1IDIA

The nmr solution structure of alpha-bungarotoxin
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the complex formed between alpha-bungarotoxin and an 18-mer cognate peptide derived from the alpha 1 subunit of the nicotinic acetylcholine receptor from Torpedo californica.
pubmed doi rcsb
molecule tags Toxin
molecule keywords ALPHA-BUNGAROTOXIN
total genus 2
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1idiA00
2MUPA 2H64B 3EBXA 1MAHF 2GOOC 1FASA 1CCQA 3ERAA 3LAQU 2I9BE 1KU6B 2H7ZA 1HOYA 6EBXA 2LCRA 1NEAA 3NH7A 2VLWA 2CCXA 2CDXA 3NDSA 3VTSA 4FAOE 4UY2C 1COEA 1KFHA 1FFJA 1B41B 1HAAA 2BTXA 2MJYA 1W6BA 1JGKA 1DRSA 1CTXA 1IDIA 5IMTD 3HH7A 1F94A 2H8UA 1VB0A 2MJ0A 1KL8A 1QKDA 4RUDA 2JVEA 1FSSB 2H7ZB 4AEAA 4BDTB 2MUOA 2L03A 3KFDI 2L5SA 4DO8A 3U73U 4HQPF 1IKCA 4EY8B 1KC4A 1QM7A 1CRFA 1REWC 2NBTA 3PLCA 1F8UB 1V6PA 2H5FA 2QJ9C 1CXNA 1HAJA 1RL5A 1HC9B 2J8BA 1XT3A 5DU1A 2QC1A 1ERGA 1TXBA 3FEVA 4XJJA 1CDRA 4ZQYA 1CHVS 1CXOA 1NORA 1NXBA 2QJBC 1NYSA 1NYUA 3EVSC 1YWHA 1L4WA 1CREA 3U74U 1TFSA 1LXGA 1IDGA 2X8BB 1LSIA 1IDLA 2UX2A 5IMYC 1HC9A 1MR6A 2CRSA 1TXAA 4QTIU 2ERAA 2K3GA 1PLOA 1IK8A 2QJAC 2FD6U 1CDQA 2H64C 1ONJA 4P7UA 2HLQA 1IJCA 3QB4B 1NTNA 3KFDE 1JBDA 1S4YA 1RGJA 1LJZA 1IDHA 1M9ZA 5DO6A 1BXPA 1BTEA 2MHYA 1CVOA 1ZADA 4FAOC 2HLRA 1CDTA 1H0JA 2N99A 1JE9A 1I02A 2MJ4A 1G6MA 1ABTA 1IQ9A 5DZ5A 4LFTA 3BT2U 1LX5B 1KBSA 1KTZB 1KXIA 2PJYC 1NTXA 2ABXA 1CODA 1CDSA 3NEQA 2UWRA 4BIKB 4OM5A 2LA1A 1UG4A 1ES7B 1FF4A 2H62C 2JQPA 1KS6A 2PJYB 1KBTA 3BT1U 2MFAA 1TGXA 2CTXA 1CB9A 2H62D 1FRAA 1FSCA 1KBAA 1LXHA 2CRTA 1QKEA 4OM4A 1ERAA 2GOOB 2OFSA 4IYEA 5EBXA 2BHIA
chains in the Genus database with same CATH superfamily
2MUPA 2H64B 3EBXA 1MAHF 2GOOC 1FASA 1CCQA 3ERAA 3LAQU 4KSNA 2I9BE 1KU6B 2H7ZA 1HOYA 6EBXA 2LCRA 1NEAA 3NH7A 2VLWA 2CCXA 2CDXA 3NDSA 3VTSA 4FAOE 4UY2C 1COEA 1KFHA 1FFJA 1B41B 1HAAA 2BTXA 2MJYA 1W6BA 1JGKA 1DRSA 1CTXA 1IDIA 5IMTD 3HH7A 1F94A 2H8UA 1VB0A 2MJ0A 1KL8A 1QKDA 4RUDA 2JVEA 1FSSB 2H7ZB 4AEAA 4BDTB 2MUOA 2L03A 3KFDI 2L5SA 4DO8A 3U73U 4HQPF 1IKCA 4EY8B 1KC4A 1QM7A 1CRFA 1REWC 2NBTA 3PLCA 1F8UB 1V6PA 2H5FA 2QJ9C 1CXNA 1HAJA 1RL5A 1HC9B 2J8BA 1XT3A 5DU1A 2QC1A 1ERGA 1TXBA 3FEVA 4XJJA 1CDRA 4ZQYA 1CHVS 1CXOA 1NORA 1NXBA 2QJBC 1NYSA 1NYUA 3EVSC 1YWHA 1L4WA 1CREA 3U74U 1TFSA 1LXGA 1IDGA 2X8BB 1LSIA 1IDLA 2UX2A 5IMYC 1HC9A 1MR6A 2CRSA 1TXAA 4QTIU 2ERAA 2K3GA 1PLOA 1IK8A 2QJAC 2FD6U 1CDQA 2H64C 1ONJA 4P7UA 2HLQA 1IJCA 3QB4B 1NTNA 3KFDE 1JBDA 1S4YA 1RGJA 1LJZA 1IDHA 1M9ZA 5DO6A 1BXPA 1BTEA 2MHYA 1CVOA 1ZADA 4FAOC 2HLRA 1CDTA 1H0JA 2N99A 1JE9A 1I02A 2MJ4A 1G6MA 1ABTA 1IQ9A 5DZ5A 4LFTA 3BT2U 1LX5B 1KBSA 1KTZB 1KXIA 2PJYC 1NTXA 2ABXA 1CODA 1CDSA 3NEQA 2UWRA 4BIKB 4OM5A 2LA1A 1UG4A 1ES7B 1FF4A 2H62C 2JQPA 1KS6A 2PJYB 1KBTA 3BT1U 2MFAA 1TGXA 2CTXA 1CB9A 2H62D 1FRAA 1FSCA 1KBAA 1LXHA 2CRTA 1QKEA 4OM4A 1ERAA 2GOOB 2OFSA 4IYEA 5EBXA 2BHIA
chains in the Genus database with same CATH topology
2MUPA 2H64B 3EBXA 1MAHF 2GOOC 1FASA 1CCQA 3ERAA 3LAQU 4KSNA 2I9BE 1KU6B 2H7ZA 1HOYA 6EBXA 2LCRA 1NEAA 3NH7A 2VLWA 2CCXA 2CDXA 3NDSA 3VTSA 4FAOE 4UY2C 1COEA 1KFHA 1FFJA 1B41B 1HAAA 2BTXA 2MJYA 1W6BA 1JGKA 1DRSA 1CTXA 1IDIA 5IMTD 3HH7A 1F94A 2H8UA 1VB0A 2MJ0A 1KL8A 1QKDA 4RUDA 2JVEA 1FSSB 2H7ZB 4AEAA 4BDTB 2MUOA 2L03A 3KFDI 2L5SA 4DO8A 3U73U 4HQPF 1IKCA 4EY8B 1KC4A 1QM7A 1CRFA 1REWC 2NBTA 3PLCA 1F8UB 1V6PA 2H5FA 2QJ9C 1CXNA 1HAJA 1RL5A 1HC9B 2J8BA 1XT3A 5DU1A 2QC1A 1ERGA 1TXBA 3FEVA 4XJJA 1CDRA 4ZQYA 1CHVS 1CXOA 1NORA 1NXBA 2QJBC 1NYSA 1NYUA 3EVSC 1YWHA 1L4WA 1CREA 3U74U 1TFSA 1LXGA 1IDGA 2X8BB 1LSIA 1IDLA 2UX2A 5IMYC 1HC9A 1MR6A 2CRSA 1TXAA 4QTIU 2ERAA 2K3GA 1PLOA 1IK8A 2QJAC 2FD6U 1CDQA 2H64C 1ONJA 4P7UA 2HLQA 1IJCA 3QB4B 1NTNA 3KFDE 1JBDA 1S4YA 1RGJA 1LJZA 1IDHA 1M9ZA 5DO6A 1BXPA 1BTEA 2MHYA 1CVOA 1ZADA 4FAOC 2HLRA 1CDTA 1H0JA 2N99A 1JE9A 1I02A 2MJ4A 1G6MA 1ABTA 1IQ9A 5DZ5A 4LFTA 3BT2U 1LX5B 1KBSA 1KTZB 1KXIA 2PJYC 1NTXA 2ABXA 1CODA 1CDSA 3NEQA 2UWRA 4BIKB 4OM5A 2LA1A 1UG4A 1ES7B 1FF4A 2H62C 2JQPA 1KS6A 2PJYB 1KBTA 3BT1U 2MFAA 1TGXA 2CTXA 1CB9A 2H62D 1FRAA 1FSCA 1KBAA 1LXHA 2CRTA 1QKEA 4OM4A 1ERAA 2GOOB 2OFSA 4IYEA 5EBXA 2BHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MUP A;  2H64 B;  3EBX A;  1MAH F;  2GOO C;  1FAS A;  1CCQ A;  3ERA A;  3LAQ U;  2I9B E;  1KU6 B;  2H7Z A;  1HOY A;  6EBX A;  2LCR A;  1NEA A;  3NH7 A;  2VLW A;  2CCX A;  2CDX A;  3NDS A;  3VTS A;  4FAO E;  4UY2 C;  1COE A;  1KFH A;  1FFJ A;  1B41 B;  1HAA A;  2BTX A;  2MJY A;  1W6B A;  1JGK A;  1DRS A;  1CTX A;  1IDI A;  5IMT D;  3HH7 A;  1F94 A;  2H8U A;  1VB0 A;  2MJ0 A;  1KL8 A;  1QKD A;  4RUD A;  2JVE A;  1FSS B;  2H7Z B;  4AEA A;  4BDT B;  2MUO A;  2L03 A;  3KFD I;  2L5S A;  4DO8 A;  3U73 U;  4HQP F;  1IKC A;  4EY8 B;  1KC4 A;  1QM7 A;  1CRF A;  1REW C;  2NBT A;  3PLC A;  1F8U B;  1V6P A;  2H5F A;  2QJ9 C;  1CXN A;  1HAJ A;  1RL5 A;  1HC9 B;  2J8B A;  1XT3 A;  5DU1 A;  2QC1 A;  1ERG A;  1TXB A;  3FEV A;  4XJJ A;  1CDR A;  4ZQY A;  1CHV S;  1CXO A;  1NOR A;  1NXB A;  2QJB C;  1NYS A;  1NYU A;  3EVS C;  1YWH A;  1L4W A;  1CRE A;  3U74 U;  1TFS A;  1LXG A;  1IDG A;  2X8B B;  1LSI A;  1IDL A;  2UX2 A;  5IMY C;  1HC9 A;  1MR6 A;  2CRS A;  1TXA A;  4QTI U;  2ERA A;  2K3G A;  1PLO A;  1IK8 A;  2QJA C;  2FD6 U;  1CDQ A;  2H64 C;  1ONJ A;  4P7U A;  2HLQ A;  1IJC A;  3QB4 B;  1NTN A;  3KFD E;  1JBD A;  1S4Y A;  1RGJ A;  1LJZ A;  1IDH A;  1M9Z A;  5DO6 A;  1BXP A;  1BTE A;  2MHY A;  1CVO A;  1ZAD A;  4FAO C;  2HLR A;  1CDT A;  1H0J A;  2N99 A;  1JE9 A;  1I02 A;  2MJ4 A;  1G6M A;  1ABT A;  1IQ9 A;  5DZ5 A;  4LFT A;  3BT2 U;  1LX5 B;  1KBS A;  1KTZ B;  1KXI A;  2PJY C;  1NTX A;  2ABX A;  1COD A;  1CDS A;  3NEQ A;  2UWR A;  4BIK B;  4OM5 A;  2LA1 A;  1UG4 A;  1ES7 B;  1FF4 A;  2H62 C;  2JQP A;  1KS6 A;  2PJY B;  1KBT A;  3BT1 U;  2MFA A;  1TGX A;  2CTX A;  1CB9 A;  2H62 D;  1FRA A;  1FSC A;  1KBA A;  1LXH A;  2CRT A;  1QKE A;  4OM4 A;  1ERA A;  2GOO B;  2OFS A;  4IYE A;  5EBX A;  2BHI A; 
#chains in the Genus database with same CATH topology
 2MUP A;  2H64 B;  3EBX A;  1MAH F;  2GOO C;  1FAS A;  1CCQ A;  3ERA A;  3LAQ U;  4KSN A;  2I9B E;  1KU6 B;  2H7Z A;  1HOY A;  6EBX A;  2LCR A;  1NEA A;  3NH7 A;  2VLW A;  2CCX A;  2CDX A;  3NDS A;  3VTS A;  4FAO E;  4UY2 C;  1COE A;  1KFH A;  1FFJ A;  1B41 B;  1HAA A;  2BTX A;  2MJY A;  1W6B A;  1JGK A;  1DRS A;  1CTX A;  1IDI A;  5IMT D;  3HH7 A;  1F94 A;  2H8U A;  1VB0 A;  2MJ0 A;  1KL8 A;  1QKD A;  4RUD A;  2JVE A;  1FSS B;  2H7Z B;  4AEA A;  4BDT B;  2MUO A;  2L03 A;  3KFD I;  2L5S A;  4DO8 A;  3U73 U;  4HQP F;  1IKC A;  4EY8 B;  1KC4 A;  1QM7 A;  1CRF A;  1REW C;  2NBT A;  3PLC A;  1F8U B;  1V6P A;  2H5F A;  2QJ9 C;  1CXN A;  1HAJ A;  1RL5 A;  1HC9 B;  2J8B A;  1XT3 A;  5DU1 A;  2QC1 A;  1ERG A;  1TXB A;  3FEV A;  4XJJ A;  1CDR A;  4ZQY A;  1CHV S;  1CXO A;  1NOR A;  1NXB A;  2QJB C;  1NYS A;  1NYU A;  3EVS C;  1YWH A;  1L4W A;  1CRE A;  3U74 U;  1TFS A;  1LXG A;  1IDG A;  2X8B B;  1LSI A;  1IDL A;  2UX2 A;  5IMY C;  1HC9 A;  1MR6 A;  2CRS A;  1TXA A;  4QTI U;  2ERA A;  2K3G A;  1PLO A;  1IK8 A;  2QJA C;  2FD6 U;  1CDQ A;  2H64 C;  1ONJ A;  4P7U A;  2HLQ A;  1IJC A;  3QB4 B;  1NTN A;  3KFD E;  1JBD A;  1S4Y A;  1RGJ A;  1LJZ A;  1IDH A;  1M9Z A;  5DO6 A;  1BXP A;  1BTE A;  2MHY A;  1CVO A;  1ZAD A;  4FAO C;  2HLR A;  1CDT A;  1H0J A;  2N99 A;  1JE9 A;  1I02 A;  2MJ4 A;  1G6M A;  1ABT A;  1IQ9 A;  5DZ5 A;  4LFT A;  3BT2 U;  1LX5 B;  1KBS A;  1KTZ B;  1KXI A;  2PJY C;  1NTX A;  2ABX A;  1COD A;  1CDS A;  3NEQ A;  2UWR A;  4BIK B;  4OM5 A;  2LA1 A;  1UG4 A;  1ES7 B;  1FF4 A;  2H62 C;  2JQP A;  1KS6 A;  2PJY B;  1KBT A;  3BT1 U;  2MFA A;  1TGX A;  2CTX A;  1CB9 A;  2H62 D;  1FRA A;  1FSC A;  1KBA A;  1LXH A;  2CRT A;  1QKE A;  4OM4 A;  1ERA A;  2GOO B;  2OFS A;  4IYE A;  5EBX A;  2BHI A; 
#chains in the Genus database with same CATH homology
 2MUP A;  2H64 B;  3EBX A;  1MAH F;  2GOO C;  1FAS A;  1CCQ A;  3ERA A;  3LAQ U;  4KSN A;  2I9B E;  1KU6 B;  2H7Z A;  1HOY A;  6EBX A;  2LCR A;  1NEA A;  3NH7 A;  2VLW A;  2CCX A;  2CDX A;  3NDS A;  3VTS A;  4FAO E;  4UY2 C;  1COE A;  1KFH A;  1FFJ A;  1B41 B;  1HAA A;  2BTX A;  2MJY A;  1W6B A;  1JGK A;  1DRS A;  1CTX A;  1IDI A;  5IMT D;  3HH7 A;  1F94 A;  2H8U A;  1VB0 A;  2MJ0 A;  1KL8 A;  1QKD A;  4RUD A;  2JVE A;  1FSS B;  2H7Z B;  4AEA A;  4BDT B;  2MUO A;  2L03 A;  3KFD I;  2L5S A;  4DO8 A;  3U73 U;  4HQP F;  1IKC A;  4EY8 B;  1KC4 A;  1QM7 A;  1CRF A;  1REW C;  2NBT A;  3PLC A;  1F8U B;  1V6P A;  2H5F A;  2QJ9 C;  1CXN A;  1HAJ A;  1RL5 A;  1HC9 B;  2J8B A;  1XT3 A;  5DU1 A;  2QC1 A;  1ERG A;  1TXB A;  3FEV A;  4XJJ A;  1CDR A;  4ZQY A;  1CHV S;  1CXO A;  1NOR A;  1NXB A;  2QJB C;  1NYS A;  1NYU A;  3EVS C;  1YWH A;  1L4W A;  1CRE A;  3U74 U;  1TFS A;  1LXG A;  1IDG A;  2X8B B;  1LSI A;  1IDL A;  2UX2 A;  5IMY C;  1HC9 A;  1MR6 A;  2CRS A;  1TXA A;  4QTI U;  2ERA A;  2K3G A;  1PLO A;  1IK8 A;  2QJA C;  2FD6 U;  1CDQ A;  2H64 C;  1ONJ A;  4P7U A;  2HLQ A;  1IJC A;  3QB4 B;  1NTN A;  3KFD E;  1JBD A;  1S4Y A;  1RGJ A;  1LJZ A;  1IDH A;  1M9Z A;  5DO6 A;  1BXP A;  1BTE A;  2MHY A;  1CVO A;  1ZAD A;  4FAO C;  2HLR A;  1CDT A;  1H0J A;  2N99 A;  1JE9 A;  1I02 A;  2MJ4 A;  1G6M A;  1ABT A;  1IQ9 A;  5DZ5 A;  4LFT A;  3BT2 U;  1LX5 B;  1KBS A;  1KTZ B;  1KXI A;  2PJY C;  1NTX A;  2ABX A;  1COD A;  1CDS A;  3NEQ A;  2UWR A;  4BIK B;  4OM5 A;  2LA1 A;  1UG4 A;  1ES7 B;  1FF4 A;  2H62 C;  2JQP A;  1KS6 A;  2PJY B;  1KBT A;  3BT1 U;  2MFA A;  1TGX A;  2CTX A;  1CB9 A;  2H62 D;  1FRA A;  1FSC A;  1KBA A;  1LXH A;  2CRT A;  1QKE A;  4OM4 A;  1ERA A;  2GOO B;  2OFS A;  4IYE A;  5EBX A;  2BHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...