1IDIA

The nmr solution structure of alpha-bungarotoxin
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-BUNGAROTOXIN
publication title The solution structure of the complex formed between alpha-bungarotoxin and an 18-mer cognate peptide derived from the alpha 1 subunit of the nicotinic acetylcholine receptor from Torpedo californica.
pubmed doi rcsb
molecule tags Toxin
total genus 2
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1idiA00
1CDSA 1CXNA 1HC9B 1IK8A 2CTXA 1FF4A 5EBXA 3KFDE 1BTEA 4BDTB 5IMYC 2MUPA 4IYEA 1CXOA 2HLQA 1W6BA 3U74U 1JE9A 1KS6A 1XT3A 2MFAA 2UX2A 1IKCA 1KBSA 1NORA 1LXGA 3NH7A 1PLOA 1NYSA 3EVSC 2JVEA 2QJ9C 1CDQA 2VLWA 1KFHA 4OM5A 1LSIA 1ERGA 1JGKA 3ERAA 2MHYA 3KFDI 2H5FA 4HQPF 5DU1A 1UG4A 4LFTA 1CCQA 1IDIA 2PJYB 1VB0A 2OFSA 1KTZB 3U73U 4EY8B 1KBTA 2UWRA 2LCRA 1FSSB 2L03A 1M9ZA 1NTNA 1V6PA 2MJYA 4XJJA 2L5SA 1F94A 1HAAA 2QC1A 1CDTA 2BHIA 2QJBC 1CREA 3BT2U 3EBXA 4RUDA 1CRFA 1HAJA 1HOYA 1RGJA 2CRTA 1LJZA 1QKDA 2CDXA 3PLCA 1NYUA 2H7ZA 2H62C 2JQPA 4P7UA 1IJCA 1LX5B 1NTXA 1F8UB 1LXHA 2PJYC 2H64B 2K3GA 1HC9A 1DRSA 2ERAA 2FD6U 1MAHF 2H8UA 4OM4A 1CVOA 2MJ4A 2QJAC 1KBAA 1NXBA 2N99A 3VTSA 2HLRA 1REWC 2X8BB 1FRAA 6EBXA 4AEAA 1G6MA 5DZ5A 1KL8A 3QB4B 1CTXA 1H0JA 1NEAA 3NDSA 1TXBA 2CCXA 4BIKB 2J8BA 1ZADA 3LAQU 3NEQA 5DO6A 1FFJA 1I02A 2H7ZB 3HH7A 1TXAA 1JBDA 1FASA 1KXIA 1YWHA 1CODA 1L4WA 1RL5A 1ES7B 2ABXA 2LA1A 1IDLA 3BT1U 1TFSA 4ZQYA 1CHVS 2H64C 2GOOB 1IQ9A 1ABTA 2GOOC 1ERAA 1MR6A 1S4YA 2MJ0A 1CB9A 4UY2C 1KC4A 2H62D 5IMTD 4FAOE 1TGXA 1B41B 1KU6B 1CDRA 4FAOC 1QKEA 1ONJA 1QM7A 1IDGA 2CRSA 2BTXA 2I9BE 2MUOA 1BXPA 1IDHA 3FEVA 2NBTA 1FSCA 4QTIU 1COEA 4DO8A
chains in the Genus database with same CATH superfamily
1CDSA 1CXNA 1HC9B 1IK8A 2CTXA 1FF4A 5EBXA 3KFDE 1BTEA 4BDTB 5IMYC 2MUPA 4IYEA 1CXOA 2HLQA 1W6BA 3U74U 1JE9A 1KS6A 1XT3A 2MFAA 2UX2A 1IKCA 1KBSA 1NORA 1LXGA 3NH7A 1PLOA 1NYSA 3EVSC 2JVEA 2QJ9C 1CDQA 2VLWA 1KFHA 4OM5A 1LSIA 1ERGA 1JGKA 3ERAA 2MHYA 3KFDI 2H5FA 4HQPF 5DU1A 1UG4A 4LFTA 1CCQA 1IDIA 2PJYB 1VB0A 2OFSA 1KTZB 3U73U 4EY8B 1KBTA 2UWRA 2LCRA 1FSSB 2L03A 1M9ZA 1NTNA 1V6PA 2MJYA 4XJJA 2L5SA 1F94A 1HAAA 2QC1A 1CDTA 2BHIA 2QJBC 1CREA 3BT2U 3EBXA 4KSNA 4RUDA 1CRFA 1HAJA 1HOYA 1RGJA 2CRTA 1LJZA 1QKDA 2CDXA 3PLCA 1NYUA 2H7ZA 2H62C 2JQPA 4P7UA 1IJCA 1LX5B 1NTXA 1F8UB 1LXHA 2PJYC 2H64B 2K3GA 1HC9A 1DRSA 2ERAA 2FD6U 1MAHF 2H8UA 4OM4A 1CVOA 2MJ4A 2QJAC 1KBAA 1NXBA 2N99A 3VTSA 2HLRA 1REWC 2X8BB 1FRAA 6EBXA 4AEAA 1G6MA 5DZ5A 1KL8A 3QB4B 1CTXA 1H0JA 1NEAA 3NDSA 1TXBA 2CCXA 4BIKB 2J8BA 1ZADA 3LAQU 3NEQA 5DO6A 1FFJA 1I02A 2H7ZB 3HH7A 1TXAA 1JBDA 1FASA 1KXIA 1YWHA 1CODA 1L4WA 1RL5A 1ES7B 2ABXA 2LA1A 1IDLA 3BT1U 1TFSA 4ZQYA 1CHVS 2H64C 2GOOB 1IQ9A 1ABTA 2GOOC 1ERAA 1MR6A 1S4YA 2MJ0A 1CB9A 4UY2C 1KC4A 2H62D 5IMTD 4FAOE 1TGXA 1B41B 1KU6B 1CDRA 4FAOC 1QKEA 1ONJA 1QM7A 1IDGA 2CRSA 2BTXA 2I9BE 2MUOA 1BXPA 1IDHA 3FEVA 2NBTA 1FSCA 4QTIU 1COEA 4DO8A
chains in the Genus database with same CATH topology
1CDSA 1CXNA 1HC9B 1IK8A 2CTXA 1FF4A 5EBXA 3KFDE 1BTEA 4BDTB 5IMYC 2MUPA 4IYEA 1CXOA 2HLQA 1W6BA 3U74U 1JE9A 1KS6A 1XT3A 2MFAA 2UX2A 1IKCA 1KBSA 1NORA 1LXGA 3NH7A 1PLOA 1NYSA 3EVSC 2JVEA 2QJ9C 1CDQA 2VLWA 1KFHA 4OM5A 1LSIA 1ERGA 1JGKA 3ERAA 2MHYA 3KFDI 2H5FA 4HQPF 5DU1A 1UG4A 4LFTA 1CCQA 1IDIA 2PJYB 1VB0A 2OFSA 1KTZB 3U73U 4EY8B 1KBTA 2UWRA 2LCRA 1FSSB 2L03A 1M9ZA 1NTNA 1V6PA 2MJYA 4XJJA 2L5SA 1F94A 1HAAA 2QC1A 1CDTA 2BHIA 2QJBC 1CREA 3BT2U 3EBXA 4KSNA 4RUDA 1CRFA 1HAJA 1HOYA 1RGJA 2CRTA 1LJZA 1QKDA 2CDXA 3PLCA 1NYUA 2H7ZA 2H62C 2JQPA 4P7UA 1IJCA 1LX5B 1NTXA 1F8UB 1LXHA 2PJYC 2H64B 2K3GA 1HC9A 1DRSA 2ERAA 2FD6U 1MAHF 2H8UA 4OM4A 1CVOA 2MJ4A 2QJAC 1KBAA 1NXBA 2N99A 3VTSA 2HLRA 1REWC 2X8BB 1FRAA 6EBXA 4AEAA 1G6MA 5DZ5A 1KL8A 3QB4B 1CTXA 1H0JA 1NEAA 3NDSA 1TXBA 2CCXA 4BIKB 2J8BA 1ZADA 3LAQU 3NEQA 5DO6A 1FFJA 1I02A 2H7ZB 3HH7A 1TXAA 1JBDA 1FASA 1KXIA 1YWHA 1CODA 1L4WA 1RL5A 1ES7B 2ABXA 2LA1A 1IDLA 3BT1U 1TFSA 4ZQYA 1CHVS 2H64C 2GOOB 1IQ9A 1ABTA 2GOOC 1ERAA 1MR6A 1S4YA 2MJ0A 1CB9A 4UY2C 1KC4A 2H62D 5IMTD 4FAOE 1TGXA 1B41B 1KU6B 1CDRA 4FAOC 1QKEA 1ONJA 1QM7A 1IDGA 2CRSA 2BTXA 2I9BE 2MUOA 1BXPA 1IDHA 3FEVA 2NBTA 1FSCA 4QTIU 1COEA 4DO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CDS A;  1CXN A;  1HC9 B;  1IK8 A;  2CTX A;  1FF4 A;  5EBX A;  3KFD E;  1BTE A;  4BDT B;  5IMY C;  2MUP A;  4IYE A;  1CXO A;  2HLQ A;  1W6B A;  3U74 U;  1JE9 A;  1KS6 A;  1XT3 A;  2MFA A;  2UX2 A;  1IKC A;  1KBS A;  1NOR A;  1LXG A;  3NH7 A;  1PLO A;  1NYS A;  3EVS C;  2JVE A;  2QJ9 C;  1CDQ A;  2VLW A;  1KFH A;  4OM5 A;  1LSI A;  1ERG A;  1JGK A;  3ERA A;  2MHY A;  3KFD I;  2H5F A;  4HQP F;  5DU1 A;  1UG4 A;  4LFT A;  1CCQ A;  1IDI A;  2PJY B;  1VB0 A;  2OFS A;  1KTZ B;  3U73 U;  4EY8 B;  1KBT A;  2UWR A;  2LCR A;  1FSS B;  2L03 A;  1M9Z A;  1NTN A;  1V6P A;  2MJY A;  4XJJ A;  2L5S A;  1F94 A;  1HAA A;  2QC1 A;  1CDT A;  2BHI A;  2QJB C;  1CRE A;  3BT2 U;  3EBX A;  4RUD A;  1CRF A;  1HAJ A;  1HOY A;  1RGJ A;  2CRT A;  1LJZ A;  1QKD A;  2CDX A;  3PLC A;  1NYU A;  2H7Z A;  2H62 C;  2JQP A;  4P7U A;  1IJC A;  1LX5 B;  1NTX A;  1F8U B;  1LXH A;  2PJY C;  2H64 B;  2K3G A;  1HC9 A;  1DRS A;  2ERA A;  2FD6 U;  1MAH F;  2H8U A;  4OM4 A;  1CVO A;  2MJ4 A;  2QJA C;  1KBA A;  1NXB A;  2N99 A;  3VTS A;  2HLR A;  1REW C;  2X8B B;  1FRA A;  6EBX A;  4AEA A;  1G6M A;  5DZ5 A;  1KL8 A;  3QB4 B;  1CTX A;  1H0J A;  1NEA A;  3NDS A;  1TXB A;  2CCX A;  4BIK B;  2J8B A;  1ZAD A;  3LAQ U;  3NEQ A;  5DO6 A;  1FFJ A;  1I02 A;  2H7Z B;  3HH7 A;  1TXA A;  1JBD A;  1FAS A;  1KXI A;  1YWH A;  1COD A;  1L4W A;  1RL5 A;  1ES7 B;  2ABX A;  2LA1 A;  1IDL A;  3BT1 U;  1TFS A;  4ZQY A;  1CHV S;  2H64 C;  2GOO B;  1IQ9 A;  1ABT A;  2GOO C;  1ERA A;  1MR6 A;  1S4Y A;  2MJ0 A;  1CB9 A;  4UY2 C;  1KC4 A;  2H62 D;  5IMT D;  4FAO E;  1TGX A;  1B41 B;  1KU6 B;  1CDR A;  4FAO C;  1QKE A;  1ONJ A;  1QM7 A;  1IDG A;  2CRS A;  2BTX A;  2I9B E;  2MUO A;  1BXP A;  1IDH A;  3FEV A;  2NBT A;  1FSC A;  4QTI U;  1COE A;  4DO8 A; 
#chains in the Genus database with same CATH topology
 1CDS A;  1CXN A;  1HC9 B;  1IK8 A;  2CTX A;  1FF4 A;  5EBX A;  3KFD E;  1BTE A;  4BDT B;  5IMY C;  2MUP A;  4IYE A;  1CXO A;  2HLQ A;  1W6B A;  3U74 U;  1JE9 A;  1KS6 A;  1XT3 A;  2MFA A;  2UX2 A;  1IKC A;  1KBS A;  1NOR A;  1LXG A;  3NH7 A;  1PLO A;  1NYS A;  3EVS C;  2JVE A;  2QJ9 C;  1CDQ A;  2VLW A;  1KFH A;  4OM5 A;  1LSI A;  1ERG A;  1JGK A;  3ERA A;  2MHY A;  3KFD I;  2H5F A;  4HQP F;  5DU1 A;  1UG4 A;  4LFT A;  1CCQ A;  1IDI A;  2PJY B;  1VB0 A;  2OFS A;  1KTZ B;  3U73 U;  4EY8 B;  1KBT A;  2UWR A;  2LCR A;  1FSS B;  2L03 A;  1M9Z A;  1NTN A;  1V6P A;  2MJY A;  4XJJ A;  2L5S A;  1F94 A;  1HAA A;  2QC1 A;  1CDT A;  2BHI A;  2QJB C;  1CRE A;  3BT2 U;  3EBX A;  4KSN A;  4RUD A;  1CRF A;  1HAJ A;  1HOY A;  1RGJ A;  2CRT A;  1LJZ A;  1QKD A;  2CDX A;  3PLC A;  1NYU A;  2H7Z A;  2H62 C;  2JQP A;  4P7U A;  1IJC A;  1LX5 B;  1NTX A;  1F8U B;  1LXH A;  2PJY C;  2H64 B;  2K3G A;  1HC9 A;  1DRS A;  2ERA A;  2FD6 U;  1MAH F;  2H8U A;  4OM4 A;  1CVO A;  2MJ4 A;  2QJA C;  1KBA A;  1NXB A;  2N99 A;  3VTS A;  2HLR A;  1REW C;  2X8B B;  1FRA A;  6EBX A;  4AEA A;  1G6M A;  5DZ5 A;  1KL8 A;  3QB4 B;  1CTX A;  1H0J A;  1NEA A;  3NDS A;  1TXB A;  2CCX A;  4BIK B;  2J8B A;  1ZAD A;  3LAQ U;  3NEQ A;  5DO6 A;  1FFJ A;  1I02 A;  2H7Z B;  3HH7 A;  1TXA A;  1JBD A;  1FAS A;  1KXI A;  1YWH A;  1COD A;  1L4W A;  1RL5 A;  1ES7 B;  2ABX A;  2LA1 A;  1IDL A;  3BT1 U;  1TFS A;  4ZQY A;  1CHV S;  2H64 C;  2GOO B;  1IQ9 A;  1ABT A;  2GOO C;  1ERA A;  1MR6 A;  1S4Y A;  2MJ0 A;  1CB9 A;  4UY2 C;  1KC4 A;  2H62 D;  5IMT D;  4FAO E;  1TGX A;  1B41 B;  1KU6 B;  1CDR A;  4FAO C;  1QKE A;  1ONJ A;  1QM7 A;  1IDG A;  2CRS A;  2BTX A;  2I9B E;  2MUO A;  1BXP A;  1IDH A;  3FEV A;  2NBT A;  1FSC A;  4QTI U;  1COE A;  4DO8 A; 
#chains in the Genus database with same CATH homology
 1CDS A;  1CXN A;  1HC9 B;  1IK8 A;  2CTX A;  1FF4 A;  5EBX A;  3KFD E;  1BTE A;  4BDT B;  5IMY C;  2MUP A;  4IYE A;  1CXO A;  2HLQ A;  1W6B A;  3U74 U;  1JE9 A;  1KS6 A;  1XT3 A;  2MFA A;  2UX2 A;  1IKC A;  1KBS A;  1NOR A;  1LXG A;  3NH7 A;  1PLO A;  1NYS A;  3EVS C;  2JVE A;  2QJ9 C;  1CDQ A;  2VLW A;  1KFH A;  4OM5 A;  1LSI A;  1ERG A;  1JGK A;  3ERA A;  2MHY A;  3KFD I;  2H5F A;  4HQP F;  5DU1 A;  1UG4 A;  4LFT A;  1CCQ A;  1IDI A;  2PJY B;  1VB0 A;  2OFS A;  1KTZ B;  3U73 U;  4EY8 B;  1KBT A;  2UWR A;  2LCR A;  1FSS B;  2L03 A;  1M9Z A;  1NTN A;  1V6P A;  2MJY A;  4XJJ A;  2L5S A;  1F94 A;  1HAA A;  2QC1 A;  1CDT A;  2BHI A;  2QJB C;  1CRE A;  3BT2 U;  3EBX A;  4KSN A;  4RUD A;  1CRF A;  1HAJ A;  1HOY A;  1RGJ A;  2CRT A;  1LJZ A;  1QKD A;  2CDX A;  3PLC A;  1NYU A;  2H7Z A;  2H62 C;  2JQP A;  4P7U A;  1IJC A;  1LX5 B;  1NTX A;  1F8U B;  1LXH A;  2PJY C;  2H64 B;  2K3G A;  1HC9 A;  1DRS A;  2ERA A;  2FD6 U;  1MAH F;  2H8U A;  4OM4 A;  1CVO A;  2MJ4 A;  2QJA C;  1KBA A;  1NXB A;  2N99 A;  3VTS A;  2HLR A;  1REW C;  2X8B B;  1FRA A;  6EBX A;  4AEA A;  1G6M A;  5DZ5 A;  1KL8 A;  3QB4 B;  1CTX A;  1H0J A;  1NEA A;  3NDS A;  1TXB A;  2CCX A;  4BIK B;  2J8B A;  1ZAD A;  3LAQ U;  3NEQ A;  5DO6 A;  1FFJ A;  1I02 A;  2H7Z B;  3HH7 A;  1TXA A;  1JBD A;  1FAS A;  1KXI A;  1YWH A;  1COD A;  1L4W A;  1RL5 A;  1ES7 B;  2ABX A;  2LA1 A;  1IDL A;  3BT1 U;  1TFS A;  4ZQY A;  1CHV S;  2H64 C;  2GOO B;  1IQ9 A;  1ABT A;  2GOO C;  1ERA A;  1MR6 A;  1S4Y A;  2MJ0 A;  1CB9 A;  4UY2 C;  1KC4 A;  2H62 D;  5IMT D;  4FAO E;  1TGX A;  1B41 B;  1KU6 B;  1CDR A;  4FAO C;  1QKE A;  1ONJ A;  1QM7 A;  1IDG A;  2CRS A;  2BTX A;  2I9B E;  2MUO A;  1BXP A;  1IDH A;  3FEV A;  2NBT A;  1FSC A;  4QTI U;  1COE A;  4DO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...