1IDJA

Pectin lyase a
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
359
structure length
359
Chain Sequence
VGVSGSAEGFAEGVTGGGDATPVYPDTIDELVSYLGDDEARVIVLTKTFDFTDSEGTTTGTGCAPWGTASACQVAIDQDDWCENYEPDAPSVSVEYYNAGVLGITVTSNKSLIGEGSSGAIKGKGLRIVSGAENIIIQNIAVTDINPKYVWGGDAITLDDCDLVWIDHVTTARIGRQHYVLGTSADNRVSLTNNYIDGVSDYSATCDGYHYWGIYLDGDADLVTMKGNYIYHTSGRSPKVQDNTLLHCVNNYFYDISGHAFEIGEGGYVLAEGNVFQNVDTVLETYEGAAFTVPSTTAGEVCSTYLGRDCVINGFGCSGTFSEDSTSFLSDFEGKNIASASAYTSVASRVVANAGQGNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two crystal structures of pectin lyase A from Aspergillus reveal a pH driven conformational change and striking divergence in the substrate-binding clefts of pectin and pectate lyases.
pubmed doi rcsb
molecule tags Lyase
molecule keywords PECTIN LYASE A
total genus 133
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.2.2.10: Pectin lyase.
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1idjA00
4Z06A 2UVFA 1O88A 2O04A 4XNFA 4MR0A 3VMVA 4OJPA 3ZSCA 3JURA 2O1DA 1CZFA 2QX3A 1KCDA 1GQ8A 2QY1A 4YZ0A 1OGOX 4Z03A 4YELA 4NK6A 4NK8A 1K5CA 4XONA 1DBOA 4HWVA 1O8JA 1OOCA 4OZZA 1O8FA 4XLFA 1EE6A 4XN3A 1RU4A 4XLAA 2X6XA 2INVA 1RMGA 5C1EA 4C2LA 2VBKA 5C1CA 1KCCA 4OJ5A 3EQNA 4W8QA 3EQOA 4YEJA 4YZQA 2VJIA 3GQ9A 3UW0A 2NTBA 1IDKA 4OZYA 1PE9A 4XM3A 3GRHA 2X6YA 1AIRA 4XOPA 1WMRA 4XLEA 1KTWA 1O8IA 3B4NA 3GQAA 1XG2A 2O0VA 4XN0A 4XORA 1NHCA 1OFMA 4AVZA 2QXZA 4U49A 4U4BA 4XLCA 1BN8A 4XMYA 4XR6A 1O8GA 1PXZA 4MXNA 4YZXA 4XLHA 1O8MA 4URRA 2O17A 2NZMA 3T9GA 2NTPA 3VSVA 3GQ7A 4XQFA 4W8TA 1O8DA 2O0WA 4OJOA 1IA5A 4OJ6A 2NSTA 1O8KA 3VMWA 4PMHA 1QJVA 2PYGA 3VSTA 2EWEA 1HG8A 1IB4A 1JRGA 4I84A 4W8RA 4XOTA 2ODLA 1X0CA 2NSPA 4YZAA 1O8EA 3GQ8A 4EW9A 2UVEA 1PLUA 3VSUA 1QCXA 2NTQA 4XL9A 2X85A 5AMVA 2Z8GA 2IQ7A 4OJLA 4XKWA 2NT6A 3ZPPA 2VBMA 2X6WA 2X3HA 1OGMX 1DBGA 2VJJA 1O8HA 3B90A 2PYHA 4XKVA 1IDJA 3B8YA 2NT9A 3FY3A 1O8LA 2PECA 2VBEA 4W8SA 3WWGA 1OFLA 4Z05A 3SUCA 1VBLA 1H80A 1JTAA 2INUA 3LMWA 1RWRA 2BSPA 1BHEA 3KRGA
chains in the Genus database with same CATH superfamily
1QRCA 2UVFA 4Z06A 1O88A 2O04A 4XNFA 4MR0A 1K8FA 3VMVA 4YFOA 3N6ZA 4OJPA 3ZSCA 2XTYA 1L1IA 3JURA 3AK5A 2O1DA 4YDTA 1CZFA 3NAWA 2QX3A 5JLVC 2XT4A 1KCDA 1TSPA 2B0RA 4JRAC 1K4ZA 1QQ1A 1GQ8A 1HF2A 2QY1A 2IOUG 3LYCA 1OGOX 4Z03A 4YZ0A 2J8IA 4NK6A 4YELA 1EZGA 4NK8A 3RIQA 1K5CA 4XONA 1DBOA 2VFNA 4HWVA 1O8JA 3ML3A 4YC5A 1OOCA 4YEIA 4OZZA 4OPWA 1QA1A 4V02C 1O8FA 4XLFA 2XTXA 1EE6A 3PSZA 4XN3A 1RU4A 4XLAA 2XT2A 3BH6B 2X6XA 2INVA 3P4GA 3SQVA 1RMGA 1LM1A 2J8KA 5C1EA 2VBKA 4C2LA 5C1CA 1KCCA 2BM6A 3PETA 4OJ5A 3EQNA 4W8QA 1TYVA 1TYXA 1OFDA 3NB2A 3EQOA 4YEJA 4YZQA 2VJIA 2YUHA 3GQ9A 3N90A 3UW0A 2NTBA 1LLZA 1IDKA 4OZYA 1CLWA 3JX8A 1PE9A 1OFEA 4XM3A 3GRHA 2X6YA 1AIRA 4XOPA 2BM4A 2BM5A 1WMRA 4XLEA 1KTWA 1O8IA 2QYUA 3B4NA 3GQAA 1XG2A 2O0VA 4XN0A 4XORA 1WXRA 1NHCA 1OFMA 4AVZA 2O6WA 2QXZA 4U49A 1EA0A 4U4BA 4XLCA 1BN8A 1TYUA 4XMYA 4XR6A 1O8GA 1PXZA 4MXNA 4YZXA 4XLHA 1O8MA 1LLWA 1TYWA 4URRA 2O17A 2NZMA 3T9GA 2NTPA 2XC1A 3GQ7A 3VSVA 5DNSA 4XQFA 4W8TA 1O8DA 2O0WA 4OJOA 1QRBA 3SZEA 1IA5A 4OJ6A 2NSTA 3LJYA 1O8KA 2VFOA 2QZAA 3VMWA 3PSSA 4PMHA 1QJVA 2PYGA 4KH3A 2EWEA 3VSTA 1HG8A 1IB4A 2F3LA 1JRGA 4I84A 4W8RA 4XOTA 1KQ5A 2ODLA 2VFPA 1X0CA 2NSPA 4YZAA 1O8EA 3GQ8A 1DABA 3BH7B 4EW9A 2UVEA 3DU1X 1PLUA 2V5IA 3VSUA 1QCXA 2NTQA 4XL9A 2X85A 5AMVA 2Z8GA 2IQ7A 4OJLA 3TH0A 5JMCB 4XKWA 2NT6A 3ZPPA 2XTWA 1QA3A 2VBMA 2X6WA 4OM9A 3SY2A 2X3HA 2W7ZA 1OGMX 1DBGA 3SYJA 2VJJA 2VFQA 1O8HA 3B90A 2PYHA 4XKVA 4YCQA 1IDJA 3B8YA 2BX6A 2BM7A 2NT9A 1O8LA 3FY3A 2PECA 2G0YA 2VBEA 4W8SA 1QA2A 3WWGA 1OFLA 2VFMA 4Z05A 3SUCA 2INUA 1VBLA 1H80A 1JTAA 3LMWA 1RWRA 2BSPA 3H09A 1BHEA 3KRGA
chains in the Genus database with same CATH topology
4Z06A 2UVFA 1O88A 2O04A 4XNFA 4MR0A 3VMVA 4OJPA 3ZSCA 3JURA 2O1DA 1CZFA 2QX3A 1KCDA 1GQ8A 2QY1A 4YZ0A 1OGOX 4Z03A 4YELA 4NK6A 4NK8A 1K5CA 4XONA 1DBOA 4HWVA 1O8JA 1OOCA 4OZZA 1O8FA 4XLFA 1EE6A 4XN3A 1RU4A 4XLAA 2X6XA 2INVA 1RMGA 5C1EA 4C2LA 2VBKA 5C1CA 1KCCA 4OJ5A 3EQNA 4W8QA 3EQOA 4YEJA 4YZQA 2VJIA 3GQ9A 3UW0A 2NTBA 1IDKA 4OZYA 1PE9A 4XM3A 3GRHA 2X6YA 1AIRA 4XOPA 1WMRA 4XLEA 1KTWA 1O8IA 3B4NA 3GQAA 1XG2A 2O0VA 4XN0A 4XORA 1NHCA 1OFMA 4AVZA 2QXZA 4U49A 4U4BA 4XLCA 1BN8A 4XMYA 4XR6A 1O8GA 1PXZA 4MXNA 4YZXA 4XLHA 1O8MA 4URRA 2O17A 2NZMA 3T9GA 2NTPA 3VSVA 3GQ7A 4XQFA 4W8TA 1O8DA 2O0WA 4OJOA 1IA5A 4OJ6A 2NSTA 1O8KA 3VMWA 4PMHA 1QJVA 2PYGA 3VSTA 2EWEA 1HG8A 1IB4A 1JRGA 4I84A 4W8RA 4XOTA 2ODLA 1X0CA 2NSPA 4YZAA 1O8EA 3GQ8A 4EW9A 2UVEA 1PLUA 3VSUA 1QCXA 2NTQA 4XL9A 2X85A 5AMVA 2Z8GA 2IQ7A 4OJLA 4XKWA 2NT6A 3ZPPA 2VBMA 2X6WA 2X3HA 1OGMX 1DBGA 2VJJA 1O8HA 3B90A 2PYHA 4XKVA 1IDJA 3B8YA 2NT9A 3FY3A 1O8LA 2PECA 2VBEA 4W8SA 3WWGA 1OFLA 4Z05A 3SUCA 1VBLA 1H80A 1JTAA 2INUA 3LMWA 1RWRA 2BSPA 1BHEA 3KRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z06 A;  2UVF A;  1O88 A;  2O04 A;  4XNF A;  4MR0 A;  3VMV A;  4OJP A;  3ZSC A;  3JUR A;  2O1D A;  1CZF A;  2QX3 A;  1KCD A;  1GQ8 A;  2QY1 A;  4YZ0 A;  1OGO X;  4Z03 A;  4YEL A;  4NK6 A;  4NK8 A;  1K5C A;  4XON A;  1DBO A;  4HWV A;  1O8J A;  1OOC A;  4OZZ A;  1O8F A;  4XLF A;  1EE6 A;  4XN3 A;  1RU4 A;  4XLA A;  2X6X A;  2INV A;  1RMG A;  5C1E A;  4C2L A;  2VBK A;  5C1C A;  1KCC A;  4OJ5 A;  3EQN A;  4W8Q A;  3EQO A;  4YEJ A;  4YZQ A;  2VJI A;  3GQ9 A;  3UW0 A;  2NTB A;  1IDK A;  4OZY A;  1PE9 A;  4XM3 A;  3GRH A;  2X6Y A;  1AIR A;  4XOP A;  1WMR A;  4XLE A;  1KTW A;  1O8I A;  3B4N A;  3GQA A;  1XG2 A;  2O0V A;  4XN0 A;  4XOR A;  1NHC A;  1OFM A;  4AVZ A;  2QXZ A;  4U49 A;  4U4B A;  4XLC A;  1BN8 A;  4XMY A;  4XR6 A;  1O8G A;  1PXZ A;  4MXN A;  4YZX A;  4XLH A;  1O8M A;  4URR A;  2O17 A;  2NZM A;  3T9G A;  2NTP A;  3VSV A;  3GQ7 A;  4XQF A;  4W8T A;  1O8D A;  2O0W A;  4OJO A;  1IA5 A;  4OJ6 A;  2NST A;  1O8K A;  3VMW A;  4PMH A;  1QJV A;  2PYG A;  3VST A;  2EWE A;  1HG8 A;  1IB4 A;  1JRG A;  4I84 A;  4W8R A;  4XOT A;  2ODL A;  1X0C A;  2NSP A;  4YZA A;  1O8E A;  3GQ8 A;  4EW9 A;  2UVE A;  1PLU A;  3VSU A;  1QCX A;  2NTQ A;  4XL9 A;  2X85 A;  5AMV A;  2Z8G A;  2IQ7 A;  4OJL A;  4XKW A;  2NT6 A;  3ZPP A;  2VBM A;  2X6W A;  2X3H A;  1OGM X;  1DBG A;  2VJJ A;  1O8H A;  3B90 A;  2PYH A;  4XKV A;  1IDJ A;  3B8Y A;  2NT9 A;  3FY3 A;  1O8L A;  2PEC A;  2VBE A;  4W8S A;  3WWG A;  1OFL A;  4Z05 A;  3SUC A;  1VBL A;  1H80 A;  1JTA A;  2INU A;  3LMW A;  1RWR A;  2BSP A;  1BHE A;  3KRG A; 
#chains in the Genus database with same CATH topology
 1QRC A;  2UVF A;  4Z06 A;  1O88 A;  2O04 A;  4XNF A;  4MR0 A;  1K8F A;  3VMV A;  4YFO A;  3N6Z A;  4OJP A;  3ZSC A;  2XTY A;  1L1I A;  3JUR A;  3AK5 A;  2O1D A;  4YDT A;  1CZF A;  3NAW A;  2QX3 A;  5JLV C;  2XT4 A;  1KCD A;  1TSP A;  2B0R A;  4JRA C;  1K4Z A;  1QQ1 A;  1GQ8 A;  1HF2 A;  2QY1 A;  2IOU G;  3LYC A;  1OGO X;  4Z03 A;  4YZ0 A;  2J8I A;  4NK6 A;  4YEL A;  1EZG A;  4NK8 A;  3RIQ A;  1K5C A;  4XON A;  1DBO A;  2VFN A;  4HWV A;  1O8J A;  3ML3 A;  4YC5 A;  1OOC A;  4YEI A;  4OZZ A;  4OPW A;  1QA1 A;  4V02 C;  1O8F A;  4XLF A;  2XTX A;  1EE6 A;  3PSZ A;  4XN3 A;  1RU4 A;  4XLA A;  2XT2 A;  3BH6 B;  2X6X A;  2INV A;  3P4G A;  3SQV A;  1RMG A;  1LM1 A;  2J8K A;  5C1E A;  2VBK A;  4C2L A;  5C1C A;  1KCC A;  2BM6 A;  3PET A;  4OJ5 A;  3EQN A;  4W8Q A;  1TYV A;  1TYX A;  1OFD A;  3NB2 A;  3EQO A;  4YEJ A;  4YZQ A;  2VJI A;  2YUH A;  3GQ9 A;  3N90 A;  3UW0 A;  2NTB A;  1LLZ A;  1IDK A;  4OZY A;  1CLW A;  3JX8 A;  1PE9 A;  1OFE A;  4XM3 A;  3GRH A;  2X6Y A;  1AIR A;  4XOP A;  2BM4 A;  2BM5 A;  1WMR A;  4XLE A;  1KTW A;  1O8I A;  2QYU A;  3B4N A;  3GQA A;  1XG2 A;  2O0V A;  4XN0 A;  4XOR A;  1WXR A;  1NHC A;  1OFM A;  4AVZ A;  2O6W A;  2QXZ A;  4U49 A;  1EA0 A;  4U4B A;  4XLC A;  1BN8 A;  1TYU A;  4XMY A;  4XR6 A;  1O8G A;  1PXZ A;  4MXN A;  4YZX A;  4XLH A;  1O8M A;  1LLW A;  1TYW A;  4URR A;  2O17 A;  2NZM A;  3T9G A;  2NTP A;  2XC1 A;  3GQ7 A;  3VSV A;  5DNS A;  4XQF A;  4W8T A;  1O8D A;  2O0W A;  4OJO A;  1QRB A;  3SZE A;  1IA5 A;  4OJ6 A;  2NST A;  3LJY A;  1O8K A;  2VFO A;  2QZA A;  3VMW A;  3PSS A;  4PMH A;  1QJV A;  2PYG A;  4KH3 A;  2EWE A;  3VST A;  1HG8 A;  1IB4 A;  2F3L A;  1JRG A;  4I84 A;  4W8R A;  4XOT A;  1KQ5 A;  2ODL A;  2VFP A;  1X0C A;  2NSP A;  4YZA A;  1O8E A;  3GQ8 A;  1DAB A;  3BH7 B;  4EW9 A;  2UVE A;  3DU1 X;  1PLU A;  2V5I A;  3VSU A;  1QCX A;  2NTQ A;  4XL9 A;  2X85 A;  5AMV A;  2Z8G A;  2IQ7 A;  4OJL A;  3TH0 A;  5JMC B;  4XKW A;  2NT6 A;  3ZPP A;  2XTW A;  1QA3 A;  2VBM A;  2X6W A;  4OM9 A;  3SY2 A;  2X3H A;  2W7Z A;  1OGM X;  1DBG A;  3SYJ A;  2VJJ A;  2VFQ A;  1O8H A;  3B90 A;  2PYH A;  4XKV A;  4YCQ A;  1IDJ A;  3B8Y A;  2BX6 A;  2BM7 A;  2NT9 A;  1O8L A;  3FY3 A;  2PEC A;  2G0Y A;  2VBE A;  4W8S A;  1QA2 A;  3WWG A;  1OFL A;  2VFM A;  4Z05 A;  3SUC A;  2INU A;  1VBL A;  1H80 A;  1JTA A;  3LMW A;  1RWR A;  2BSP A;  3H09 A;  1BHE A;  3KRG A; 
#chains in the Genus database with same CATH homology
 4Z06 A;  2UVF A;  1O88 A;  2O04 A;  4XNF A;  4MR0 A;  3VMV A;  4OJP A;  3ZSC A;  3JUR A;  2O1D A;  1CZF A;  2QX3 A;  1KCD A;  1GQ8 A;  2QY1 A;  4YZ0 A;  1OGO X;  4Z03 A;  4YEL A;  4NK6 A;  4NK8 A;  1K5C A;  4XON A;  1DBO A;  4HWV A;  1O8J A;  1OOC A;  4OZZ A;  1O8F A;  4XLF A;  1EE6 A;  4XN3 A;  1RU4 A;  4XLA A;  2X6X A;  2INV A;  1RMG A;  5C1E A;  4C2L A;  2VBK A;  5C1C A;  1KCC A;  4OJ5 A;  3EQN A;  4W8Q A;  3EQO A;  4YEJ A;  4YZQ A;  2VJI A;  3GQ9 A;  3UW0 A;  2NTB A;  1IDK A;  4OZY A;  1PE9 A;  4XM3 A;  3GRH A;  2X6Y A;  1AIR A;  4XOP A;  1WMR A;  4XLE A;  1KTW A;  1O8I A;  3B4N A;  3GQA A;  1XG2 A;  2O0V A;  4XN0 A;  4XOR A;  1NHC A;  1OFM A;  4AVZ A;  2QXZ A;  4U49 A;  4U4B A;  4XLC A;  1BN8 A;  4XMY A;  4XR6 A;  1O8G A;  1PXZ A;  4MXN A;  4YZX A;  4XLH A;  1O8M A;  4URR A;  2O17 A;  2NZM A;  3T9G A;  2NTP A;  3VSV A;  3GQ7 A;  4XQF A;  4W8T A;  1O8D A;  2O0W A;  4OJO A;  1IA5 A;  4OJ6 A;  2NST A;  1O8K A;  3VMW A;  4PMH A;  1QJV A;  2PYG A;  3VST A;  2EWE A;  1HG8 A;  1IB4 A;  1JRG A;  4I84 A;  4W8R A;  4XOT A;  2ODL A;  1X0C A;  2NSP A;  4YZA A;  1O8E A;  3GQ8 A;  4EW9 A;  2UVE A;  1PLU A;  3VSU A;  1QCX A;  2NTQ A;  4XL9 A;  2X85 A;  5AMV A;  2Z8G A;  2IQ7 A;  4OJL A;  4XKW A;  2NT6 A;  3ZPP A;  2VBM A;  2X6W A;  2X3H A;  1OGM X;  1DBG A;  2VJJ A;  1O8H A;  3B90 A;  2PYH A;  4XKV A;  1IDJ A;  3B8Y A;  2NT9 A;  3FY3 A;  1O8L A;  2PEC A;  2VBE A;  4W8S A;  3WWG A;  1OFL A;  4Z05 A;  3SUC A;  1VBL A;  1H80 A;  1JTA A;  2INU A;  3LMW A;  1RWR A;  2BSP A;  1BHE A;  3KRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...