1IDJA

Pectin lyase a
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
359
structure length
359
Chain Sequence
VGVSGSAEGFAEGVTGGGDATPVYPDTIDELVSYLGDDEARVIVLTKTFDFTDSEGTTTGTGCAPWGTASACQVAIDQDDWCENYEPDAPSVSVEYYNAGVLGITVTSNKSLIGEGSSGAIKGKGLRIVSGAENIIIQNIAVTDINPKYVWGGDAITLDDCDLVWIDHVTTARIGRQHYVLGTSADNRVSLTNNYIDGVSDYSATCDGYHYWGIYLDGDADLVTMKGNYIYHTSGRSPKVQDNTLLHCVNNYFYDISGHAFEIGEGGYVLAEGNVFQNVDTVLETYEGAAFTVPSTTAGEVCSTYLGRDCVINGFGCSGTFSEDSTSFLSDFEGKNIASASAYTSVASRVVANAGQGNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTIN LYASE A
publication title Two crystal structures of pectin lyase A from Aspergillus reveal a pH driven conformational change and striking divergence in the substrate-binding clefts of pectin and pectate lyases.
pubmed doi rcsb
molecule tags Lyase
total genus 133
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.2.2.10: Pectin lyase.
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1idjA00
4XOTA 3FY3A 4URRA 2QXZA 4XNFA 2X3HA 1O8FA 2QY1A 4I84A 2NTQA 4Z06A 3GRHA 1JRGA 2IQ7A 1RU4A 3GQ7A 1GQ8A 4XORA 4OJ6A 1H80A 4XONA 3VMWA 1QCXA 4YELA 1O8HA 2O0VA 3B90A 1JTAA 1CZFA 1OOCA 3B4NA 1O8GA 5C1EA 4U49A 4XKVA 4YEJA 4OJLA 4OJOA 1X0CA 2PYHA 3SUCA 3T9GA 4OZYA 1RWRA 3VSVA 4XLFA 4AVZA 1IDKA 4YZ0A 3B8YA 1QJVA 4XN3A 4Z05A 1K5CA 1DBGA 1IDJA 2PECA 1O8MA 3WWGA 2NTBA 4XL9A 2NSTA 2NT9A 4XM3A 2X85A 1WMRA 2VBEA 1DBOA 4W8SA 2NZMA 1KCDA 4XOPA 1EE6A 1O88A 1RMGA 4YZAA 4NK8A 3ZSCA 2EWEA 1NHCA 4XLAA 3GQ8A 1O8KA 1PXZA 2INVA 2NT6A 2ODLA 4OJPA 3VSUA 1O8IA 2UVFA 1IB4A 1BHEA 2O1DA 1OGMX 3GQ9A 3KRGA 4XLEA 2VJIA 4XQFA 1AIRA 2X6XA 1OFLA 3JURA 4C2LA 1PE9A 5C1CA 2Z8GA 3ZPPA 2BSPA 2VBMA 4YZXA 2O04A 2O0WA 2NTPA 4OJ5A 2UVEA 4PMHA 4MR0A 4XLCA 4HWVA 1VBLA 1BN8A 4YZQA 4OZZA 1O8DA 1PLUA 1O8LA 2O17A 4MXNA 4XKWA 2X6YA 4U4BA 3UW0A 1IA5A 3EQNA 1KCCA 2INUA 4XR6A 4Z03A 1OFMA 1O8JA 4W8TA 3LMWA 4XN0A 1KTWA 2VJJA 4NK6A 4W8RA 4XLHA 1XG2A 4EW9A 2QX3A 1HG8A 1OGOX 3VMVA 2PYGA 3EQOA 2X6WA 1O8EA 2NSPA 2VBKA 5AMVA 3GQAA 3VSTA 4XMYA 4W8QA
chains in the Genus database with same CATH superfamily
4XOTA 3FY3A 4URRA 1L1IA 2QXZA 4XNFA 2X3HA 1O8FA 2QY1A 2VFMA 2NTQA 4I84A 4Z06A 3GRHA 1JRGA 2IQ7A 1RU4A 3GQ7A 1GQ8A 4XORA 4OJ6A 1H80A 1TYVA 4XONA 3VMWA 1QCXA 1QRBA 1O8HA 2BM5A 2O0VA 1JTAA 1CZFA 1OOCA 3B90A 4YELA 2XTXA 3B4NA 4KH3A 1O8GA 3P4GA 1TYWA 4U49A 1LM1A 4XKVA 4YEJA 2W7ZA 4OJLA 4OJOA 5C1EA 3N6ZA 1X0CA 2PYHA 3SUCA 3T9GA 4OZYA 1RWRA 3VSVA 3NB2A 4XLFA 5DNSA 4AVZA 1IDKA 3AK5A 1K8FA 4YZ0A 2O6WA 3B8YA 3JX8A 2IOUG 1QJVA 3PSSA 4XN3A 4Z05A 1DBGA 3PSZA 1K5CA 1WXRA 1IDJA 2PECA 1O8MA 3WWGA 2VFOA 1QRCA 2NTBA 4XL9A 2VFNA 2NSTA 2NT9A 5JLVC 4XM3A 2X85A 3DU1X 1HF2A 1WMRA 1OFDA 1DBOA 2VBEA 4W8SA 2NZMA 3SZEA 1KCDA 4XOPA 1EE6A 1O88A 1RMGA 4YCQA 4YZAA 2XT4A 1EZGA 2EWEA 4NK8A 3SYJA 3ZSCA 1NHCA 4XLAA 1K4ZA 3GQ8A 1O8KA 1PXZA 1QA2A 4OPWA 3NAWA 1EA0A 1LLWA 2INVA 2NT6A 2ODLA 4OJPA 3VSUA 1O8IA 3PETA 2UVFA 1IB4A 2QZAA 1BHEA 3SY2A 2O1DA 1OGMX 2BM7A 3GQ9A 2VFQA 2VJIA 3KRGA 3LJYA 4XLEA 4YDTA 3SQVA 4XQFA 1AIRA 2BX6A 3BH7B 2X6XA 1OFLA 3JURA 4C2LA 1PE9A 5C1CA 2Z8GA 3ZPPA 2BSPA 2VBMA 1TYXA 4YZXA 2O04A 2O0WA 2NTPA 4YC5A 4OJ5A 2UVEA 2XC1A 4PMHA 4MR0A 4XLCA 2XTWA 4HWVA 3RIQA 4YEIA 1QQ1A 1KQ5A 4YFOA 2BM4A 1VBLA 1BN8A 2J8KA 4YZQA 4OZZA 5JMCB 1QA3A 2XT2A 3N90A 1O8DA 2G0YA 1OFEA 1PLUA 1O8LA 2O17A 4MXNA 4V02C 4XKWA 1TYUA 2X6YA 4U4BA 3UW0A 1QA1A 1IA5A 3EQNA 2B0RA 1KCCA 2INUA 3TH0A 4XR6A 2VFPA 1DABA 1TSPA 4Z03A 1OFMA 1LLZA 1O8JA 3BH6B 4W8TA 3LMWA 4JRAC 4XN0A 1KTWA 2VJJA 4NK6A 4W8RA 4XLHA 1XG2A 2YUHA 3H09A 4EW9A 2F3LA 2J8IA 1HG8A 2QX3A 1OGOX 3VMVA 2PYGA 1CLWA 3EQOA 3ML3A 2X6WA 4OM9A 1O8EA 2NSPA 2VBKA 5AMVA 2XTYA 3LYCA 3GQAA 3VSTA 4XMYA 4W8QA 2BM6A 2QYUA 2V5IA
chains in the Genus database with same CATH topology
4XOTA 3FY3A 4URRA 2QXZA 4XNFA 2X3HA 1O8FA 2QY1A 4I84A 2NTQA 4Z06A 3GRHA 1JRGA 2IQ7A 1RU4A 3GQ7A 1GQ8A 4XORA 4OJ6A 1H80A 4XONA 3VMWA 1QCXA 4YELA 1O8HA 2O0VA 3B90A 1JTAA 1CZFA 1OOCA 3B4NA 1O8GA 5C1EA 4U49A 4XKVA 4YEJA 4OJLA 4OJOA 1X0CA 2PYHA 3SUCA 3T9GA 4OZYA 1RWRA 3VSVA 4XLFA 4AVZA 1IDKA 4YZ0A 3B8YA 1QJVA 4XN3A 4Z05A 1K5CA 1DBGA 1IDJA 2PECA 1O8MA 3WWGA 2NTBA 4XL9A 2NSTA 2NT9A 4XM3A 2X85A 1WMRA 2VBEA 1DBOA 4W8SA 2NZMA 1KCDA 4XOPA 1EE6A 1O88A 1RMGA 4YZAA 4NK8A 3ZSCA 2EWEA 1NHCA 4XLAA 3GQ8A 1O8KA 1PXZA 2INVA 2NT6A 2ODLA 4OJPA 3VSUA 1O8IA 2UVFA 1IB4A 1BHEA 2O1DA 1OGMX 3GQ9A 3KRGA 4XLEA 2VJIA 4XQFA 1AIRA 2X6XA 1OFLA 3JURA 4C2LA 1PE9A 5C1CA 2Z8GA 3ZPPA 2BSPA 2VBMA 4YZXA 2O04A 2O0WA 2NTPA 4OJ5A 2UVEA 4PMHA 4MR0A 4XLCA 4HWVA 1VBLA 1BN8A 4YZQA 4OZZA 1O8DA 1PLUA 1O8LA 2O17A 4MXNA 4XKWA 2X6YA 4U4BA 3UW0A 1IA5A 3EQNA 1KCCA 2INUA 4XR6A 4Z03A 1OFMA 1O8JA 4W8TA 3LMWA 4XN0A 1KTWA 2VJJA 4NK6A 4W8RA 4XLHA 1XG2A 4EW9A 2QX3A 1HG8A 1OGOX 3VMVA 2PYGA 3EQOA 2X6WA 1O8EA 2NSPA 2VBKA 5AMVA 3GQAA 3VSTA 4XMYA 4W8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XOT A;  3FY3 A;  4URR A;  2QXZ A;  4XNF A;  2X3H A;  1O8F A;  2QY1 A;  4I84 A;  2NTQ A;  4Z06 A;  3GRH A;  1JRG A;  2IQ7 A;  1RU4 A;  3GQ7 A;  1GQ8 A;  4XOR A;  4OJ6 A;  1H80 A;  4XON A;  3VMW A;  1QCX A;  4YEL A;  1O8H A;  2O0V A;  3B90 A;  1JTA A;  1CZF A;  1OOC A;  3B4N A;  1O8G A;  5C1E A;  4U49 A;  4XKV A;  4YEJ A;  4OJL A;  4OJO A;  1X0C A;  2PYH A;  3SUC A;  3T9G A;  4OZY A;  1RWR A;  3VSV A;  4XLF A;  4AVZ A;  1IDK A;  4YZ0 A;  3B8Y A;  1QJV A;  4XN3 A;  4Z05 A;  1K5C A;  1DBG A;  1IDJ A;  2PEC A;  1O8M A;  3WWG A;  2NTB A;  4XL9 A;  2NST A;  2NT9 A;  4XM3 A;  2X85 A;  1WMR A;  2VBE A;  1DBO A;  4W8S A;  2NZM A;  1KCD A;  4XOP A;  1EE6 A;  1O88 A;  1RMG A;  4YZA A;  4NK8 A;  3ZSC A;  2EWE A;  1NHC A;  4XLA A;  3GQ8 A;  1O8K A;  1PXZ A;  2INV A;  2NT6 A;  2ODL A;  4OJP A;  3VSU A;  1O8I A;  2UVF A;  1IB4 A;  1BHE A;  2O1D A;  1OGM X;  3GQ9 A;  3KRG A;  4XLE A;  2VJI A;  4XQF A;  1AIR A;  2X6X A;  1OFL A;  3JUR A;  4C2L A;  1PE9 A;  5C1C A;  2Z8G A;  3ZPP A;  2BSP A;  2VBM A;  4YZX A;  2O04 A;  2O0W A;  2NTP A;  4OJ5 A;  2UVE A;  4PMH A;  4MR0 A;  4XLC A;  4HWV A;  1VBL A;  1BN8 A;  4YZQ A;  4OZZ A;  1O8D A;  1PLU A;  1O8L A;  2O17 A;  4MXN A;  4XKW A;  2X6Y A;  4U4B A;  3UW0 A;  1IA5 A;  3EQN A;  1KCC A;  2INU A;  4XR6 A;  4Z03 A;  1OFM A;  1O8J A;  4W8T A;  3LMW A;  4XN0 A;  1KTW A;  2VJJ A;  4NK6 A;  4W8R A;  4XLH A;  1XG2 A;  4EW9 A;  2QX3 A;  1HG8 A;  1OGO X;  3VMV A;  2PYG A;  3EQO A;  2X6W A;  1O8E A;  2NSP A;  2VBK A;  5AMV A;  3GQA A;  3VST A;  4XMY A;  4W8Q A; 
#chains in the Genus database with same CATH topology
 4XOT A;  3FY3 A;  4URR A;  1L1I A;  2QXZ A;  4XNF A;  2X3H A;  1O8F A;  2QY1 A;  2VFM A;  2NTQ A;  4I84 A;  4Z06 A;  3GRH A;  1JRG A;  2IQ7 A;  1RU4 A;  3GQ7 A;  1GQ8 A;  4XOR A;  4OJ6 A;  1H80 A;  1TYV A;  4XON A;  3VMW A;  1QCX A;  1QRB A;  1O8H A;  2BM5 A;  2O0V A;  1JTA A;  1CZF A;  1OOC A;  3B90 A;  4YEL A;  2XTX A;  3B4N A;  4KH3 A;  1O8G A;  3P4G A;  1TYW A;  4U49 A;  1LM1 A;  4XKV A;  4YEJ A;  2W7Z A;  4OJL A;  4OJO A;  5C1E A;  3N6Z A;  1X0C A;  2PYH A;  3SUC A;  3T9G A;  4OZY A;  1RWR A;  3VSV A;  3NB2 A;  4XLF A;  5DNS A;  4AVZ A;  1IDK A;  3AK5 A;  1K8F A;  4YZ0 A;  2O6W A;  3B8Y A;  3JX8 A;  2IOU G;  1QJV A;  3PSS A;  4XN3 A;  4Z05 A;  1DBG A;  3PSZ A;  1K5C A;  1WXR A;  1IDJ A;  2PEC A;  1O8M A;  3WWG A;  2VFO A;  1QRC A;  2NTB A;  4XL9 A;  2VFN A;  2NST A;  2NT9 A;  5JLV C;  4XM3 A;  2X85 A;  3DU1 X;  1HF2 A;  1WMR A;  1OFD A;  1DBO A;  2VBE A;  4W8S A;  2NZM A;  3SZE A;  1KCD A;  4XOP A;  1EE6 A;  1O88 A;  1RMG A;  4YCQ A;  4YZA A;  2XT4 A;  1EZG A;  2EWE A;  4NK8 A;  3SYJ A;  3ZSC A;  1NHC A;  4XLA A;  1K4Z A;  3GQ8 A;  1O8K A;  1PXZ A;  1QA2 A;  4OPW A;  3NAW A;  1EA0 A;  1LLW A;  2INV A;  2NT6 A;  2ODL A;  4OJP A;  3VSU A;  1O8I A;  3PET A;  2UVF A;  1IB4 A;  2QZA A;  1BHE A;  3SY2 A;  2O1D A;  1OGM X;  2BM7 A;  3GQ9 A;  2VFQ A;  2VJI A;  3KRG A;  3LJY A;  4XLE A;  4YDT A;  3SQV A;  4XQF A;  1AIR A;  2BX6 A;  3BH7 B;  2X6X A;  1OFL A;  3JUR A;  4C2L A;  1PE9 A;  5C1C A;  2Z8G A;  3ZPP A;  2BSP A;  2VBM A;  1TYX A;  4YZX A;  2O04 A;  2O0W A;  2NTP A;  4YC5 A;  4OJ5 A;  2UVE A;  2XC1 A;  4PMH A;  4MR0 A;  4XLC A;  2XTW A;  4HWV A;  3RIQ A;  4YEI A;  1QQ1 A;  1KQ5 A;  4YFO A;  2BM4 A;  1VBL A;  1BN8 A;  2J8K A;  4YZQ A;  4OZZ A;  5JMC B;  1QA3 A;  2XT2 A;  3N90 A;  1O8D A;  2G0Y A;  1OFE A;  1PLU A;  1O8L A;  2O17 A;  4MXN A;  4V02 C;  4XKW A;  1TYU A;  2X6Y A;  4U4B A;  3UW0 A;  1QA1 A;  1IA5 A;  3EQN A;  2B0R A;  1KCC A;  2INU A;  3TH0 A;  4XR6 A;  2VFP A;  1DAB A;  1TSP A;  4Z03 A;  1OFM A;  1LLZ A;  1O8J A;  3BH6 B;  4W8T A;  3LMW A;  4JRA C;  4XN0 A;  1KTW A;  2VJJ A;  4NK6 A;  4W8R A;  4XLH A;  1XG2 A;  2YUH A;  3H09 A;  4EW9 A;  2F3L A;  2J8I A;  1HG8 A;  2QX3 A;  1OGO X;  3VMV A;  2PYG A;  1CLW A;  3EQO A;  3ML3 A;  2X6W A;  4OM9 A;  1O8E A;  2NSP A;  2VBK A;  5AMV A;  2XTY A;  3LYC A;  3GQA A;  3VST A;  4XMY A;  4W8Q A;  2BM6 A;  2QYU A;  2V5I A; 
#chains in the Genus database with same CATH homology
 4XOT A;  3FY3 A;  4URR A;  2QXZ A;  4XNF A;  2X3H A;  1O8F A;  2QY1 A;  4I84 A;  2NTQ A;  4Z06 A;  3GRH A;  1JRG A;  2IQ7 A;  1RU4 A;  3GQ7 A;  1GQ8 A;  4XOR A;  4OJ6 A;  1H80 A;  4XON A;  3VMW A;  1QCX A;  4YEL A;  1O8H A;  2O0V A;  3B90 A;  1JTA A;  1CZF A;  1OOC A;  3B4N A;  1O8G A;  5C1E A;  4U49 A;  4XKV A;  4YEJ A;  4OJL A;  4OJO A;  1X0C A;  2PYH A;  3SUC A;  3T9G A;  4OZY A;  1RWR A;  3VSV A;  4XLF A;  4AVZ A;  1IDK A;  4YZ0 A;  3B8Y A;  1QJV A;  4XN3 A;  4Z05 A;  1K5C A;  1DBG A;  1IDJ A;  2PEC A;  1O8M A;  3WWG A;  2NTB A;  4XL9 A;  2NST A;  2NT9 A;  4XM3 A;  2X85 A;  1WMR A;  2VBE A;  1DBO A;  4W8S A;  2NZM A;  1KCD A;  4XOP A;  1EE6 A;  1O88 A;  1RMG A;  4YZA A;  4NK8 A;  3ZSC A;  2EWE A;  1NHC A;  4XLA A;  3GQ8 A;  1O8K A;  1PXZ A;  2INV A;  2NT6 A;  2ODL A;  4OJP A;  3VSU A;  1O8I A;  2UVF A;  1IB4 A;  1BHE A;  2O1D A;  1OGM X;  3GQ9 A;  3KRG A;  4XLE A;  2VJI A;  4XQF A;  1AIR A;  2X6X A;  1OFL A;  3JUR A;  4C2L A;  1PE9 A;  5C1C A;  2Z8G A;  3ZPP A;  2BSP A;  2VBM A;  4YZX A;  2O04 A;  2O0W A;  2NTP A;  4OJ5 A;  2UVE A;  4PMH A;  4MR0 A;  4XLC A;  4HWV A;  1VBL A;  1BN8 A;  4YZQ A;  4OZZ A;  1O8D A;  1PLU A;  1O8L A;  2O17 A;  4MXN A;  4XKW A;  2X6Y A;  4U4B A;  3UW0 A;  1IA5 A;  3EQN A;  1KCC A;  2INU A;  4XR6 A;  4Z03 A;  1OFM A;  1O8J A;  4W8T A;  3LMW A;  4XN0 A;  1KTW A;  2VJJ A;  4NK6 A;  4W8R A;  4XLH A;  1XG2 A;  4EW9 A;  2QX3 A;  1HG8 A;  1OGO X;  3VMV A;  2PYG A;  3EQO A;  2X6W A;  1O8E A;  2NSP A;  2VBK A;  5AMV A;  3GQA A;  3VST A;  4XMY A;  4W8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...