1IDJA

Pectin lyase a
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
359
structure length
359
Chain Sequence
b'VGVSGSAEGFAEGVTGGGDATPVYPDTIDELVSYLGDDEARVIVLTKTFDFTDSEGTTTGTGCAPWGTASACQVAIDQDDWCENYEPDAPSVSVEYYNAGVLGITVTSNKSLIGEGSSGAIKGKGLRIVSGAENIIIQNIAVTDINPKYVWGGDAITLDDCDLVWIDHVTTARIGRQHYVLGTSADNRVSLTNNYIDGVSDYSATCDGYHYWGIYLDGDADLVTMKGNYIYHTSGRSPKVQDNTLLHCVNNYFYDISGHAFEIGEGGYVLAEGNVFQNVDTVLETYEGAAFTVPSTTAGEVCSTYLGRDCVINGFGCSGTFSEDSTSFLSDFEGKNIASASAYTSVASRVVANAGQGNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTIN LYASE A
publication title Two crystal structures of pectin lyase A from Aspergillus reveal a pH driven conformational change and striking divergence in the substrate-binding clefts of pectin and pectate lyases.
pubmed doi rcsb
molecule tags Lyase
total genus 133
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.2.2.10: Pectin lyase.
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1idjA00
4XNFA 4XLEA 1IDJA 4YELA 1OGMX 2NT6A 1RMGA 1RWRA 1QJVA 1O8GA 3FY3A 2PECA 5C1CA 5AMVA 4AVZA 1OFMA 1O8FA 1PLUA 4NK8A 2NTQA 2ODLA 4MXNA 4W8TA 2X6YA 5C1EA 3SUCA 1X0CA 4YZQA 4YEJA 1O8DA 1OOCA 1O8KA 4XLAA 2PYHA 4YZAA 4C2LA 3ZPPA 1WMRA 1IDKA 1KCDA 1JTAA 3KRGA 4NK6A 1O88A 2IQ7A 3GQ8A 3T9GA 3VMWA 4XKVA 1DBGA 2VJIA 1KCCA 4OJLA 1EE6A 1OFLA 3B8YA 3GQAA 2O0VA 3WWGA 2INVA 1QCXA 1O8LA 1O8IA 4XONA 4I84A 3GQ7A 4XKWA 1IA5A 2QXZA 2X85A 4OJOA 2VBMA 2PYGA 4XMYA 2UVEA 4PMHA 2X3HA 3UW0A 1XG2A 1H80A 2O1DA 1PE9A 4HWVA 1KTWA 3VMVA 1GQ8A 4OJPA 3B90A 2QY1A 2Z8GA 3GRHA 2BSPA 2NTBA 1DBOA 4XN0A 1O8HA 4W8QA 4U49A 2NSPA 4XLHA 4U4BA 3ZSCA 3EQOA 2O0WA 4MR0A 4XLFA 1PXZA 1O8EA 2NZMA 4OZZA 4URRA 1K5CA 4OJ6A 4EW9A 2VBEA 4XOTA 1IB4A 3VSVA 1BN8A 1HG8A 4XQFA 4W8SA 1O8JA 4XLCA 2O17A 3JURA 4W8RA 4Z06A 4Z03A 4OZYA 2X6XA 4YZ0A 4OJ5A 1VBLA 2UVFA 1CZFA 4YZXA 4XR6A 4XL9A 2O04A 2QX3A 2NT9A 2EWEA 3EQNA 1AIRA 2NSTA 3B4NA 2NTPA 3LMWA 2INUA 1BHEA 3VSTA 4XORA 3VSUA 4XOPA 2X6WA 1JRGA 1O8MA 2VJJA 4XN3A 1RU4A 1NHCA 3GQ9A 4Z05A 2VBKA 4XM3A 1OGOX
chains in the Genus database with same CATH superfamily
2IOUG 4XLEA 4XNFA 1L1IA 1IDJA 2F3LA 4YELA 1OGMX 2NT6A 1RMGA 1RWRA 1QJVA 1O8GA 3FY3A 3NAWA 2PECA 5C1CA 5AMVA 4AVZA 1OFMA 2BM4A 1O8FA 2VBKA 1OFDA 5JMCB 1PLUA 4NK8A 2NTQA 1QRBA 2ODLA 4MXNA 4W8TA 2X6YA 5C1EA 3SUCA 1X0CA 2BM7A 4YZQA 4YEJA 1O8DA 1OOCA 3NB2A 1O8KA 1LLZA 4XLAA 2PYHA 4YZAA 1TYVA 2BM6A 4C2LA 2VFMA 3ZPPA 1WMRA 1QA2A 2XT4A 4YC5A 1TSPA 1IDKA 2QYUA 1KCDA 1CLWA 1JTAA 3KRGA 4YCQA 4NK6A 1O88A 2IQ7A 3GQ8A 3T9GA 3SYJA 3VMWA 4XKVA 1DBGA 1EZGA 2VJIA 1KCCA 4KH3A 4OJLA 1QA1A 1QA3A 1EE6A 1OFLA 3B8YA 3GQAA 2O0VA 3WWGA 2INVA 1QCXA 1O8LA 1O8IA 4XONA 2XT2A 4I84A 3RIQA 1TYXA 3BH7B 3GQ7A 4XKWA 1IA5A 2QXZA 2X85A 3AK5A 4OJOA 2VBMA 5DNSA 2PYGA 3ML3A 4XMYA 4PMHA 3SZEA 2X3HA 3UW0A 1XG2A 1H80A 2O1DA 3LJYA 1PE9A 2VFQA 4HWVA 1LM1A 4OM9A 2XTWA 1DABA 1LLWA 1KTWA 3VMVA 3DU1X 1GQ8A 2G0YA 4OJPA 3B90A 2QY1A 2Z8GA 2BX6A 3GRHA 2BSPA 1K4ZA 2NTBA 2B0RA 3SQVA 1DBOA 4XN0A 1O8HA 3JX8A 4U49A 4W8QA 4V02C 2NSPA 1OFEA 4YEIA 4XLHA 4U4BA 2VFPA 3ZSCA 3EQOA 2O0WA 4MR0A 4XLFA 2VFNA 1PXZA 1O8EA 3TH0A 2NZMA 4OZZA 3PETA 4URRA 3LYCA 1EA0A 1K5CA 4OJ6A 1TYUA 4EW9A 2BM5A 3H09A 2J8IA 2VBEA 1QRCA 3P4GA 4XOTA 1IB4A 1KQ5A 3VSVA 1BN8A 1HG8A 2W7ZA 4XQFA 4W8SA 1O8JA 4XLCA 1HF2A 2O17A 3JURA 4W8RA 4Z06A 2XTXA 5JLVC 3BH6B 4Z03A 4OZYA 2J8KA 2O6WA 1TYWA 2VFOA 2X6XA 4YZ0A 4OJ5A 1VBLA 2UVFA 1CZFA 4YZXA 3PSZA 4XR6A 3PSSA 4XL9A 2O04A 2QX3A 2XTYA 2NT9A 4OPWA 1K8FA 2EWEA 3EQNA 4JRAC 1QQ1A 1AIRA 2NSTA 2QZAA 2XC1A 3B4NA 2NTPA 3LMWA 2INUA 1BHEA 3VSTA 4XORA 3VSUA 2YUHA 3N90A 4XOPA 2X6WA 3N6ZA 4YDTA 1JRGA 1O8MA 2V5IA 2VJJA 4XN3A 1RU4A 4YFOA 3SY2A 1NHCA 3GQ9A 4Z05A 1WXRA 2UVEA 4XM3A 1OGOX
chains in the Genus database with same CATH topology
4XNFA 4XLEA 1IDJA 4YELA 1OGMX 2NT6A 1RMGA 1RWRA 1QJVA 1O8GA 3FY3A 2PECA 5C1CA 5AMVA 4AVZA 1OFMA 1O8FA 1PLUA 4NK8A 2NTQA 2ODLA 4MXNA 4W8TA 2X6YA 5C1EA 3SUCA 1X0CA 4YZQA 4YEJA 1O8DA 1OOCA 1O8KA 4XLAA 2PYHA 4YZAA 4C2LA 3ZPPA 1WMRA 1IDKA 1KCDA 1JTAA 3KRGA 4NK6A 1O88A 2IQ7A 3GQ8A 3T9GA 3VMWA 4XKVA 1DBGA 2VJIA 1KCCA 4OJLA 1EE6A 1OFLA 3B8YA 3GQAA 2O0VA 3WWGA 2INVA 1QCXA 1O8LA 1O8IA 4XONA 4I84A 3GQ7A 4XKWA 1IA5A 2QXZA 2X85A 4OJOA 2VBMA 2PYGA 4XMYA 2UVEA 4PMHA 2X3HA 3UW0A 1XG2A 1H80A 2O1DA 1PE9A 4HWVA 1KTWA 3VMVA 1GQ8A 4OJPA 3B90A 2QY1A 2Z8GA 3GRHA 2BSPA 2NTBA 1DBOA 4XN0A 1O8HA 4W8QA 4U49A 2NSPA 4XLHA 4U4BA 3ZSCA 3EQOA 2O0WA 4MR0A 4XLFA 1PXZA 1O8EA 2NZMA 4OZZA 4URRA 1K5CA 4OJ6A 4EW9A 2VBEA 4XOTA 1IB4A 3VSVA 1BN8A 1HG8A 4XQFA 4W8SA 1O8JA 4XLCA 2O17A 3JURA 4W8RA 4Z06A 4Z03A 4OZYA 2X6XA 4YZ0A 4OJ5A 1VBLA 2UVFA 1CZFA 4YZXA 4XR6A 4XL9A 2O04A 2QX3A 2NT9A 2EWEA 3EQNA 1AIRA 2NSTA 3B4NA 2NTPA 3LMWA 2INUA 1BHEA 3VSTA 4XORA 3VSUA 4XOPA 2X6WA 1JRGA 1O8MA 2VJJA 4XN3A 1RU4A 1NHCA 3GQ9A 4Z05A 2VBKA 4XM3A 1OGOX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XNF A;  4XLE A;  1IDJ A;  4YEL A;  1OGM X;  2NT6 A;  1RMG A;  1RWR A;  1QJV A;  1O8G A;  3FY3 A;  2PEC A;  5C1C A;  5AMV A;  4AVZ A;  1OFM A;  1O8F A;  1PLU A;  4NK8 A;  2NTQ A;  2ODL A;  4MXN A;  4W8T A;  2X6Y A;  5C1E A;  3SUC A;  1X0C A;  4YZQ A;  4YEJ A;  1O8D A;  1OOC A;  1O8K A;  4XLA A;  2PYH A;  4YZA A;  4C2L A;  3ZPP A;  1WMR A;  1IDK A;  1KCD A;  1JTA A;  3KRG A;  4NK6 A;  1O88 A;  2IQ7 A;  3GQ8 A;  3T9G A;  3VMW A;  4XKV A;  1DBG A;  2VJI A;  1KCC A;  4OJL A;  1EE6 A;  1OFL A;  3B8Y A;  3GQA A;  2O0V A;  3WWG A;  2INV A;  1QCX A;  1O8L A;  1O8I A;  4XON A;  4I84 A;  3GQ7 A;  4XKW A;  1IA5 A;  2QXZ A;  2X85 A;  4OJO A;  2VBM A;  2PYG A;  4XMY A;  2UVE A;  4PMH A;  2X3H A;  3UW0 A;  1XG2 A;  1H80 A;  2O1D A;  1PE9 A;  4HWV A;  1KTW A;  3VMV A;  1GQ8 A;  4OJP A;  3B90 A;  2QY1 A;  2Z8G A;  3GRH A;  2BSP A;  2NTB A;  1DBO A;  4XN0 A;  1O8H A;  4W8Q A;  4U49 A;  2NSP A;  4XLH A;  4U4B A;  3ZSC A;  3EQO A;  2O0W A;  4MR0 A;  4XLF A;  1PXZ A;  1O8E A;  2NZM A;  4OZZ A;  4URR A;  1K5C A;  4OJ6 A;  4EW9 A;  2VBE A;  4XOT A;  1IB4 A;  3VSV A;  1BN8 A;  1HG8 A;  4XQF A;  4W8S A;  1O8J A;  4XLC A;  2O17 A;  3JUR A;  4W8R A;  4Z06 A;  4Z03 A;  4OZY A;  2X6X A;  4YZ0 A;  4OJ5 A;  1VBL A;  2UVF A;  1CZF A;  4YZX A;  4XR6 A;  4XL9 A;  2O04 A;  2QX3 A;  2NT9 A;  2EWE A;  3EQN A;  1AIR A;  2NST A;  3B4N A;  2NTP A;  3LMW A;  2INU A;  1BHE A;  3VST A;  4XOR A;  3VSU A;  4XOP A;  2X6W A;  1JRG A;  1O8M A;  2VJJ A;  4XN3 A;  1RU4 A;  1NHC A;  3GQ9 A;  4Z05 A;  2VBK A;  4XM3 A;  1OGO X; 
#chains in the Genus database with same CATH topology
 2IOU G;  4XLE A;  4XNF A;  1L1I A;  1IDJ A;  2F3L A;  4YEL A;  1OGM X;  2NT6 A;  1RMG A;  1RWR A;  1QJV A;  1O8G A;  3FY3 A;  3NAW A;  2PEC A;  5C1C A;  5AMV A;  4AVZ A;  1OFM A;  2BM4 A;  1O8F A;  2VBK A;  1OFD A;  5JMC B;  1PLU A;  4NK8 A;  2NTQ A;  1QRB A;  2ODL A;  4MXN A;  4W8T A;  2X6Y A;  5C1E A;  3SUC A;  1X0C A;  2BM7 A;  4YZQ A;  4YEJ A;  1O8D A;  1OOC A;  3NB2 A;  1O8K A;  1LLZ A;  4XLA A;  2PYH A;  4YZA A;  1TYV A;  2BM6 A;  4C2L A;  2VFM A;  3ZPP A;  1WMR A;  1QA2 A;  2XT4 A;  4YC5 A;  1TSP A;  1IDK A;  2QYU A;  1KCD A;  1CLW A;  1JTA A;  3KRG A;  4YCQ A;  4NK6 A;  1O88 A;  2IQ7 A;  3GQ8 A;  3T9G A;  3SYJ A;  3VMW A;  4XKV A;  1DBG A;  1EZG A;  2VJI A;  1KCC A;  4KH3 A;  4OJL A;  1QA1 A;  1QA3 A;  1EE6 A;  1OFL A;  3B8Y A;  3GQA A;  2O0V A;  3WWG A;  2INV A;  1QCX A;  1O8L A;  1O8I A;  4XON A;  2XT2 A;  4I84 A;  3RIQ A;  1TYX A;  3BH7 B;  3GQ7 A;  4XKW A;  1IA5 A;  2QXZ A;  2X85 A;  3AK5 A;  4OJO A;  2VBM A;  5DNS A;  2PYG A;  3ML3 A;  4XMY A;  4PMH A;  3SZE A;  2X3H A;  3UW0 A;  1XG2 A;  1H80 A;  2O1D A;  3LJY A;  1PE9 A;  2VFQ A;  4HWV A;  1LM1 A;  4OM9 A;  2XTW A;  1DAB A;  1LLW A;  1KTW A;  3VMV A;  3DU1 X;  1GQ8 A;  2G0Y A;  4OJP A;  3B90 A;  2QY1 A;  2Z8G A;  2BX6 A;  3GRH A;  2BSP A;  1K4Z A;  2NTB A;  2B0R A;  3SQV A;  1DBO A;  4XN0 A;  1O8H A;  3JX8 A;  4U49 A;  4W8Q A;  4V02 C;  2NSP A;  1OFE A;  4YEI A;  4XLH A;  4U4B A;  2VFP A;  3ZSC A;  3EQO A;  2O0W A;  4MR0 A;  4XLF A;  2VFN A;  1PXZ A;  1O8E A;  3TH0 A;  2NZM A;  4OZZ A;  3PET A;  4URR A;  3LYC A;  1EA0 A;  1K5C A;  4OJ6 A;  1TYU A;  4EW9 A;  2BM5 A;  3H09 A;  2J8I A;  2VBE A;  1QRC A;  3P4G A;  4XOT A;  1IB4 A;  1KQ5 A;  3VSV A;  1BN8 A;  1HG8 A;  2W7Z A;  4XQF A;  4W8S A;  1O8J A;  4XLC A;  1HF2 A;  2O17 A;  3JUR A;  4W8R A;  4Z06 A;  2XTX A;  5JLV C;  3BH6 B;  4Z03 A;  4OZY A;  2J8K A;  2O6W A;  1TYW A;  2VFO A;  2X6X A;  4YZ0 A;  4OJ5 A;  1VBL A;  2UVF A;  1CZF A;  4YZX A;  3PSZ A;  4XR6 A;  3PSS A;  4XL9 A;  2O04 A;  2QX3 A;  2XTY A;  2NT9 A;  4OPW A;  1K8F A;  2EWE A;  3EQN A;  4JRA C;  1QQ1 A;  1AIR A;  2NST A;  2QZA A;  2XC1 A;  3B4N A;  2NTP A;  3LMW A;  2INU A;  1BHE A;  3VST A;  4XOR A;  3VSU A;  2YUH A;  3N90 A;  4XOP A;  2X6W A;  3N6Z A;  4YDT A;  1JRG A;  1O8M A;  2V5I A;  2VJJ A;  4XN3 A;  1RU4 A;  4YFO A;  3SY2 A;  1NHC A;  3GQ9 A;  4Z05 A;  1WXR A;  2UVE A;  4XM3 A;  1OGO X; 
#chains in the Genus database with same CATH homology
 4XNF A;  4XLE A;  1IDJ A;  4YEL A;  1OGM X;  2NT6 A;  1RMG A;  1RWR A;  1QJV A;  1O8G A;  3FY3 A;  2PEC A;  5C1C A;  5AMV A;  4AVZ A;  1OFM A;  1O8F A;  1PLU A;  4NK8 A;  2NTQ A;  2ODL A;  4MXN A;  4W8T A;  2X6Y A;  5C1E A;  3SUC A;  1X0C A;  4YZQ A;  4YEJ A;  1O8D A;  1OOC A;  1O8K A;  4XLA A;  2PYH A;  4YZA A;  4C2L A;  3ZPP A;  1WMR A;  1IDK A;  1KCD A;  1JTA A;  3KRG A;  4NK6 A;  1O88 A;  2IQ7 A;  3GQ8 A;  3T9G A;  3VMW A;  4XKV A;  1DBG A;  2VJI A;  1KCC A;  4OJL A;  1EE6 A;  1OFL A;  3B8Y A;  3GQA A;  2O0V A;  3WWG A;  2INV A;  1QCX A;  1O8L A;  1O8I A;  4XON A;  4I84 A;  3GQ7 A;  4XKW A;  1IA5 A;  2QXZ A;  2X85 A;  4OJO A;  2VBM A;  2PYG A;  4XMY A;  2UVE A;  4PMH A;  2X3H A;  3UW0 A;  1XG2 A;  1H80 A;  2O1D A;  1PE9 A;  4HWV A;  1KTW A;  3VMV A;  1GQ8 A;  4OJP A;  3B90 A;  2QY1 A;  2Z8G A;  3GRH A;  2BSP A;  2NTB A;  1DBO A;  4XN0 A;  1O8H A;  4W8Q A;  4U49 A;  2NSP A;  4XLH A;  4U4B A;  3ZSC A;  3EQO A;  2O0W A;  4MR0 A;  4XLF A;  1PXZ A;  1O8E A;  2NZM A;  4OZZ A;  4URR A;  1K5C A;  4OJ6 A;  4EW9 A;  2VBE A;  4XOT A;  1IB4 A;  3VSV A;  1BN8 A;  1HG8 A;  4XQF A;  4W8S A;  1O8J A;  4XLC A;  2O17 A;  3JUR A;  4W8R A;  4Z06 A;  4Z03 A;  4OZY A;  2X6X A;  4YZ0 A;  4OJ5 A;  1VBL A;  2UVF A;  1CZF A;  4YZX A;  4XR6 A;  4XL9 A;  2O04 A;  2QX3 A;  2NT9 A;  2EWE A;  3EQN A;  1AIR A;  2NST A;  3B4N A;  2NTP A;  3LMW A;  2INU A;  1BHE A;  3VST A;  4XOR A;  3VSU A;  4XOP A;  2X6W A;  1JRG A;  1O8M A;  2VJJ A;  4XN3 A;  1RU4 A;  1NHC A;  3GQ9 A;  4Z05 A;  2VBK A;  4XM3 A;  1OGO X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...