1IDJA

Pectin lyase a
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
359
structure length
359
Chain Sequence
VGVSGSAEGFAEGVTGGGDATPVYPDTIDELVSYLGDDEARVIVLTKTFDFTDSEGTTTGTGCAPWGTASACQVAIDQDDWCENYEPDAPSVSVEYYNAGVLGITVTSNKSLIGEGSSGAIKGKGLRIVSGAENIIIQNIAVTDINPKYVWGGDAITLDDCDLVWIDHVTTARIGRQHYVLGTSADNRVSLTNNYIDGVSDYSATCDGYHYWGIYLDGDADLVTMKGNYIYHTSGRSPKVQDNTLLHCVNNYFYDISGHAFEIGEGGYVLAEGNVFQNVDTVLETYEGAAFTVPSTTAGEVCSTYLGRDCVINGFGCSGTFSEDSTSFLSDFEGKNIASASAYTSVASRVVANAGQGNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two crystal structures of pectin lyase A from Aspergillus reveal a pH driven conformational change and striking divergence in the substrate-binding clefts of pectin and pectate lyases.
pubmed doi rcsb
molecule tags Lyase
molecule keywords PECTIN LYASE A
total genus 133
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.2.2.10: Pectin lyase.
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1idjA00
4Z06A 4YZ0A 1O8JA 2UVEA 4MR0A 1GQ8A 3VMVA 1O8HA 1IB4A 2UVFA 2NTPA 1NHCA 3GQ9A 1IA5A 4URRA 4OZYA 1IDKA 4W8QA 1RU4A 1DBGA 1O8FA 1OGMX 4XKVA 1O8MA 1KCCA 2O1DA 3WWGA 3EQOA 2O0VA 1O8DA 1PE9A 2IQ7A 1JTAA 2X85A 4NK6A 4YZXA 4HWVA 3VSVA 4YELA 4YEJA 1BHEA 4XN0A 2X3HA 3VSUA 4XMYA 4U4BA 2VBKA 4XKWA 3B90A 2O04A 1O8GA 1K5CA 1AIRA 4XONA 5C1CA 4XLEA 2NSPA 3VMWA 4XORA 4XLFA 3T9GA 3UW0A 2O17A 3ZSCA 4C2LA 1WMRA 1OFLA 4AVZA 4XQFA 4OJOA 1PLUA 2QY1A 4OJ6A 1PXZA 1O8LA 4W8TA 2INUA 1JRGA 5C1EA 1KTWA 2NTBA 2VBEA 4YZQA 2NSTA 2NT6A 2PYGA 2NZMA 1RMGA 3GRHA 3JURA 3LMWA 1VBLA 1O8EA 2VJJA 3B4NA 4XLHA 4OJ5A 1OOCA 2INVA 4XOTA 1H80A 2X6XA 1IDJA 4YZAA 4Z03A 1QJVA 4OZZA 3FY3A 2O0WA 1HG8A 3GQ8A 2NTQA 3EQNA 2VJIA 1QCXA 4XLCA 4XM3A 1KCDA 4MXNA 1OGOX 4NK8A 4XLAA 1X0CA 2QXZA 1O8IA 3SUCA 4I84A 4OJLA 1O88A 3GQAA 3ZPPA 1OFMA 4XOPA 1XG2A 2X6WA 2Z8GA 4Z05A 1DBOA 2QX3A 3GQ7A 4XNFA 5AMVA 1O8KA 4W8RA 2VBMA 1CZFA 4PMHA 2X6YA 1RWRA 2BSPA 3KRGA 4XL9A 4XN3A 2PYHA 4U49A 3B8YA 2ODLA 3VSTA 1BN8A 2EWEA 2NT9A 4XR6A 4EW9A 4OJPA 4W8SA 1EE6A 2PECA
chains in the Genus database with same CATH superfamily
4Z06A 4YZ0A 1O8JA 3DU1X 2UVEA 4MR0A 1GQ8A 2J8KA 3VMVA 1HF2A 1O8HA 1IB4A 2UVFA 1QA3A 2NTPA 1NHCA 3GQ9A 1IA5A 2J8IA 4URRA 3SQVA 4OZYA 1IDKA 1OFEA 4W8QA 1RU4A 3H09A 3AK5A 1DBGA 1O8FA 1LLZA 1OGMX 4OPWA 4XKVA 1O8MA 4OM9A 1LLWA 2O1DA 4YFOA 1KCCA 3WWGA 3EQOA 2VFNA 2O0VA 1O8DA 1L1IA 1PE9A 2VFQA 2IQ7A 1JTAA 2X85A 1CLWA 2BX6A 2W7ZA 3TH0A 1OFDA 2F3LA 4NK6A 4YZXA 4HWVA 3VSVA 5JMCB 4YELA 5JLVC 4YEJA 3JX8A 1BHEA 4XN0A 3PETA 4JRAC 2X3HA 2BM5A 3VSUA 4XMYA 4U4BA 2VBKA 4XKWA 3B90A 2O04A 1O8GA 4V02C 1K5CA 1AIRA 1LM1A 4XONA 5C1CA 4XLEA 2NSPA 4KH3A 3VMWA 4XORA 4XLFA 3T9GA 3UW0A 2O17A 3ZSCA 4C2LA 1TYXA 2BM7A 1QA2A 1WMRA 1OFLA 4AVZA 3NB2A 3NAWA 4XQFA 4OJOA 4YC5A 1PLUA 2QY1A 4OJ6A 5AMVA 1PXZA 1O8LA 2XT2A 2QZAA 3PSZA 4W8TA 2INUA 1JRGA 5C1EA 3SYJA 1KTWA 2NTBA 1QRCA 1QRBA 3BH6B 2VBEA 4YZQA 2NSTA 2NT6A 2PYGA 2NZMA 3GRHA 3JURA 3LMWA 3RIQA 1VBLA 1O8EA 2IOUG 2VFMA 2VJJA 3B4NA 4XLHA 4OJ5A 2BM6A 3LYCA 1OOCA 2INVA 4XOTA 1H80A 5DNSA 1EZGA 2XTYA 2X6XA 1IDJA 1K8FA 2V5IA 2BM4A 2VFPA 4YZAA 4Z03A 1QJVA 4OZZA 4YCQA 3FY3A 4YDTA 2O0WA 1HG8A 1TYWA 3GQ8A 1WXRA 2VFOA 2NTQA 3EQNA 2VJIA 1QCXA 4XLCA 4XM3A 1KCDA 4MXNA 1OGOX 1TSPA 1EA0A 4NK8A 4XLAA 1X0CA 2QYUA 2XT4A 2QXZA 1O8IA 3SUCA 3SY2A 2XTXA 4I84A 1O88A 4OJLA 1QA1A 3GQAA 3ZPPA 2PECA 1TYUA 1OFMA 4XOPA 1XG2A 2X6WA 2Z8GA 3N6ZA 1DBOA 2QX3A 3GQ7A 4XNFA 4Z05A 3LJYA 1O8KA 4W8RA 1KQ5A 3N90A 2VBMA 1CZFA 4PMHA 2X6YA 1K4ZA 2XC1A 4YEIA 1RWRA 2BSPA 2YUHA 1QQ1A 3KRGA 2XTWA 4XL9A 2B0RA 4XN3A 2G0YA 1TYVA 3P4GA 2PYHA 3ML3A 3B8YA 2ODLA 3BH7B 1BN8A 2EWEA 2NT9A 4U49A 3SZEA 3VSTA 4XR6A 1DABA 2O6WA 3PSSA 4EW9A 4OJPA 4W8SA 1EE6A 1RMGA
chains in the Genus database with same CATH topology
4Z06A 4YZ0A 1O8JA 2UVEA 4MR0A 1GQ8A 3VMVA 1O8HA 1IB4A 2UVFA 2NTPA 1NHCA 3GQ9A 1IA5A 4URRA 4OZYA 1IDKA 4W8QA 1RU4A 1DBGA 1O8FA 1OGMX 4XKVA 1O8MA 1KCCA 2O1DA 3WWGA 3EQOA 2O0VA 1O8DA 1PE9A 2IQ7A 1JTAA 2X85A 4NK6A 4YZXA 4HWVA 3VSVA 4YELA 4YEJA 1BHEA 4XN0A 2X3HA 3VSUA 4XMYA 4U4BA 2VBKA 4XKWA 3B90A 2O04A 1O8GA 1K5CA 1AIRA 4XONA 5C1CA 4XLEA 2NSPA 3VMWA 4XORA 4XLFA 3T9GA 3UW0A 2O17A 3ZSCA 4C2LA 1WMRA 1OFLA 4AVZA 4XQFA 4OJOA 1PLUA 2QY1A 4OJ6A 1PXZA 1O8LA 4W8TA 2INUA 1JRGA 5C1EA 1KTWA 2NTBA 2VBEA 4YZQA 2NSTA 2NT6A 2PYGA 2NZMA 1RMGA 3GRHA 3JURA 3LMWA 1VBLA 1O8EA 2VJJA 3B4NA 4XLHA 4OJ5A 1OOCA 2INVA 4XOTA 1H80A 2X6XA 1IDJA 4YZAA 4Z03A 1QJVA 4OZZA 3FY3A 2O0WA 1HG8A 3GQ8A 2NTQA 3EQNA 2VJIA 1QCXA 4XLCA 4XM3A 1KCDA 4MXNA 1OGOX 4NK8A 4XLAA 1X0CA 2QXZA 1O8IA 3SUCA 4I84A 4OJLA 1O88A 3GQAA 3ZPPA 1OFMA 4XOPA 1XG2A 2X6WA 2Z8GA 4Z05A 1DBOA 2QX3A 3GQ7A 4XNFA 5AMVA 1O8KA 4W8RA 2VBMA 1CZFA 4PMHA 2X6YA 1RWRA 2BSPA 3KRGA 4XL9A 4XN3A 2PYHA 4U49A 3B8YA 2ODLA 3VSTA 1BN8A 2EWEA 2NT9A 4XR6A 4EW9A 4OJPA 4W8SA 1EE6A 2PECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z06 A;  4YZ0 A;  1O8J A;  2UVE A;  4MR0 A;  1GQ8 A;  3VMV A;  1O8H A;  1IB4 A;  2UVF A;  2NTP A;  1NHC A;  3GQ9 A;  1IA5 A;  4URR A;  4OZY A;  1IDK A;  4W8Q A;  1RU4 A;  1DBG A;  1O8F A;  1OGM X;  4XKV A;  1O8M A;  1KCC A;  2O1D A;  3WWG A;  3EQO A;  2O0V A;  1O8D A;  1PE9 A;  2IQ7 A;  1JTA A;  2X85 A;  4NK6 A;  4YZX A;  4HWV A;  3VSV A;  4YEL A;  4YEJ A;  1BHE A;  4XN0 A;  2X3H A;  3VSU A;  4XMY A;  4U4B A;  2VBK A;  4XKW A;  3B90 A;  2O04 A;  1O8G A;  1K5C A;  1AIR A;  4XON A;  5C1C A;  4XLE A;  2NSP A;  3VMW A;  4XOR A;  4XLF A;  3T9G A;  3UW0 A;  2O17 A;  3ZSC A;  4C2L A;  1WMR A;  1OFL A;  4AVZ A;  4XQF A;  4OJO A;  1PLU A;  2QY1 A;  4OJ6 A;  1PXZ A;  1O8L A;  4W8T A;  2INU A;  1JRG A;  5C1E A;  1KTW A;  2NTB A;  2VBE A;  4YZQ A;  2NST A;  2NT6 A;  2PYG A;  2NZM A;  1RMG A;  3GRH A;  3JUR A;  3LMW A;  1VBL A;  1O8E A;  2VJJ A;  3B4N A;  4XLH A;  4OJ5 A;  1OOC A;  2INV A;  4XOT A;  1H80 A;  2X6X A;  1IDJ A;  4YZA A;  4Z03 A;  1QJV A;  4OZZ A;  3FY3 A;  2O0W A;  1HG8 A;  3GQ8 A;  2NTQ A;  3EQN A;  2VJI A;  1QCX A;  4XLC A;  4XM3 A;  1KCD A;  4MXN A;  1OGO X;  4NK8 A;  4XLA A;  1X0C A;  2QXZ A;  1O8I A;  3SUC A;  4I84 A;  4OJL A;  1O88 A;  3GQA A;  3ZPP A;  1OFM A;  4XOP A;  1XG2 A;  2X6W A;  2Z8G A;  4Z05 A;  1DBO A;  2QX3 A;  3GQ7 A;  4XNF A;  5AMV A;  1O8K A;  4W8R A;  2VBM A;  1CZF A;  4PMH A;  2X6Y A;  1RWR A;  2BSP A;  3KRG A;  4XL9 A;  4XN3 A;  2PYH A;  4U49 A;  3B8Y A;  2ODL A;  3VST A;  1BN8 A;  2EWE A;  2NT9 A;  4XR6 A;  4EW9 A;  4OJP A;  4W8S A;  1EE6 A;  2PEC A; 
#chains in the Genus database with same CATH topology
 4Z06 A;  4YZ0 A;  1O8J A;  3DU1 X;  2UVE A;  4MR0 A;  1GQ8 A;  2J8K A;  3VMV A;  1HF2 A;  1O8H A;  1IB4 A;  2UVF A;  1QA3 A;  2NTP A;  1NHC A;  3GQ9 A;  1IA5 A;  2J8I A;  4URR A;  3SQV A;  4OZY A;  1IDK A;  1OFE A;  4W8Q A;  1RU4 A;  3H09 A;  3AK5 A;  1DBG A;  1O8F A;  1LLZ A;  1OGM X;  4OPW A;  4XKV A;  1O8M A;  4OM9 A;  1LLW A;  2O1D A;  4YFO A;  1KCC A;  3WWG A;  3EQO A;  2VFN A;  2O0V A;  1O8D A;  1L1I A;  1PE9 A;  2VFQ A;  2IQ7 A;  1JTA A;  2X85 A;  1CLW A;  2BX6 A;  2W7Z A;  3TH0 A;  1OFD A;  2F3L A;  4NK6 A;  4YZX A;  4HWV A;  3VSV A;  5JMC B;  4YEL A;  5JLV C;  4YEJ A;  3JX8 A;  1BHE A;  4XN0 A;  3PET A;  4JRA C;  2X3H A;  2BM5 A;  3VSU A;  4XMY A;  4U4B A;  2VBK A;  4XKW A;  3B90 A;  2O04 A;  1O8G A;  4V02 C;  1K5C A;  1AIR A;  1LM1 A;  4XON A;  5C1C A;  4XLE A;  2NSP A;  4KH3 A;  3VMW A;  4XOR A;  4XLF A;  3T9G A;  3UW0 A;  2O17 A;  3ZSC A;  4C2L A;  1TYX A;  2BM7 A;  1QA2 A;  1WMR A;  1OFL A;  4AVZ A;  3NB2 A;  3NAW A;  4XQF A;  4OJO A;  4YC5 A;  1PLU A;  2QY1 A;  4OJ6 A;  5AMV A;  1PXZ A;  1O8L A;  2XT2 A;  2QZA A;  3PSZ A;  4W8T A;  2INU A;  1JRG A;  5C1E A;  3SYJ A;  1KTW A;  2NTB A;  1QRC A;  1QRB A;  3BH6 B;  2VBE A;  4YZQ A;  2NST A;  2NT6 A;  2PYG A;  2NZM A;  3GRH A;  3JUR A;  3LMW A;  3RIQ A;  1VBL A;  1O8E A;  2IOU G;  2VFM A;  2VJJ A;  3B4N A;  4XLH A;  4OJ5 A;  2BM6 A;  3LYC A;  1OOC A;  2INV A;  4XOT A;  1H80 A;  5DNS A;  1EZG A;  2XTY A;  2X6X A;  1IDJ A;  1K8F A;  2V5I A;  2BM4 A;  2VFP A;  4YZA A;  4Z03 A;  1QJV A;  4OZZ A;  4YCQ A;  3FY3 A;  4YDT A;  2O0W A;  1HG8 A;  1TYW A;  3GQ8 A;  1WXR A;  2VFO A;  2NTQ A;  3EQN A;  2VJI A;  1QCX A;  4XLC A;  4XM3 A;  1KCD A;  4MXN A;  1OGO X;  1TSP A;  1EA0 A;  4NK8 A;  4XLA A;  1X0C A;  2QYU A;  2XT4 A;  2QXZ A;  1O8I A;  3SUC A;  3SY2 A;  2XTX A;  4I84 A;  1O88 A;  4OJL A;  1QA1 A;  3GQA A;  3ZPP A;  2PEC A;  1TYU A;  1OFM A;  4XOP A;  1XG2 A;  2X6W A;  2Z8G A;  3N6Z A;  1DBO A;  2QX3 A;  3GQ7 A;  4XNF A;  4Z05 A;  3LJY A;  1O8K A;  4W8R A;  1KQ5 A;  3N90 A;  2VBM A;  1CZF A;  4PMH A;  2X6Y A;  1K4Z A;  2XC1 A;  4YEI A;  1RWR A;  2BSP A;  2YUH A;  1QQ1 A;  3KRG A;  2XTW A;  4XL9 A;  2B0R A;  4XN3 A;  2G0Y A;  1TYV A;  3P4G A;  2PYH A;  3ML3 A;  3B8Y A;  2ODL A;  3BH7 B;  1BN8 A;  2EWE A;  2NT9 A;  4U49 A;  3SZE A;  3VST A;  4XR6 A;  1DAB A;  2O6W A;  3PSS A;  4EW9 A;  4OJP A;  4W8S A;  1EE6 A;  1RMG A; 
#chains in the Genus database with same CATH homology
 4Z06 A;  4YZ0 A;  1O8J A;  2UVE A;  4MR0 A;  1GQ8 A;  3VMV A;  1O8H A;  1IB4 A;  2UVF A;  2NTP A;  1NHC A;  3GQ9 A;  1IA5 A;  4URR A;  4OZY A;  1IDK A;  4W8Q A;  1RU4 A;  1DBG A;  1O8F A;  1OGM X;  4XKV A;  1O8M A;  1KCC A;  2O1D A;  3WWG A;  3EQO A;  2O0V A;  1O8D A;  1PE9 A;  2IQ7 A;  1JTA A;  2X85 A;  4NK6 A;  4YZX A;  4HWV A;  3VSV A;  4YEL A;  4YEJ A;  1BHE A;  4XN0 A;  2X3H A;  3VSU A;  4XMY A;  4U4B A;  2VBK A;  4XKW A;  3B90 A;  2O04 A;  1O8G A;  1K5C A;  1AIR A;  4XON A;  5C1C A;  4XLE A;  2NSP A;  3VMW A;  4XOR A;  4XLF A;  3T9G A;  3UW0 A;  2O17 A;  3ZSC A;  4C2L A;  1WMR A;  1OFL A;  4AVZ A;  4XQF A;  4OJO A;  1PLU A;  2QY1 A;  4OJ6 A;  1PXZ A;  1O8L A;  4W8T A;  2INU A;  1JRG A;  5C1E A;  1KTW A;  2NTB A;  2VBE A;  4YZQ A;  2NST A;  2NT6 A;  2PYG A;  2NZM A;  1RMG A;  3GRH A;  3JUR A;  3LMW A;  1VBL A;  1O8E A;  2VJJ A;  3B4N A;  4XLH A;  4OJ5 A;  1OOC A;  2INV A;  4XOT A;  1H80 A;  2X6X A;  1IDJ A;  4YZA A;  4Z03 A;  1QJV A;  4OZZ A;  3FY3 A;  2O0W A;  1HG8 A;  3GQ8 A;  2NTQ A;  3EQN A;  2VJI A;  1QCX A;  4XLC A;  4XM3 A;  1KCD A;  4MXN A;  1OGO X;  4NK8 A;  4XLA A;  1X0C A;  2QXZ A;  1O8I A;  3SUC A;  4I84 A;  4OJL A;  1O88 A;  3GQA A;  3ZPP A;  1OFM A;  4XOP A;  1XG2 A;  2X6W A;  2Z8G A;  4Z05 A;  1DBO A;  2QX3 A;  3GQ7 A;  4XNF A;  5AMV A;  1O8K A;  4W8R A;  2VBM A;  1CZF A;  4PMH A;  2X6Y A;  1RWR A;  2BSP A;  3KRG A;  4XL9 A;  4XN3 A;  2PYH A;  4U49 A;  3B8Y A;  2ODL A;  3VST A;  1BN8 A;  2EWE A;  2NT9 A;  4XR6 A;  4EW9 A;  4OJP A;  4W8S A;  1EE6 A;  2PEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...