1IDJA

Pectin lyase a
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
359
structure length
359
Chain Sequence
VGVSGSAEGFAEGVTGGGDATPVYPDTIDELVSYLGDDEARVIVLTKTFDFTDSEGTTTGTGCAPWGTASACQVAIDQDDWCENYEPDAPSVSVEYYNAGVLGITVTSNKSLIGEGSSGAIKGKGLRIVSGAENIIIQNIAVTDINPKYVWGGDAITLDDCDLVWIDHVTTARIGRQHYVLGTSADNRVSLTNNYIDGVSDYSATCDGYHYWGIYLDGDADLVTMKGNYIYHTSGRSPKVQDNTLLHCVNNYFYDISGHAFEIGEGGYVLAEGNVFQNVDTVLETYEGAAFTVPSTTAGEVCSTYLGRDCVINGFGCSGTFSEDSTSFLSDFEGKNIASASAYTSVASRVVANAGQGNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two crystal structures of pectin lyase A from Aspergillus reveal a pH driven conformational change and striking divergence in the substrate-binding clefts of pectin and pectate lyases.
pubmed doi rcsb
molecule tags Lyase
molecule keywords PECTIN LYASE A
total genus 133
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.2.2.10: Pectin lyase.
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1idjA00
4HWVA 1IB4A 1CZFA 2QX3A 1O8JA 3GQAA 4PMHA 1O8IA 2X6XA 3ZPPA 1VBLA 1GQ8A 2QY1A 2UVFA 1KTWA 3B90A 4XKVA 1O88A 4Z06A 4YZ0A 1O8GA 3VMVA 2VJJA 4OZYA 4W8RA 3UW0A 4YZQA 1DBGA 2O0VA 4OJ5A 3JURA 4OJOA 4XLCA 3VSVA 2VBEA 3FY3A 4EW9A 1H80A 4XL9A 1XG2A 3ZSCA 1JRGA 5AMVA 4YEJA 4OJPA 1IDKA 3B4NA 4XM3A 4I84A 4Z03A 3T9GA 4AVZA 1X0CA 4URRA 4XOPA 2O0WA 1OGOX 4XLAA 1WMRA 1OOCA 4NK8A 1HG8A 2NTQA 2X6WA 3GQ9A 1DBOA 3GQ8A 4NK6A 2O04A 1OGMX 4XR6A 4YZAA 3VSTA 4XN3A 4XQFA 1O8EA 4YELA 3VMWA 2X6YA 4U49A 2INVA 4XLEA 1RMGA 4XOTA 3SUCA 1QJVA 4C2LA 1RU4A 3WWGA 1KCDA 3LMWA 4MXNA 4XMYA 4OZZA 1AIRA 1OFLA 4W8SA 1O8HA 1QCXA 2VBKA 2PYHA 1RWRA 1O8LA 2NT9A 1JTAA 3GQ7A 1PXZA 2UVEA 1O8KA 4U4BA 1EE6A 4W8TA 4XN0A 4XNFA 1KCCA 1K5CA 3EQOA 2VJIA 4XKWA 1PE9A 4XORA 2BSPA 5C1CA 1BN8A 1O8MA 1O8DA 2PECA 4OJ6A 3KRGA 1BHEA 3GRHA 2IQ7A 1NHCA 2VBMA 2NSTA 4YZXA 4XLHA 2O17A 3VSUA 1IA5A 4XLFA 3B8YA 4XONA 2NTBA 2NZMA 4MR0A 2X85A 2EWEA 1OFMA 5C1EA 4Z05A 2NT6A 2Z8GA 4W8QA 4OJLA 2NTPA 1IDJA 2QXZA 2X3HA 2NSPA 3EQNA 2O1DA 1PLUA 2INUA 2ODLA 2PYGA 1O8FA
chains in the Genus database with same CATH superfamily
4HWVA 1IB4A 1CZFA 3BH6B 1TYXA 2QX3A 1O8JA 1QQ1A 3GQAA 4PMHA 2J8IA 1O8IA 2X6XA 2VFOA 3ZPPA 1VBLA 1GQ8A 2QY1A 2UVFA 1KTWA 1LLZA 3B90A 3NB2A 1O88A 4XKVA 3SZEA 1WXRA 4Z06A 4YZ0A 1O8GA 2G0YA 3VMVA 2VJJA 4OZYA 4OM9A 1EZGA 4W8RA 3UW0A 4YZQA 1DBGA 2O0VA 4OJ5A 3JURA 4OJOA 4XLCA 3VSVA 2VBEA 2VFQA 1K4ZA 3FY3A 4EW9A 1H80A 2VFMA 4XL9A 1XG2A 3ZSCA 1OFDA 1JRGA 5AMVA 4YEJA 3BH7B 4OJPA 3LYCA 1DABA 1IDKA 2VFPA 3B4NA 4XM3A 2XT4A 2B0RA 2F3LA 1OFEA 4I84A 1QA1A 4Z03A 3T9GA 4AVZA 1X0CA 4URRA 4XOPA 2O0WA 1OGOX 2V5IA 1L1IA 1LM1A 1QA2A 4XLAA 1WMRA 1CLWA 1OOCA 3SYJA 4NK8A 1HG8A 2NTQA 2X6WA 3GQ9A 1DBOA 3GQ8A 4NK6A 4YCQA 2YUHA 2O04A 2VFNA 1OGMX 4XR6A 4YZAA 3SY2A 2J8KA 3VSTA 4XN3A 4XQFA 1O8EA 1TSPA 4YELA 4YFOA 3VMWA 2X6YA 4U49A 2INVA 4XLEA 1RMGA 4XOTA 3ML3A 3N90A 3SUCA 1QJVA 4C2LA 1HF2A 1RU4A 3DU1X 3WWGA 1KCDA 3RIQA 4YDTA 2O6WA 3LMWA 4MXNA 2IOUG 4XMYA 3PSZA 4OZZA 1AIRA 1KQ5A 1OFLA 4W8SA 1O8HA 1QCXA 2VBKA 2PYHA 1RWRA 2XTYA 2NT9A 1O8LA 1JTAA 2BM7A 1PXZA 1O8KA 2UVEA 3GQ7A 1EE6A 4OPWA 4U4BA 4W8TA 4XN0A 4XNFA 5JMCB 1KCCA 5DNSA 2BM4A 1K5CA 3EQOA 2QYUA 2XTXA 2VJIA 2XTWA 3N6ZA 4XKWA 1PE9A 4XORA 2BSPA 5C1CA 1BN8A 1TYUA 2QZAA 1O8MA 1O8DA 2PECA 1TYVA 4OJ6A 3KRGA 1BHEA 3GRHA 4KH3A 4V02C 2IQ7A 1QRCA 1NHCA 2W7ZA 1LLWA 2VBMA 3PETA 3TH0A 1QRBA 2NSTA 4YZXA 4XLHA 2O17A 3VSUA 1IA5A 3SQVA 4JRAC 3NAWA 4XLFA 3B8YA 3H09A 4XONA 2NTBA 2NZMA 4MR0A 3PSSA 2BX6A 2X85A 3AK5A 2EWEA 4YEIA 1OFMA 2XT2A 5C1EA 4YC5A 2BM5A 2NT6A 2Z8GA 4W8QA 4OJLA 4Z05A 2NTPA 1IDJA 1K8FA 2QXZA 2X3HA 3P4GA 2NSPA 3LJYA 3EQNA 2O1DA 1EA0A 1TYWA 1QA3A 1PLUA 2INUA 2XC1A 2BM6A 5JLVC 3JX8A 2ODLA 2PYGA 1O8FA
chains in the Genus database with same CATH topology
4HWVA 1IB4A 1CZFA 2QX3A 1O8JA 3GQAA 4PMHA 1O8IA 2X6XA 3ZPPA 1VBLA 1GQ8A 2QY1A 2UVFA 1KTWA 3B90A 4XKVA 1O88A 4Z06A 4YZ0A 1O8GA 3VMVA 2VJJA 4OZYA 4W8RA 3UW0A 4YZQA 1DBGA 2O0VA 4OJ5A 3JURA 4OJOA 4XLCA 3VSVA 2VBEA 3FY3A 4EW9A 1H80A 4XL9A 1XG2A 3ZSCA 1JRGA 5AMVA 4YEJA 4OJPA 1IDKA 3B4NA 4XM3A 4I84A 4Z03A 3T9GA 4AVZA 1X0CA 4URRA 4XOPA 2O0WA 1OGOX 4XLAA 1WMRA 1OOCA 4NK8A 1HG8A 2NTQA 2X6WA 3GQ9A 1DBOA 3GQ8A 4NK6A 2O04A 1OGMX 4XR6A 4YZAA 3VSTA 4XN3A 4XQFA 1O8EA 4YELA 3VMWA 2X6YA 4U49A 2INVA 4XLEA 1RMGA 4XOTA 3SUCA 1QJVA 4C2LA 1RU4A 3WWGA 1KCDA 3LMWA 4MXNA 4XMYA 4OZZA 1AIRA 1OFLA 4W8SA 1O8HA 1QCXA 2VBKA 2PYHA 1RWRA 1O8LA 2NT9A 1JTAA 3GQ7A 1PXZA 2UVEA 1O8KA 4U4BA 1EE6A 4W8TA 4XN0A 4XNFA 1KCCA 1K5CA 3EQOA 2VJIA 4XKWA 1PE9A 4XORA 2BSPA 5C1CA 1BN8A 1O8MA 1O8DA 2PECA 4OJ6A 3KRGA 1BHEA 3GRHA 2IQ7A 1NHCA 2VBMA 2NSTA 4YZXA 4XLHA 2O17A 3VSUA 1IA5A 4XLFA 3B8YA 4XONA 2NTBA 2NZMA 4MR0A 2X85A 2EWEA 1OFMA 5C1EA 4Z05A 2NT6A 2Z8GA 4W8QA 4OJLA 2NTPA 1IDJA 2QXZA 2X3HA 2NSPA 3EQNA 2O1DA 1PLUA 2INUA 2ODLA 2PYGA 1O8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWV A;  1IB4 A;  1CZF A;  2QX3 A;  1O8J A;  3GQA A;  4PMH A;  1O8I A;  2X6X A;  3ZPP A;  1VBL A;  1GQ8 A;  2QY1 A;  2UVF A;  1KTW A;  3B90 A;  4XKV A;  1O88 A;  4Z06 A;  4YZ0 A;  1O8G A;  3VMV A;  2VJJ A;  4OZY A;  4W8R A;  3UW0 A;  4YZQ A;  1DBG A;  2O0V A;  4OJ5 A;  3JUR A;  4OJO A;  4XLC A;  3VSV A;  2VBE A;  3FY3 A;  4EW9 A;  1H80 A;  4XL9 A;  1XG2 A;  3ZSC A;  1JRG A;  5AMV A;  4YEJ A;  4OJP A;  1IDK A;  3B4N A;  4XM3 A;  4I84 A;  4Z03 A;  3T9G A;  4AVZ A;  1X0C A;  4URR A;  4XOP A;  2O0W A;  1OGO X;  4XLA A;  1WMR A;  1OOC A;  4NK8 A;  1HG8 A;  2NTQ A;  2X6W A;  3GQ9 A;  1DBO A;  3GQ8 A;  4NK6 A;  2O04 A;  1OGM X;  4XR6 A;  4YZA A;  3VST A;  4XN3 A;  4XQF A;  1O8E A;  4YEL A;  3VMW A;  2X6Y A;  4U49 A;  2INV A;  4XLE A;  1RMG A;  4XOT A;  3SUC A;  1QJV A;  4C2L A;  1RU4 A;  3WWG A;  1KCD A;  3LMW A;  4MXN A;  4XMY A;  4OZZ A;  1AIR A;  1OFL A;  4W8S A;  1O8H A;  1QCX A;  2VBK A;  2PYH A;  1RWR A;  1O8L A;  2NT9 A;  1JTA A;  3GQ7 A;  1PXZ A;  2UVE A;  1O8K A;  4U4B A;  1EE6 A;  4W8T A;  4XN0 A;  4XNF A;  1KCC A;  1K5C A;  3EQO A;  2VJI A;  4XKW A;  1PE9 A;  4XOR A;  2BSP A;  5C1C A;  1BN8 A;  1O8M A;  1O8D A;  2PEC A;  4OJ6 A;  3KRG A;  1BHE A;  3GRH A;  2IQ7 A;  1NHC A;  2VBM A;  2NST A;  4YZX A;  4XLH A;  2O17 A;  3VSU A;  1IA5 A;  4XLF A;  3B8Y A;  4XON A;  2NTB A;  2NZM A;  4MR0 A;  2X85 A;  2EWE A;  1OFM A;  5C1E A;  4Z05 A;  2NT6 A;  2Z8G A;  4W8Q A;  4OJL A;  2NTP A;  1IDJ A;  2QXZ A;  2X3H A;  2NSP A;  3EQN A;  2O1D A;  1PLU A;  2INU A;  2ODL A;  2PYG A;  1O8F A; 
#chains in the Genus database with same CATH topology
 4HWV A;  1IB4 A;  1CZF A;  3BH6 B;  1TYX A;  2QX3 A;  1O8J A;  1QQ1 A;  3GQA A;  4PMH A;  2J8I A;  1O8I A;  2X6X A;  2VFO A;  3ZPP A;  1VBL A;  1GQ8 A;  2QY1 A;  2UVF A;  1KTW A;  1LLZ A;  3B90 A;  3NB2 A;  1O88 A;  4XKV A;  3SZE A;  1WXR A;  4Z06 A;  4YZ0 A;  1O8G A;  2G0Y A;  3VMV A;  2VJJ A;  4OZY A;  4OM9 A;  1EZG A;  4W8R A;  3UW0 A;  4YZQ A;  1DBG A;  2O0V A;  4OJ5 A;  3JUR A;  4OJO A;  4XLC A;  3VSV A;  2VBE A;  2VFQ A;  1K4Z A;  3FY3 A;  4EW9 A;  1H80 A;  2VFM A;  4XL9 A;  1XG2 A;  3ZSC A;  1OFD A;  1JRG A;  5AMV A;  4YEJ A;  3BH7 B;  4OJP A;  3LYC A;  1DAB A;  1IDK A;  2VFP A;  3B4N A;  4XM3 A;  2XT4 A;  2B0R A;  2F3L A;  1OFE A;  4I84 A;  1QA1 A;  4Z03 A;  3T9G A;  4AVZ A;  1X0C A;  4URR A;  4XOP A;  2O0W A;  1OGO X;  2V5I A;  1L1I A;  1LM1 A;  1QA2 A;  4XLA A;  1WMR A;  1CLW A;  1OOC A;  3SYJ A;  4NK8 A;  1HG8 A;  2NTQ A;  2X6W A;  3GQ9 A;  1DBO A;  3GQ8 A;  4NK6 A;  4YCQ A;  2YUH A;  2O04 A;  2VFN A;  1OGM X;  4XR6 A;  4YZA A;  3SY2 A;  2J8K A;  3VST A;  4XN3 A;  4XQF A;  1O8E A;  1TSP A;  4YEL A;  4YFO A;  3VMW A;  2X6Y A;  4U49 A;  2INV A;  4XLE A;  1RMG A;  4XOT A;  3ML3 A;  3N90 A;  3SUC A;  1QJV A;  4C2L A;  1HF2 A;  1RU4 A;  3DU1 X;  3WWG A;  1KCD A;  3RIQ A;  4YDT A;  2O6W A;  3LMW A;  4MXN A;  2IOU G;  4XMY A;  3PSZ A;  4OZZ A;  1AIR A;  1KQ5 A;  1OFL A;  4W8S A;  1O8H A;  1QCX A;  2VBK A;  2PYH A;  1RWR A;  2XTY A;  2NT9 A;  1O8L A;  1JTA A;  2BM7 A;  1PXZ A;  1O8K A;  2UVE A;  3GQ7 A;  1EE6 A;  4OPW A;  4U4B A;  4W8T A;  4XN0 A;  4XNF A;  5JMC B;  1KCC A;  5DNS A;  2BM4 A;  1K5C A;  3EQO A;  2QYU A;  2XTX A;  2VJI A;  2XTW A;  3N6Z A;  4XKW A;  1PE9 A;  4XOR A;  2BSP A;  5C1C A;  1BN8 A;  1TYU A;  2QZA A;  1O8M A;  1O8D A;  2PEC A;  1TYV A;  4OJ6 A;  3KRG A;  1BHE A;  3GRH A;  4KH3 A;  4V02 C;  2IQ7 A;  1QRC A;  1NHC A;  2W7Z A;  1LLW A;  2VBM A;  3PET A;  3TH0 A;  1QRB A;  2NST A;  4YZX A;  4XLH A;  2O17 A;  3VSU A;  1IA5 A;  3SQV A;  4JRA C;  3NAW A;  4XLF A;  3B8Y A;  3H09 A;  4XON A;  2NTB A;  2NZM A;  4MR0 A;  3PSS A;  2BX6 A;  2X85 A;  3AK5 A;  2EWE A;  4YEI A;  1OFM A;  2XT2 A;  5C1E A;  4YC5 A;  2BM5 A;  2NT6 A;  2Z8G A;  4W8Q A;  4OJL A;  4Z05 A;  2NTP A;  1IDJ A;  1K8F A;  2QXZ A;  2X3H A;  3P4G A;  2NSP A;  3LJY A;  3EQN A;  2O1D A;  1EA0 A;  1TYW A;  1QA3 A;  1PLU A;  2INU A;  2XC1 A;  2BM6 A;  5JLV C;  3JX8 A;  2ODL A;  2PYG A;  1O8F A; 
#chains in the Genus database with same CATH homology
 4HWV A;  1IB4 A;  1CZF A;  2QX3 A;  1O8J A;  3GQA A;  4PMH A;  1O8I A;  2X6X A;  3ZPP A;  1VBL A;  1GQ8 A;  2QY1 A;  2UVF A;  1KTW A;  3B90 A;  4XKV A;  1O88 A;  4Z06 A;  4YZ0 A;  1O8G A;  3VMV A;  2VJJ A;  4OZY A;  4W8R A;  3UW0 A;  4YZQ A;  1DBG A;  2O0V A;  4OJ5 A;  3JUR A;  4OJO A;  4XLC A;  3VSV A;  2VBE A;  3FY3 A;  4EW9 A;  1H80 A;  4XL9 A;  1XG2 A;  3ZSC A;  1JRG A;  5AMV A;  4YEJ A;  4OJP A;  1IDK A;  3B4N A;  4XM3 A;  4I84 A;  4Z03 A;  3T9G A;  4AVZ A;  1X0C A;  4URR A;  4XOP A;  2O0W A;  1OGO X;  4XLA A;  1WMR A;  1OOC A;  4NK8 A;  1HG8 A;  2NTQ A;  2X6W A;  3GQ9 A;  1DBO A;  3GQ8 A;  4NK6 A;  2O04 A;  1OGM X;  4XR6 A;  4YZA A;  3VST A;  4XN3 A;  4XQF A;  1O8E A;  4YEL A;  3VMW A;  2X6Y A;  4U49 A;  2INV A;  4XLE A;  1RMG A;  4XOT A;  3SUC A;  1QJV A;  4C2L A;  1RU4 A;  3WWG A;  1KCD A;  3LMW A;  4MXN A;  4XMY A;  4OZZ A;  1AIR A;  1OFL A;  4W8S A;  1O8H A;  1QCX A;  2VBK A;  2PYH A;  1RWR A;  1O8L A;  2NT9 A;  1JTA A;  3GQ7 A;  1PXZ A;  2UVE A;  1O8K A;  4U4B A;  1EE6 A;  4W8T A;  4XN0 A;  4XNF A;  1KCC A;  1K5C A;  3EQO A;  2VJI A;  4XKW A;  1PE9 A;  4XOR A;  2BSP A;  5C1C A;  1BN8 A;  1O8M A;  1O8D A;  2PEC A;  4OJ6 A;  3KRG A;  1BHE A;  3GRH A;  2IQ7 A;  1NHC A;  2VBM A;  2NST A;  4YZX A;  4XLH A;  2O17 A;  3VSU A;  1IA5 A;  4XLF A;  3B8Y A;  4XON A;  2NTB A;  2NZM A;  4MR0 A;  2X85 A;  2EWE A;  1OFM A;  5C1E A;  4Z05 A;  2NT6 A;  2Z8G A;  4W8Q A;  4OJL A;  2NTP A;  1IDJ A;  2QXZ A;  2X3H A;  2NSP A;  3EQN A;  2O1D A;  1PLU A;  2INU A;  2ODL A;  2PYG A;  1O8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...