;  5BNX A;  3AZL B;  3R45 A;  4X23 C;  4J8V C;  3LZ1 B;  4LD9 C;  5JRG B;  3EG5 B;  1TZY B;  5B0Z A;  4KUD B;  5GSU C;  4G92 C;  3UTA A;  1B6W A;  3LZ0 A;  5AY8 D;  4R8P C;  3A1K A;  4J8X C;  3W99 D;  3X1S A;  3O62 D;  1P3K C;  3X1U D;  2JSS A;  1N1J A;  3REL C;  3W96 B;  3AZL C;  5B32 D;  4WU8 B;  3WAA D;  3LZ1 C;  5JRG C;  3MGP D;  4DRB A;  4YM6 A;  4WZS B;  3MGS A;  2G5H C;  1AOI C;  2Y2N A;  3AZH D;  3WKJ D;  4H9N B;  1EQZ A;  5E5A C;  1S32 D;  3AV1 A;  5FUG B;  4JJN C;  4DRA A;  4X23 A;  4J8V A;  1P3B B;  4LD9 A;  3AZK D;  3AZG D;  4CSR A;  3B6F B;  1BFM A;  3AZN C;  5B32 G;  1P34 C;  5AV9 D;  3KUY D;  5GSU A;  1P3L B;  4NFT A;  3REI D;  4XZQ B;  3UT9 C;  4KGC B;  4R8P A;  5F99 B;  1HQ3 C;  4J8X A;  1P3A C;  1F66 B;  4XUJ C;  4J8W C;  4QLC B;  2FFF B;  1P3G D;  5B1M B;  3AV2 B;  1P3K A;  3AN2 B;  2F8N D;  3REL A;  2Y2Q A;  4ZBJ B;  3AZI B;  3X1V B;  4Z5T D;  3AZL A;  3LZ1 A;  5CPK B;  5JRG A;  3MVD C;  5B40 C;  1P3P D;  2NZD D;  3A6N B;  1AOI A;  2CV5 B;  3AYW B;  5E5A A;  2YFV B;  4JJN A;  5B31 D;  5DNM B;  3MGQ C;  3W97 D;  2DQN C;  5GT3 C;  2PYO B;  4YS3 D;  5JA4 A;  5BNX B;  5DNN D;  3R45 B;  5B24 D;  3WTP B;  3AZI C;  4WJ3 C;  4EO5 B;  1P3F B;  5GT0 D;  3AZN A;  1P34 A;  4H9Q A;  3AZE D;  3UT9 A;  2ARO C;  3WA9 C;  1HQ3 A;  4H9P B;  1P3A A;  4H9R A;  3NQJ B;  4XUJ A;  4J8W A;  3AZM B;  3LZ0 B;  5AVB C;  1Z2C B;  3X1S B;  5CP6 C;  2J8P A;  1WWS A;  3VH6 T;  5GXQ C;  5B31 G;  4ZUX D;  2Y2M A;  4HGA C;  3FDD A;  3KWQ D;  3X1T D;  3REJ D;  3MVD A;  2UWX A;  5B40 A;  3WTP C;  3NQU A;  4EO5 C;  1WWI A;  2Y2P A;  3MGS B;  2F8N H;  3W98 D;  5B2I D;  3EPL A;  3C1B D;  5B2J D;  3MNN B;  3AZM C;  1EQZ B;  3MGQ A;  5GT3 A;  3AZJ D;  3C1C D;  3VH5 A;  1BH9 B;  5AY8 C;  3W99 C;  4X23 B;  3LEL D;  3AZI A;  4LD9 B;  3O62 C;  5AV6 D;  4WU9 D;  3REH B;  5BO0 A;  4CSR B;  3EPJ A;  5AV5 C;  1M18 D;  3B6F D;  2ARO A;  3WA9 A;  5B32 C;  5GSU B;  3WAA C;  1KX3 B;  5AVB A;  4J8X B;  4KGC D;  1BH8 B;  2RVQ C;  3MGP C;  3REK D;  3TU4 B;  5CP6 A;  2BYK A;  4E44 A;  1F66 D;  3MNN C;  1ID3 D;  3LJA D;  3B6G D;  5GXQ A;  1P3K B;  3AFA D;  1P3O D;  3REL B;  3B0D C;  3AN2 D;  1F1E A;  1S32 C;  3P5J B;  2NQB B;  2JE5 A;  3WTP A;  1KX5 D;  3H0M C;  3REH C;  5AV8 D;  5B0Y D;  3A6N D;  5CPI B;  1AOI B;  4WNN A;  4H9P A;  3AZF C;  3NQJ A;  3AZM A;  5E5A B;  5B33 D;  3KUY C;  1M1A B;  3AYW D;  2Y2I A;  3VH5 W;  4JJN B;  3REI C;  1KX3 C;  1U35 D;  5AY8 A;  3TU4 C;  3MGR D;  3W99 A;  5JA4 B;  1P3G C;  3UTB D;  1ZLA B;  3O62 A;  2ZY5 A;  2BG1 A;  5BT1 D;  5AV5 A;  2NQB C;  3H0R C;  3AZN B;  1P34 B;  5B32 A;  4H9Q B;  3WAA A;  3UT9 B;  5B0Z D;  1ULY A;  1HQ3 B;  5CPI C;  3MGP A;  4H9R B;  4XUJ B;  1P3A B;  4J8W B;  1P3P C;  2NZD C;  3UTA D;  4H9S C;  3MNN A;  1M19 D;  1M1A C;  5AVC B;  3X1S D;  2ZY2 A;  1BH9 A;  4UUZ A;  1S32 A;  4DQY B;  5KDM B;  2FJ7 D;  1ZLA C;  3MVD B;  5B40 B;  3REH A;  4J8U B;  4AWL C;  3NQU B;  5DNN C;  3KXB B;  3AZF A;  4YM6 D;  5GT0 C;  3B0C W;  2F2A C;  1KX3 A;  3KUY A;  3AZE C;  1BH8 A;  3REI A;  3MGQ B;  5B1L B;  5G49 A;  3TU4 A;  3H0L C;  1JFI A;  5GT3 B;  3AV1 D;  1P3F D;  4KHA B;  5AVC C;  1P3G A;  4X23 D;  4J8V D;  1P3I D;  2Y2K A;  2F8N A;  2NQB A;  5BO0 B;  4ZUX C;  1PZR A;  2W8S A;  4CAY A;  4J8U C;  3X1T C;  2ARO B;  1A7W A;  3REJ C;  3WA9 B;  5CPI A;  3KXB C;  1P3P A;  2NZD A;  1P3M D;  5AVB B;  4H9S A;  4R8P D;  1M1A A;  5CP6 B;  2BYK B;  5GXQ B;  5B1L C;  5CPJ D;  5B2J C;  1P3K D;  4HGA B;  1KX4 D;  2HIO D;  2Y2G A;  3AZJ C;  3B0B A;  1ZLA A;  2XD5 A;  4Z66 D;  4NE5 A;  3AZL D;  5DNN A;  3LZ1 D;  5JRG D;  3KFU G;  5GT0 A;  1TZY D;  4WNN B;  3AZE A;  1M18 C;  2IO5 C;  4KUD D;  5AY8 B;  5AVC A;  3W99 B;  5KDM A;  1H3O A;  1ID3 C;  3O62 B;  3LJA C;  3X1U B;  5BS7 C;  4ZUX A;  3AFA C;  3EPK A;  4H9O A;  1P3O C;  5AV5 B;  3W96 D;  4NE3 A;  4J8U A;  4WU8 D;  3X1T A;  3REJ A;  5B32 B;  3KXB A;  3WAA B;  3KSY A;  2ZY4 A;  5AV8 C;  3MGP B;  2F8N K;  5B0Y C;  5B1L A;  5C3I C;  3AZH B;  4M6B A;  3WKJ B;  5B2J A;  4UUZ B;  3B0D B;  5B33 C;  1S32 B;  4KHA A;  3AZJ A;  1U35 C;  3MGR C;  1W2E A;  1P3B D;  2YFW A;  3X1U C;  5B40 D;  3UTB C;  3AZG B;  5BT1 C;  1M18 A;  3AZF B;  1P3L D;  5AV9 B;  3KUY B;  4XZQ D;  3REI B;  5F99 D;  5G49 B;  4QLC D;  1JFI B;  5B1M D;  3AZH C;  3WKJ C;  1P3G B;  1ID3 A;  3LJA A;  3AV2 D;  1M19 C;  5BS7 A;  3AFA A;  1P3O A;  2F8N B;  3AZI D;  3X1V D;  2FJ7 C;  4Z5T B;  3EPH A;  5CPK D;  4CAY B;  2Y2O A;  3AZK C;  3WA9 D;  5AV8 A;  1P3P B;  3AZG C;  4E45 A;  2NZD B;  1HTA A;  2CV5 D;  5B0Y A;  4G91 C;  2Y2J A;  5AV9 C;  2DF4 C;  5B33 A;  5DNM D;  1U35 A;  3MGR A;  2PYO D;  4YS3 B;  2Y2L A;  1P3F C;  3X1U A;  4AWL B;  1R4V A;  3UTB A;  3WTP D;  5DNN B;  5B24 B;  3VH6 A;  2CWE A;  4Z5T C;  1P3I C;  2G5I C;  4Z2M G;  5GT0 B;  4UPK A;  3AZE B;  2BYM B;  3A1I A;  3AZM D;  3LZ0 D;  1P3M C;  2HUE C;  3AZH A;  3WKJ A;  1M19 A;  1H3O B;  5B31 C;  4NE6 A;  3W97 C;  5CPJ C;  4ZUX B;  2FJ7 A;  4YS3 C;  4H9O B;  1KX4 C;  2HIO C;  5AV5 D;  3KWQ B;  3X1T B;  3REJ B;  1TAF A;  4Z66 C;  5B24 C;  5BNV A;  3AZK A;  3AZG A;  3MGS D;  2RVQ D;  5AV9 A;  3W98 B;  3AL0 C;  5B2I B;  1TZY C;  4Z2M H;  3MNN D;  1EQZ D;  4KUD C;  3C1B B;  2ZY3 A;  5B2J B;  3AZJ B;  3C1C B;  2L5A A;  1P3F A;  3VH6 W;  2YFW B;  4LD9 D;  3LEL B;  3REH D;  3V9R A;  4Z5T A;  1P3I A;  5AV6 B;  4WU9 B;  2Y2H A;  3KWQ C;  3W96 C;  1M18 B;  2IO5 B;  4WU8 C;  5GSU D;  3AZF D;  1KX3 D;  4J8X D;  1P3M A;  3VH5 T;  2LY8 A;  3W98 C;  5B2I C;  3TU4 D;  3REK B;  3C1B C;  5B31 A;  1ID3 B;  3LJA B;  3B6G B;  3W97 A;  5CPJ A;  3AFA B;  3REL D;  1P3O B;  4YS3 A;  3C1C C;  1KX4 A;  2HIO A;  2NQB D;  3IP4 C;  4Z66 A;  5B24 A;  3LEL C;  1P3B C;  5AV6 C;  4WU9 C;  1KX5 B;  5AV8 B;  1AOI D;  5CPI D;  5B0Y B;  2RIQ A;  3B6F C;  2BYM A;  1TZY A;  5C3I B;  4KUD A;  5E5A D;  2VQR A;  1P3L C;  1M1A D;  4JJN D;  1B67 A;  5B33 B;  4XZQ C;  4KGC C;  5F99 C;  3REK C;  1U35 B;  5CHL B;  1F66 C;  3MGR B;  4QLC C;  3B6G C;  1ZLA D;  5B1M C;  3UTB B;  3AV2 C;  3AN2 C;  3KWQ A;  4ZBJ C;  3W96 A;  2F8N G;  3X1V C;  3AZN D;  1P34 D;  4WU8 A;  3F6T A;  1KX5 C;  3UT9 D;  5CPK C;  3B0C T;  1HQ3 D;  1P3A D;  5B0Z B;  4XUJ D;  3W98 A;  3A6N C;  1T3U A;  4J8W D;  5B2I A;  3UTA B;  2CV5 C;  3C1B A;  1Q9C A;  4H9N A;  5AVC D;  1M19 B;  3AYW C;  3C1C A;  5FUG A;  5DNM C;  2FJ7 B;  2PYO C;  3MVD D;  3LEL A;  1N1J B;  1P3B A;  4J8U D;  5AV6 A;  1TAF B;  3AZK B;  4WU9 A;  5BNV B;  3KXB D;  4G91 B;  3B6F A;  4YM6 B;  1P3L A;  5B0Z C;  4XZQ A;  4KGC A;  3MGQ D;  5B1L D;  5F99 A;  3REK A;  5GT3 D;  3UTA C;  1F66 A;  4QLC A;  3LZ0 C;  3AV1 B;  3B6G A;  5B1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...