1IEJA

Ovotransferrin, n-terminal lobe, holo form, at 1.65 a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
329
structure length
329
Chain Sequence
KSVIRWCTISSPEEKKCNNLRDLTQQERISLTCVQKATYLDCIKAIANNEADAITLDGGQVFEAGLAPYKLKPIAAEVYEHTEGSTTSYYAVAVVKKGTEFTVNDLQGKTSCHTGLGRSAGWNIPIGTLLHRGAIEWEGIESGSVEQAVAKFFSASCVPGATIEQKLCRQCKGDPKTKCARNAPYSGYSGAFHCLKDGKGDVAFVKHTTVNENAPDQKDEYELLCLDGSRQPVDNYKTCNWARVAAHAVVARDDNKVEDIWSFLSKAQSDFGVDTKSDFHLFGPPGKKDPVLKDLLFKDSAIMLKRVPSLMDSQLYLGFEYYSAIQSMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OVOTRANSFERRIN
publication title Domain closure mechanism in transferrins: new viewpoints about the hinge structure and motion as deduced from high resolution crystal structures of ovotransferrin N-lobe.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 112
structure length 329
sequence length 329
ec nomenclature
pdb deposition date 2001-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iejA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iejA02
3R7XA 3TTNA 1XOCA 1FTOA 2THIA 2VOZA 4G68C 4R2BA 3TCGA 1POTA 2P0SA 4IO3A 2F7CA 5L8DA 5AA2D 1QUJA 1Y20A 4H65A 5H8NB 3IJOB 2ONRA 3QIMA 2O7IA 2D5WA 2DWIA 4L17A 4MH5A 5CRYA 3Q28A 4AB6A 3IJXB 3G7WA 4ECFA 3PPRA 3EHUA 2PMSA 4R72A 2QMXA 3OSQA 1SBPA 1A8FA 1PB8A 4PFTA 1VE4A 2QJEA 3MZ1A 4RK2A 1N76A 2V3TA 1B5JA 1ATGA 1ZBMA 3E4RA 3C9HA 4H5FA 3K1PA 4I9DA 1JW4A 2F6PA 1SW5A 3QYTA 1Z7NE 3Q27A 3K2DA 3O6GA 4IO4A 3MQ9A 4M4GA 1PDAA 2ZXTA 1YCJA 4YKJA 4NF5B 1GV8A 4F3BA 1B51A 3WAFA 3P7IA 3PD8A 5AA2A 1FQDA 3S9MC 2UVIA 4IO7A 1SQYA 3IO6A 2ZYNA 4ZEKA 3VLVA 3K4UA 3OMBA 3ILUB 3T66A 3N6UA 3B7DA 2Q9TA 2V3QA 4F2OA 4JSDA 1MQIA 3TTKA 4OMBA 2H25A 4EDPA 4IY5A 4JWOA 4F18A 2E0SA 3G3KA 2V93A 4YB6A 3FVKA 3L6GA 3PV0E 4ONYA 4WKMA 4NMYA 2O7UA 1SVXB 2DYXA 4O3BA 2Q89A 4LUBA 1Y1ZA 5JEIA 4QFNA 3ONMA 3PPPA 4JBZA 1VR5A 5KDTA 4GIZA 1MH3A 4FIMA 1AL3A 2YJPA 4U4SA 1SW1A 3UIFA 3OD7A 4LQ5A 4R9GA 4QSEA 3A3UA 4DCXA 1LLSA 4YKKA 3IX1A 1ZIUA 2YLNA 4G8HA 3F11A 4G4PA 3H6TA 3MVXA 4F3GA 1LB9A 3M8UA 2GHAA 3OO9A 4LZ8A 4BDRA 4AQ4A 1VFEA 5TPAB 3D4CA 3KGCA 2E1SA 3PGFA 1HSLA 4OTEA 1OLCA 2B65A 4X48A 3SERA 4JXIA 4MF3A 3FJGA 1UQWA 3MP1A 4HCWA 1FQAA 2PT2A 2Z8DA 1H45A 4YMAA 4WEPA 4KD5A 3SKPA 2QS4A 3C32A 1MXWA 3UK4A 3K6XA 4PE5B 2QPQA 3KOSA 1O7TA 1ZMGA 2F7BA 1B1HA 3U93A 3MZ9A 3ZS6A 2F34A 2Y7IA 3KJ7A 3KZGA 2XXYA 3T96B 2LAOA 3GXAA 1MY0A 5FTIA 3KN8A 1B3LA 2I3VA 4G2ZA 4PFUA 3K6WA 4F2QA 1LSTA 3H6VA 3RLFE 4POXA 4KFQA 4Q0CA 4IO2A 5DEXA 1MRPA 4U1OA 2Q2AA 2Q88A 5L9OA 4OFLA 4NE4A 3FASA 2H98A 1B5HA 2I48A 4ESXA 1TFDA 3C35A 2HEUA 1SYHA 5CI5A 2IA4A 1N84A 1GR2A 4RNSA 4X1DA 3TQLA 4KPTA 3SEYA 3IOWA 1MM6A 4THIA 4XXUA 2REGA 1B9JA 3H3GA 2HAUA 2G29A 4LA9A 3VVFA 4LATA 5I2KB 5JTYA 4QSCA 4TOZA 3DM0A 1POY1 3U94A 1M5BA 5I57B 1UTHA 5CMBA 1NH7A 2DWAA 2OJTA 3CFLA 1B3HA 3PUYE 2ZYKA 1I6BA 3EHSA 3TODA 2DE4A 2O6AA 3OO7A 1US4A 2QS1A 2ZMBA 3OSRA 2RCAA 3CRBA 1B0HA 1S9TA 1Y4CA 4NTLA 4ZECA 2D3IA 1L5TA 2XXTA 3LBSA 2NXOA 5I59B 4FAJA 3M3KA 3T22A 4BDMA 1DPEA 3KSXA 3H7MA 4YB7A 2GH9A 4PP0A 3TQWA 3QSLA 2G93A 2NWJA 3I5OA 3V8XB 3TAJA 1B7HA 4ZE9A 3HPIA 3Q26A 1DTZA 4RY1A 4LP2B 3K1NA 1MQJA 3IK6B 1GGGA 4H8IA 5H8HB 3SEWA 2ZYMA 4G68A 1ZTYA 5DTBA 2ONKE 2AL5A 2O84X 3G3HA 4DZ1A 2XX9A 2XXRA 1JW1A 3MP6A 3IORA 3VFJA 1XHYA 4R6HA 3TUSA 1O63A 5I84A 1XVXA 4EQ7A 4DXBA 5TP9B 4GD5A 1B32A 3K6UA 4GVOA 1XS5A 5A5XA 1PBQA 2IEEA 3FZVA 1LGBC 2OZZA 2ZNUA 3UGWA 5HM4B 3A09A 2X7QA 3BBRA 3B6QA 4EF2A 1MPBA 1A55A 1BTJA 5IKBA 1R1NA 4TLLB 3EPEA 2I6EA 3HCQA 1B4ZA 3FXQA 1P1NA 1ZKBA 2PYYA 3TFLA 1QW0A 4BLAA 1LAFE 3TTLA 4Q30B 3V89B 2PVUA 5I58B 3FUZA 2Q2CA 2HZLA 4ZZAA 1BKAA 5AA4A 2F6GA 3MW0A 1SI0A 4GXSB 4GXAA 4ELPA 2HFBA 4YKPA 4DCYA 2BJJX 3VLWA 3G3JA 1TWYA 2I4CA 4P0GA 1IEJA 4H8JA 1MPDA 1LFHA 3U72A 3DP8A 4HTGA 4H0WA 1ANFA 2AIXA 2I49A 3IOVA 3O9PA 3VXCA 3FJMA 2DXRA 2UVJA 3CSBA 2GHBA 5J1DA 1OMPA 2AYSA 1NMUA 3LC8A 2REJA 1N3WA 5B7DA 3T9VA 1VSOA 3FIRA 1MS7A 3IO4A 4WXJA 4K3FA 1OQGA 2P1SA 1LBCA 4GF8A 3TTRA 2F78A 2I4BA 3JYRA 4LONB 3CR9A 3PMXA 1YTVA 3CVGA 3C31A 4RA1A 4LVQA 1T0KA 1NNFA 4OHNA 4R74A 5DYHA 4DDDA 2F97A 3BFUA 5ICQA 1WDNA 1JVYA 1CB6A 3HSTA 3CG3A 2OBGA 5F1QA 2RINA 1Z7ME 2DWJA 1RKMA 1JETA 3MAMA 4H5GA 3ECRA 4YMBA 5K2XA 1EZPA 4U23A 2Z23A 3FJ7A 4UACA 4GQOA 3UP9A 2XXIA 3CIJA 3VDFA 1D9VA 5CBSA 4PETA 4YKIA 1FTMA 3RUMA 5AA2B 5EHMA 2RC7A 4DE8A 3O6HA 1RYOA 3EHTA 1FCKA 1GVCA 4FEDA 2VHAA 2DWHA 1FTJA 4QFLA 2Y7PA 3PUXE 3MP8A 2DS9A 3FVGA 3M3FA 4G77A 3FV2A 3O6IA 3UORA 2Y7KA 3DP6A 1DPPA 1CE2A 3S2VA 1N0TA 3SESA 1AIVA 5KCJA 3LSFB 3FVNA 1B6HA 5ITPA 1IXHA 1SW4A 3V83A 5KDTB 4O3AA 2QMWA 2Y7WA 1JVXA 2DOJA 1Y3NA 2B3FA 1MXVA 1SDXA 4GWOA 3W9VA 4JSOA 3CFXA 3RT8A 4OFOA 2RCBA 4RXLA 4EUOA 3OENA 1RYXA 2RC8A 4R6KA 3O29A 3RT6B 1H43A 3W9WA 3S9LC 2R71A 3TYHA 4N13A 1YAEA 2ESNA 4KCCA 3S9NC 5TPAA 3JZJA 4M1VA 2DE2A 4MLVA 5ICTA 2RKMA 3R26A 4QFOA 3OO6A 4I8CA 3PPOA 3USDA 4C0RA 1A99A 2F5XA 4MFIA 1USYH 1Q35A 3UA8A 1A7LA 3MVZA 2QS3A 1F9BA 4RYAA 4F39A 2HZKA 5H8QA 2AL4A 1PEBA 3KN7A 1JW5A 1QUIA 3PMWA 3DELB 1IIWA 4NF6B 4IO6A 5L9SA 1WODA 1KWHA 4ESWA 1Y4TA 3LSWA 2DVZA 3OXNA 1FQEA 4R9FA 4FORA 3FATA 4ND9A 1PB7A 4E0XA 1N7XA 3PUVE 1MDP1 4OENA 4ZZEA 3TCHA 5DEXB 1M5DA 1A54A 5I2NA 4F3PA 4BDOA 3K6VA 4ZDMA 1MY2A 4KCDA 4OQOA 2O1MA 5EHSA 1IQ7A 4JWXA 3LUYA 3IOUA 3I3VA 3PD9A 1MH4A 4LQ2A 3VV5A 3L6HA 1Y1MA 4EQ9A 4YAHX 3T9HB 5ISUA 5AA1A 3E9XA 1QUKA 3DLNA 1PB9A 3RTFB 3FVOA 4U2RA 5FTHA 3QUJA 2F36A 4H67A 5DVIA 4LZ5A 3MUQA 5JK4A 2UYFA 1B3GA 3QXMA 4G8NA 4G8MA 1LBBA 1NH8A 5JTYB 5H8FB 4F31B 5DVFA 3OELA 3U8QA 2ZNTA 2V84A 3S9EA 3U1OA 3MVYA 1UTHB 4XTCQ 4GFRA 3K01A 1A40A 2OK2A 3ZKLA 2I3WA 4FE8A 1JEUA 2H5YA 2HQ0A 3C33A 3UN6A 3V5AA 4ISUA 3N26A 2DSFA 5LOMA 2FA7A 2NOOA 1URGA 3N5LA 4PFWA 3QAXA 3GBAA 3TTMA 3IB0A 5CC2A 1JNFA 1PBPA 3PPQA 2H9BA 3R6UA 1Q1KA 4GLIA 1IITA 4KHZE 2GFEA 3OOAA 4YZZA 4TQUQ 4YU0A 1MXZA 1NFTA 3H03A 5EYFA 3FV1A 2ZNSA 5I56A 4BDNA 2R9JA 1B2HA 3THIA 4EXKA 4QRZA 3OEKA 2UXAA 1M5CA 1LAHE 2KLFA 4O3CA 4C1TA 3HO7A 1P1OA 4G68B 1FQFA 1AH5A 2VD3A 5DT6A 4KYEA 4KYDA 3C34A 1HSEA 1S7YA 3VXBA 2Z22A 1D4NA 4OERA 4ELQA 3H06B 2PX1A 4E0WA 2XX8A 2A5TA 1OLAA 1B40A 3N94A 1XC1A 4YB5A 4BDLA 1MDQA 1Y3QA 5A5XB 3DP4A 2XXVA 3VVEA 3KEIA 4RK9A 4F1YA 1ZLQA 2V3UA 1JEVA 1NL5A 1SYIA 3M3LA 3H4ZA 2X7PA 5BUUA 3HHGA 4NF8A 1QULA 1XT8A 1UTBA 2FNCA 3SDFA 3K1MA 1M5FA 3SEXA 3O66A 5H8SA 4XKRA 3IB1A 5BWJA 1ZU0A 5AE4A 5I58A 1FW0A 3TELA 3KJTA 1R9LA 4Z0IA 1I69A 1NNTA 2W7YA 3MJNA 3MBPA 4FECA 4I1DA 4BDQA 1AMFA 5AA4B 4JB7A 4NF4A 1JQFA 3ILTB 4GL0A 4QHQA 3K02A 1FTKA 3KSJA 4GOTA 1OVBA 1FQCA 2DXYA 3WAEA 4WEDA 2GRVA 2XXWA 4KR5A 3TPAA 4F1VA 2OWSA 3MPKA 3MPLA 3TDJA 5KZTA 4R73A 1MY4A 3CFZA 3FD3A 1LCTA 2R6GE 2Y84A 5CMKA 1D3KA 1B52A 4AB5A 1VFDA 5H8NA 2O69A 1URDA 1O64A 4U22A 2Z8EA 4OFJA 3AXFA 3SEVA 4P11A 2X26A 1N7WA 3MC2A 3EN3A 3MZBA 2Q8JA 3G3GA 3HHFA 4DXCA 1LFGA 1Y3PA 2I58A 2H4IA 4OETA 2CZLA 1B3EA 1DTGA 5CMCA 5ITOA 2OCUA 3GLBA 3GZGA 4U1ZA 3HV1A 1BLFA 3OEMA 1HSJA 4F3SA 1B58A 1MXYA 4HS7A 4NF5A 1QKAA 1B1XA 4XKPA 3ZSFA 4DLDA 2XD3A 1OIBA 1M5EA 3PMVA 2QS2A 1I6AA 2XHDA 5K2YA 3N6TA 4POWA 1B05A 3SETA 2RF1A 4ELRA 4X9TA 4F22A 4H1XA 4QFPA 1LCFA 3H6UA 4XKQA 1MPCA 3OO8A 4U21A 3O2AA 3U92A 1LB8A 4OZ9A 3IB2A 4KI0E 3K00A 5ELVA 1GTKA 1B3FA 3CSGA 1WVJA 1EU8A 1MG1A 2O1LA 3VE1B 3QUFA 3RQTA 1SW2A 5FHNA 3FXUA 5M2VA 2D21A 5KCJB 3LSXA 4EQBA 1EH3A 2UYEA 1IXIA 4GRKA 4ZEIA 3D4GA 1N04A 2I0BA 2XXPA 2UVGA 5B70A 1EZOA 2PBWA 1YPNA 4PFYA 3ZKKA 1MM7A 4R2FA 2CMOA 4UA8A 4FATA 4I62A 3LR1A 3KOTA 4HW8A 1BIYA 1NNKA 2DE3A 4F29A 3TZAA 3G3FA 1MQDA 4NWCA 1QJMA 3E3KA 3RY3A 2DVCA 3CI8A 4NEDA 4N07A 2F35A 1IZ1A 4MBPA 1SI1A 4MLQA 2ANJA 4F19A 2XXUA 1H44A 3MWBA 3PUZE 3JV9A 2Y7RA 5FHMA 3IAZA 2VGQA 5TU0A 1PC3A 3K0VA 3IL1B 4U4XA 3W15C 1B7ZA 1SD3A 4H6DA 1TXFA 4X1BA 4RJZA 2XX7A 1FQBA 4IO5A 4JDFA 3H6WA 5H8QB 3B6WA 4DIGA 4QSDA 1P1QA 4NF6A 3KG2A 5AA3A 5L9MA 2ABHA 1LFIA 2ZYOA 1IUDA 3S4UA 3RNNA 3IR1A 3Q29A 3PUWE 5HBCA 5CMMA 1TT1A 4ZEFA 5DVJA 2QL3A 2O51A 1MXUA 4OXVA 3O28A 1R6ZA 5HPQA 1QKBA 1USYE 1DOTA 5I2NB 2WKYA 1P1WA 3IOTA 4KQPA 1DMBA 2VP1A 1P1UA 4R75A 1IXGA 4Q5TA 5CBRA 5CM6A 2VD2A 1LAGE 4R6YA 4HCYA 5IAIA 3RN8A 2XXQA 2QSXA 3TMGA 4ELOA 2F7AA 3QK6A 5I2KA 3KBRA 2HXWA 1AOVA 4XKNA 5I57A 1UIVA 3VLUA 4YICA 5H8FA 4DXUA 4FEBA 3GBBA 3C36A 3RGYA 2ALUA 4QFKA 3O97A 2M8CA 1UIUA 4NWDA 2ONSA 3B6TA 4IB2A 4EXLA 1DSNA 2NUVA 4RPOA 3FXRA 4ZE8A 1H76A 1BP5A 2DQVA 5I59A 4Z7EA 3PU5A 3HN0A 4QF9A 5F7VA 2XD2A 4N6PA 2YPNA 2HCAA 4IGRA 1B0LA 2V25A 4FJPA 3RTWB 2I0CA 2QRYA 1D9YA 3KN3A 4OEVA 5H8HA 3EF7A 1ZJLA 4OEUA 1EZ9A 1MY1A 1XVYA 2XXXA 1MY3A 2XXHA 4OWDA 3PPNA 5I56B 3I6VA 3ODBA 4JWYA 3KFMA 1N3XA 1P99A 1Y9UA 1URSA 1S50A 4ZS9A 1OQHA 3CG1A 4IGTA 1II5A 4C1UA 4Q8RA 4OVJA 3E13X 4TLMB 3T9UA 5TP9A 4OESA 2DP8A 3TEPA 3FGSA 4EF1A 2B3BA 1ELJA 2HAVA 4RPNA 1I6QA 3G3IA 2F8DA 2A5TB 1LAXA 2A5SA 3Q25A 3RPWA 3A3CA 1MQGA 2FYIA 4PQJA 2NVUB 1B4HA 3VVDA 2UVHA 2Z8FA 4IY6A 3T9XB 3C4MA 1FTLA 3TCFA 4XIGQ 1MQHA 4OYVA 4NF8B 1UTBB 3T93B 5FHOA 3SEUA 1QVSA 1MXXA 3MVWA 2O68A 4GL8A 1B7UA 1H3DA 1TFAA 2RC9A 2OWTA 4LZ7A 3BKIB 2OLBA 4ZEDA 1B46A 1A8EA 4NF4B 2PT1A 4ZEBA 4KYSA 3EQ1A 1OVTA 4P0IA 3BFTA 2P2AA 2H99A 1IXCA 1NNPA 3LSLA 1J1NA 1NKXA 4F1UA 1US5A 1R9QA 3TKDA 1B5IA
chains in the Genus database with same CATH superfamily
3R7XA 3TTNA 1XOCA 1FTOA 2THIA 2VOZA 4G61A 4G68C 4R2BA 3TCGA 1POTA 2P0SA 4IO3A 2F7CA 5L8DA 5AA2D 1QUJA 1FTAA 1Y20A 4H65A 5H8NB 2PFYA 3IJOB 2ONRA 3QIMA 2O7IA 2D5WA 2XWKA 2DWIA 4L17A 4MH5A 5ET5A 5CRYA 3Q28A 1FRPA 4AB6A 3IJXB 3G7WA 4ECFA 3PPRA 3EHUA 2PMSA 4R72A 3E79A 4GWUA 2QMXA 3OSQA 1SBPA 1A8FA 1PB8A 4PFTA 1VE4A 2QJEA 3MZ1A 4RK2A 1N76A 2V3TA 1B5JA 1ATGA 1ZBMA 3E4RA 1FBFA 3C9HA 4H5FA 5EQ8A 3K1PA 2WYPA 4I9DA 2VPNA 1JW4A 2F6PA 1SW5A 3QYTA 1Z7NE 3Q27A 4PCDA 3K2DA 3O6GA 4IO4A 3MQ9A 4M4GA 1PDAA 2ZXTA 1YCJA 4YKJA 4NF5B 1GV8A 4F3BA 1B51A 3WAFA 3P7IA 3PD8A 5AA2A 1FQDA 3S9MC 2UVIA 4IO7A 1SQYA 3IO6A 2ZYNA 4ZEKA 3VLVA 3K4UA 3OMBA 3ILUB 3T66A 3N6UA 3B7DA 2Q9TA 2V3QA 4F2OA 4JSDA 1MQIA 4PAFA 4OMBA 3TTKA 2H25A 4EDPA 4IY5A 4JWOA 4F18A 5A5LA 2E0SA 1FBGA 3G3KA 2V93A 4YB6A 3FVKA 4PFIA 3L6GA 3PV0E 4ONYA 4WKMA 4NMYA 3QMFA 2O7UA 1SVXB 2DYXA 4O3BA 2Q89A 4LUBA 4NHBA 2CZIA 1AWBA 1Y1ZA 5JEIA 4QFNA 3ONMA 3PPPA 4JBZA 1VR5A 5KDTA 1G0IA 4GIZA 1MH3A 4FIMA 2L5VA 1AL3A 2YJPA 4GX6A 4U4SA 1SW1A 3UIFA 4OA4A 3OD7A 4LQ5A 4R9GA 4QSEA 3A3UA 4N91A 4DCXA 1LLSA 4YKKA 3IX1A 1ZIUA 2YLNA 4G8HA 3F11A 4G4PA 3H6TA 3MVXA 4F3GA 1LB9A 3M8UA 2GHAA 3MSTA 3OO9A 4LZ8A 5IZ1A 4BDRA 4AQ4A 1VFEA 5TPAB 3D4CA 4NGUA 1VDWA 3KGCA 1FPBA 2E1SA 3PGFA 1HSLA 3RPLB 4OTEA 1OLCA 2B65A 4X48A 3SERA 4JXIA 4MF3A 3FJGA 4KXPA 1UQWA 3MP1A 4HCWA 1FQAA 2PT2A 2Z8DA 1H45A 4GWZA 1EYJA 4WEPA 4YMAA 4KD5A 1NUWA 3SKPA 2QS4A 2Y5KA 1FPJA 3C32A 1MXWA 3UK4A 3K6XA 4PE5B 2QPQA 1LEVA 3KOSA 1O7TA 1ZMGA 2F7BA 1B1HA 3U93A 3MZ9A 3ZS6A 2F34A 2Y7IA 3KJ7A 3KZGA 3NOHA 4PDDA 2XXYA 3T96B 4XF5A 2LAOA 3GXAA 1MY0A 5FTIA 3KN8A 1B3LA 2I3VA 4G2ZA 4PFUA 3K6WA 4F2QA 1LSTA 3H6VA 3RLFE 4POXA 4KFQA 4Q0CA 4IO2A 5DEXA 1MRPA 4U1OA 5EQ9A 2Q2AA 2Q88A 4AS5A 5L9OA 4OFLA 4NE4A 3FASA 2H98A 4NF0A 1B5HA 1LBYA 2I48A 4ESXA 1TFDA 3C35A 2HEUA 1SYHA 5CI5A 2IA4A 1N84A 1GR2A 4N17A 4RNSA 5EYHA 4X1DA 3TQLA 4KPTA 3KC1A 4UABA 3SEYA 3IOWA 1MM6A 4THIA 1IMEA 2FIEA 4XXUA 2REGA 1B9JA 2KQZA 3H3GA 2HAUA 2G29A 4LA9A 3VVFA 3SZPA 4LATA 5I2KB 5JTYA 4QSCA 4TOZA 3DM0A 1POY1 3U94A 1M5BA 5I57B 1UTHA 5CMBA 1NH7A 2DWAA 4PFBA 5ET6A 2OJTA 3CFLA 1B3HA 1INPA 3PUYE 2ZYKA 1I6BA 3EHSA 2HPGA 3TODA 2DE4A 2O6AA 3OO7A 1US4A 2QS1A 1K9YA 2ZMBA 3OSRA 2RCAA 3CRBA 1B0HA 1S9TA 1Y4CA 4NTLA 4ZECA 2D3IA 3ROJA 1L5TA 2XXTA 1NV1A 3LBSA 2NXOA 5I59B 4FAJA 3M3KA 3T22A 4BDMA 1DPEA 3KSXA 3H7MA 4YB7A 2GH9A 4PP0A 3TQWA 3QSLA 2G93A 2NWJA 3I5OA 3V8XB 3TAJA 4O8MA 1B7HA 4ZE9A 3HPIA 4QXDA 3Q26A 5IZ3A 2F3DA 1DTZA 4RY1A 4LP2B 3K1NA 1MQJA 3IK6B 1GGGA 4H8IA 5H8HB 3SEWA 2ZYMA 4G68A 1ZTYA 5DTBA 2ONKE 2AL5A 2O84X 3G3HA 5DW8A 4PC9A 1Q9DA 2BJIA 4DZ1A 1YZ0A 2XX9A 2XXRA 1JW1A 3B50A 3MP6A 3IORA 3VFJA 1XHYA 4R6HA 3TUSA 1O63A 5I84A 1XVXA 4EQ7A 4DXBA 5TP9B 4GD5A 1B32A 3K6UA 4GVOA 1XS5A 5A5XA 1PBQA 2IEEA 3FZVA 4PDHA 1LGBC 2OZZA 1NV2A 2ZNUA 3UGWA 5HM4B 3A09A 2X7QA 3BBRA 3B6QA 4EF2A 1MPBA 1A55A 1EYIA 1BTJA 4NQ8A 5IKBA 1R1NA 4TLLB 3EPEA 2I6EA 3HCQA 1IMAA 1B4ZA 3FXQA 1P1NA 1ZKBA 2PYYA 3TFLA 5J16A 1QW0A 4BLAA 1LAFE 3TTLA 4Q30B 3V89B 2PVUA 5I58B 4PBHA 3FUZA 4GBVA 5EQ7A 2Q2CA 2ZZVA 2HZLA 4ZZAA 1BKAA 4GX3A 5AA4A 2F6GA 3MW0A 1SI0A 4GXSB 4GXAA 4ELPA 4MHFA 2HFBA 4YKPA 4DCYA 2BJJX 3VLWA 3G3JA 1TWYA 2I4CA 2WBDA 4P0GA 1IEJA 2P3NA 4GX4A 4H8JA 4PF8A 4PFRA 1MPDA 1BK4A 1LFHA 1JP4A 4XEQA 3U72A 3DP8A 4HTGA 4H0WA 5LTCA 1ANFA 2AIXA 2I49A 3LV0A 3IOVA 3O9PA 3VXCA 3FJMA 2DXRA 2UVJA 3CSBA 4X8RA 2GHBA 5J1DA 1OMPA 2AYSA 1NMUA 3LC8A 2REJA 1N3WA 5B7DA 3T9VA 1VSOA 3FIRA 1MS7A 3IO4A 4WXJA 4K3FA 1OQGA 2P1SA 1LBCA 4GF8A 3HFUA 2JJKA 3TTRA 2F78A 2I4BA 3JYRA 4OVRA 4LONB 3CR9A 3PMXA 1YTVA 3CVGA 3C31A 4RA1A 4LVQA 1T0KA 1NNFA 4OHNA 4R74A 5DYHA 4DDDA 2F97A 3BFUA 5ICQA 1WDNA 1JVYA 1CB6A 5EQAA 3HSTA 3CG3A 2OBGA 5F1QA 2RINA 4P1LA 1Z7ME 2DWJA 1LBZA 1RKMA 1JETA 3MAMA 4H5GA 3ECRA 4YMBA 5K2XA 1EZPA 4U23A 1LBWA 4MNIA 2Z23A 3EKIA 3FJ7A 4UACA 4GQOA 3UP9A 1FBPA 2XXIA 3CIJA 3VDFA 1FPIA 1D9VA 4H45A 5CBSA 4PETA 4YKIA 1FJ6A 4NG7A 4NAPA 1FTMA 3RUMA 5AA2B 5EHMA 2RC7A 4DE8A 3ISPA 3O6HA 1RYOA 3EHTA 1FCKA 1GVCA 4FEDA 2VHAA 4GWXA 2DWHA 1FTJA 4QFLA 2Y7PA 3PUXE 3MP8A 2DS9A 3FVGA 3M3FA 4G77A 3FV2A 3O6IA 3UORA 2Y7KA 3DP6A 1QGXA 2B4MA 1DPPA 1CE2A 3S2VA 1N0TA 4HE2A 1KZ8A 3SESA 1AIVA 5KCJA 2CEYA 3LSFB 3FVNA 1B6HA 5ET7A 5ITPA 1IXHA 1SW4A 3V83A 5KDTB 4O3AA 2Y5LA 2QMWA 2Y7WA 1JVXA 2DOJA 1Y3NA 2B3FA 1MXVA 1SDXA 3T0JA 4GWOA 4I3YA 3W9VA 4JSOA 3CFXA 3RT8A 4OFOA 2RCBA 4RXLA 4EUOA 3OENA 1RYXA 2RC8A 4R6KA 3O29A 3RT6B 1H43A 3W9WA 2XXKA 3S9LC 2R71A 3TYHA 4N13A 1YAEA 2ESNA 4KCCA 3S9NC 5TPAA 2ZZWA 3BIHA 3JZJA 2VT5A 4M1VA 2DE2A 4MLVA 5ICTA 2RKMA 2FHYA 3R26A 4PGPA 4QFOA 3OO6A 3A29A 4I8CA 3PPOA 3USDA 4C0RA 1A99A 2F5XA 4MFIA 4GWWA 1USYH 1Q35A 3UA8A 1A7LA 3MVZA 4IR8A 2QS3A 1F9BA 4RYAA 4F39A 2HZKA 5H8QA 2AL4A 1PEBA 3KN7A 2KR0A 1JW5A 1QUIA 3PMWA 3DELB 1IIWA 4NF6B 4IO6A 5L9SA 1WODA 1KWHA 4ESWA 1Y4TA 3LSWA 2DVZA 3OXNA 1FQEA 4R9FA 4FORA 3FATA 4ND9A 1PB7A 4E0XA 1N7XA 3CHGA 3PUVE 1MDP1 3U65A 4OENA 4ZZEA 3TCHA 5DEXB 1M5DA 1A54A 5I2NA 4F3PA 1DBZA 4BDOA 3K6VA 4ZDMA 1MY2A 4KCDA 4OQOA 2O1MA 5EHSA 1IQ7A 4JWXA 1RDXA 3LUYA 4N15A 3IOUA 3I3VA 3PD9A 1MH4A 4MCOA 4LQ2A 3VV5A 3L6HA 1Y1MA 4EQ9A 4YAHX 2CZHA 3T9HB 5ISUA 5AA1A 2V4CA 3E9XA 1QUKA 3DLNA 1PB9A 3RTFB 2FBPA 3FVOA 4U2RA 5FTHA 3QUJA 2F36A 4H67A 5DVIA 4LZ5A 3MUQA 3MYUA 5JK4A 2UYFA 1B3GA 3QXMA 4G8NA 2DDKA 4G8MA 1LBBA 1NH8A 5JTYB 5H8FB 4F31B 2ZZXA 5DVFA 3OELA 3U8QA 2ZNTA 2V84A 3S9EA 1K9ZA 3U1OA 3MVYA 1UTHB 4XTCQ 4GFRA 3K01A 1A40A 2OK2A 3ZKLA 4I40A 2I3WA 4FE8A 1JEUA 2H5YA 2HQ0A 3C33A 3UN6A 3V5AA 1FPGA 4ISUA 3N26A 2DSFA 5LOMA 2FA7A 2NOOA 1URGA 3N5LA 4PFWA 3QAXA 1EYKA 2PFZA 1IMCA 1NUXA 3GBAA 3TTMA 3IB0A 5CC2A 1JNFA 1PBPA 1YYZA 2H9BA 3PPQA 3R6UA 1Q1KA 4GLIA 1IITA 4KHZE 2GFEA 4P1EA 3OOAA 4YZZA 4TQUQ 4YU0A 1MXZA 1NFTA 3H03A 5EYFA 1FPEA 3FV1A 5IZ3B 4OVSA 2ZNSA 5I56A 4BDNA 2R9JA 1B2HA 3THIA 4EXKA 4QRZA 3OEKA 2UXAA 1M5CA 1LAHE 2KLFA 2GQ1A 4O3CA 4C1TA 3HO7A 1P1OA 4G68B 5IM2A 2FIXA 1FQFA 1AH5A 2VD3A 5DT6A 4KYEA 4N4UA 4KYDA 2XWOA 3C34A 4LN5A 1HSEA 1S7YA 3VXBA 2Z22A 1D4NA 5T3JA 4OERA 4ELQA 3H06B 4PAIA 1G0HA 2PX1A 4E0WA 2XX8A 2A5TA 1OLAA 1B40A 3N94A 1XC1A 4YB5A 4BDLA 1MDQA 1Y3QA 5A5XB 3DP4A 5IGAA 2XXVA 3VVEA 4PAKA 1CNQA 1LBXA 3KEIA 4RK9A 5ET8A 4F1YA 1ZLQA 4P56A 2V3UA 1JEVA 1NL5A 4P8BA 1SYIA 3M3LA 3H4ZA 2X7PA 5BUUA 3HHGA 4NF8A 2XWVA 1QULA 1XT8A 1UTBA 2FNCA 3SDFA 2Q74A 3K1MA 1M5FA 3SEXA 1KA1A 3KC0A 4OVTA 3O66A 5H8SA 4XKRA 3IB1A 5BWJA 1ZU0A 5AE4A 5I58A 1FW0A 3TELA 3KJTA 1R9LA 4Z0IA 1I69A 1NNTA 2W7YA 3MJNA 4JVCA 3MBPA 4HE1A 4FECA 4I1DA 4BDQA 1AMFA 5AA4B 4JB7A 4NF4A 4N6KA 1JQFA 3ILTB 4GL0A 4QHQA 3K02A 1FTKA 3KSJA 4GOTA 1OVBA 4GWSA 1FQCA 2DXYA 1XI6A 3WAEA 4WEDA 2GRVA 4N6DA 2XXWA 4KR5A 3TPAA 4F1VA 2OWSA 2OX3A 3MPKA 3MPLA 3TDJA 5KZTA 4R73A 1MY4A 3CFZA 3FD3A 1LCTA 2R6GE 2Y84A 1FPFA 5CMKA 1D3KA 1B52A 4AB5A 4X04A 4MIJA 1VFDA 5H8NA 2O69A 2Q8MA 1URDA 1O64A 4U22A 2Z8EA 4OFJA 3AXFA 3SEVA 4P11A 2X26A 1N7WA 2WBBA 1RDYA 4FBPA 3MC2A 3EN3A 5IZZA 3MZBA 5FBPA 2Q8JA 5EYGA 3G3GA 3HHFA 4DXCA 1LFGA 1Y3PA 2I58A 2H4IA 4OETA 2CZLA 1B3EA 1DTGA 5CMCA 4AS4A 5ITOA 2OCUA 3GLBA 3GZGA 4U1ZA 3HV1A 1BLFA 4MJOA 3OEMA 1HSJA 4F3SA 1B58A 1MXYA 4HS7A 1FJ9A 4NF5A 1QKAA 1B1XA 4XKPA 3ZSFA 4DLDA 2XD3A 1OIBA 1M5EA 3PMVA 2QS2A 5I7IA 1I6AA 2XHDA 4PE3A 5K2YA 3GYYA 3N6TA 4POWA 2OWZA 1B05A 3SETA 2RF1A 4ELRA 4X9TA 4F22A 4H1XA 4QFPA 1LCFA 3H6UA 4XKQA 1MPCA 3OO8A 3D1RA 1DCUA 4U21A 3O2AA 3U92A 1LB8A 4OZ9A 3IB2A 4KI0E 1NV5A 3K00A 5ELVA 1NV3A 1FBHA 1GTKA 1B3FA 1NV7A 2R8TA 3CSGA 1WVJA 4O7IA 1EU8A 1MG1A 1FBCA 2O1LA 3VE1B 2VPOA 3QUFA 3RQTA 1SW2A 5FHNA 3FXUA 5M2VA 2D21A 3T1BA 3LSXA 4EQBA 5KCJB 1EH3A 2UYEA 1IXIA 4GRKA 4HE0A 4ZEIA 3D4GA 1N04A 2I0BA 2XXPA 1IMBA 2UVGA 4O94A 3IFCA 5B70A 1EZOA 4GWYA 2QVUA 2PBWA 4I3EA 1YPNA 4PFYA 3ZKKA 1MM7A 4R2FA 2CMOA 2F3BA 4UA8A 4FATA 4I62A 4PF6A 2FVZA 3LR1A 3KOTA 4HW8A 1BIYA 1NNKA 2DE3A 4N8YA 4F29A 1FPKA 4DI4B 3TZAA 3G3FA 1MQDA 4NWCA 1QJMA 1RDZA 3E3KA 3RY3A 1YXIA 2DVCA 3RPLA 3CI8A 4P3LA 4NEDA 4N07A 4P9KA 2F35A 2QVRA 1IZ1A 4MBPA 1SI1A 4MLQA 2ANJA 1NV6A 4F19A 2XXUA 1H44A 3MWBA 3PUZE 3JV9A 2Y7RA 5FHMA 3IAZA 1FPLA 2VGQA 5TU0A 4PGNA 1PC3A 3K0VA 3IL1B 4U4XA 3W15C 1B7ZA 1SD3A 4H6DA 1KA0A 1TXFA 3FXBA 4X1BA 4RJZA 2XX7A 1FQBA 4IO5A 4JDFA 3H6WA 5H8QB 3B6WA 4DIGA 4QSDA 1P1QA 4NF6A 3KG2A 5AA3A 5L9MA 2ABHA 1LFIA 2ZYOA 1IUDA 3S4UA 3RNNA 3IR1A 4O7MA 3Q29A 4OVPA 3PUWE 5HBCA 5CMMA 1TT1A 4ZEFA 5DVJA 3RYDA 2QL3A 2O51A 1MXUA 4OXVA 3O28A 2CEXA 1R6ZA 5HPQA 1QKBA 1USYE 1DOTA 5I2NB 2WKYA 4MEVA 1P1WA 3IOTA 2CZKA 4PTKA 3IFAA 4JVDA 4KQPA 1DMBA 2VP1A 1P1UA 4R75A 1IXGA 4PBQA 4Q5TA 5CBRA 5CM6A 2VD2A 1LAGE 4R6YA 4HCYA 5IAIA 3RN8A 2XXQA 2QSXA 1FPDA 3TMGA 2MKZA 4ELOA 2F7AA 4MNPA 1NV0A 3QK6A 5I2KA 3KBRA 2HXWA 1AOVA 1LBVA 4XKNA 5I57A 1UIVA 3VLUA 4YICA 5F24A 4GBWA 5H8FA 4DXUA 4FEBA 3GBBA 4QBAA 3PTYA 3C36A 4MMPA 3RGYA 2ALUA 4QFKA 5I5PA 2WEFA 3O97A 2M8CA 1UIUA 4JVIA 4NWDA 2ONSA 3B6TA 1NUZA 4IB2A 4EXLA 1DSNA 1NUYA 2NUVA 4RPOA 1DK4A 4NX1A 3LUZA 3FXRA 4ZE8A 1H76A 1BP5A 2DQVA 5I59A 4Z7EA 3PU5A 3HN0A 1IMDA 4QF9A 5F7VA 2XD2A 2XWIA 4N6PA 4N81A 2YPNA 2HCAA 4IGRA 1NV4A 1B0LA 2V25A 3FBPA 4FJPA 3RTWB 2I0CA 2QRYA 1D9YA 3KN3A 1IMFA 4HXVA 4OEVA 5H8HA 3EF7A 1ZJLA 4H46A 4OEUA 1EZ9A 1FSAA 1MY1A 1XVYA 3B8BA 2XXXA 1MY3A 5ESYA 2XXHA 4OWDA 3PPNA 5I56B 3I6VA 3ODBA 4JWYA 3KFMA 3KBZA 1N3XA 1P99A 1Y9UA 2WX9A 1URSA 1D9QA 1S50A 4ZS9A 1OQHA 3CG1A 4IGTA 1II5A 4C1UA 4MAGA 4Q8RA 4OVJA 3E13X 4TLMB 2HXRA 3T9UA 5TP9A 4OESA 2DP8A 3TEPA 3FGSA 4EF1A 2B3BA 1FBDA 1ELJA 2HAVA 1SPIA 4RPNA 1I6QA 3G3IA 2F8DA 2A5TB 4NN3A 1LAXA 2A5SA 4MNCA 3Q25A 3RPWA 3A3CA 1MQGA 2FYIA 2QVVA 4PQJA 2NVUB 1B4HA 3VVDA 2UVHA 2P3VA 2Z8FA 4IY6A 3T9XB 3C4MA 1FBEA 1FTLA 2HHMA 3TCFA 4XIGQ 1MQHA 4OYVA 4NF8B 1UTBB 3T93B 5FHOA 4N8GA 3SEUA 1QVSA 1MXXA 3MVWA 2PCRA 2XA5A 2O68A 4GL8A 1B7UA 1NI9A 5I3SA 3BIGA 5LDZA 1H3DA 1TFAA 2RC9A 2B4LA 2OWTA 4LZ7A 3BKIB 2OLBA 4ZEDA 4DI3D 2QFLA 1B46A 1A8EA 4NF4B 2PT1A 4ZEBA 4KYSA 4P47A 3EQ1A 1OVTA 4MX6A 4P0IA 3BFTA 2P2AA 2H99A 1IXCA 1NNPA 2WYKA 4OVQA 4XFEA 3LSLA 4OANA 1J1NA 3E78A 1NKXA 4F1UA 1US5A 1R9QA 3TKDA 1B5IA
chains in the Genus database with same CATH topology
3R7XA 3TTNA 1XOCA 1FTOA 2THIA 2VOZA 4G68C 4R2BA 3TCGA 1POTA 2P0SA 4IO3A 2F7CA 5L8DA 5AA2D 1QUJA 1Y20A 4H65A 5H8NB 3IJOB 2ONRA 3QIMA 2O7IA 2D5WA 2DWIA 4L17A 4MH5A 5CRYA 3Q28A 4AB6A 3IJXB 3G7WA 4ECFA 3PPRA 3EHUA 2PMSA 4R72A 2QMXA 3OSQA 1SBPA 1A8FA 1PB8A 4PFTA 1VE4A 2QJEA 3MZ1A 4RK2A 1N76A 2V3TA 1B5JA 1ATGA 1ZBMA 3E4RA 3C9HA 4H5FA 3K1PA 4I9DA 1JW4A 2F6PA 1SW5A 3QYTA 1Z7NE 3Q27A 3K2DA 3O6GA 4IO4A 3MQ9A 4M4GA 1PDAA 2ZXTA 1YCJA 4YKJA 4NF5B 1GV8A 4F3BA 1B51A 3WAFA 3P7IA 3PD8A 5AA2A 1FQDA 3S9MC 2UVIA 4IO7A 1SQYA 3IO6A 2ZYNA 4ZEKA 3VLVA 3K4UA 3OMBA 3ILUB 3T66A 3N6UA 3B7DA 2Q9TA 2V3QA 4F2OA 4JSDA 1MQIA 3TTKA 4OMBA 2H25A 4EDPA 4IY5A 4JWOA 4F18A 2E0SA 3G3KA 2V93A 4YB6A 3FVKA 3L6GA 3PV0E 4ONYA 4WKMA 4NMYA 2O7UA 1SVXB 2DYXA 4O3BA 2Q89A 4LUBA 1Y1ZA 5JEIA 4QFNA 3ONMA 3PPPA 4JBZA 1VR5A 5KDTA 4GIZA 1MH3A 4FIMA 1AL3A 2YJPA 4U4SA 1SW1A 3UIFA 3OD7A 4LQ5A 4R9GA 4QSEA 3A3UA 4DCXA 1LLSA 4YKKA 3IX1A 1ZIUA 2YLNA 4G8HA 3F11A 4G4PA 3H6TA 3MVXA 4F3GA 1LB9A 3M8UA 2GHAA 3OO9A 4LZ8A 4BDRA 4AQ4A 1VFEA 5TPAB 3D4CA 3KGCA 2E1SA 3PGFA 1HSLA 4OTEA 1OLCA 2B65A 4X48A 3SERA 4JXIA 4MF3A 3FJGA 1UQWA 3MP1A 4HCWA 1FQAA 2PT2A 2Z8DA 1H45A 4YMAA 4WEPA 4KD5A 3SKPA 2QS4A 3C32A 1MXWA 3UK4A 3K6XA 4PE5B 2QPQA 3KOSA 1O7TA 1ZMGA 2F7BA 1B1HA 3U93A 3MZ9A 3ZS6A 2F34A 2Y7IA 3KJ7A 3KZGA 2XXYA 3T96B 2LAOA 3GXAA 1MY0A 5FTIA 3KN8A 1B3LA 2I3VA 4G2ZA 4PFUA 3K6WA 4F2QA 1LSTA 3H6VA 3RLFE 4POXA 4KFQA 4Q0CA 4IO2A 5DEXA 1MRPA 4U1OA 2Q2AA 2Q88A 5L9OA 4OFLA 4NE4A 3FASA 2H98A 1B5HA 2I48A 4ESXA 1TFDA 3C35A 2HEUA 1SYHA 5CI5A 2IA4A 1N84A 1GR2A 4RNSA 4X1DA 3TQLA 4KPTA 3SEYA 3IOWA 1MM6A 4THIA 4XXUA 2REGA 1B9JA 3H3GA 2HAUA 2G29A 4LA9A 3VVFA 4LATA 5I2KB 5JTYA 4QSCA 4TOZA 3DM0A 1POY1 3U94A 1M5BA 5I57B 1UTHA 5CMBA 1NH7A 2DWAA 2OJTA 3CFLA 1B3HA 3PUYE 2ZYKA 1I6BA 3EHSA 3TODA 2DE4A 2O6AA 3OO7A 1US4A 2QS1A 2ZMBA 3OSRA 2RCAA 3CRBA 1B0HA 1S9TA 1Y4CA 4NTLA 4ZECA 2D3IA 1L5TA 2XXTA 3LBSA 2NXOA 5I59B 4FAJA 3M3KA 3T22A 4BDMA 1DPEA 3KSXA 3H7MA 4YB7A 2GH9A 4PP0A 3TQWA 3QSLA 2G93A 2NWJA 3I5OA 3V8XB 3TAJA 1B7HA 4ZE9A 3HPIA 3Q26A 1DTZA 4RY1A 4LP2B 3K1NA 1MQJA 3IK6B 1GGGA 4H8IA 5H8HB 3SEWA 2ZYMA 4G68A 1ZTYA 5DTBA 2ONKE 2AL5A 2O84X 3G3HA 4DZ1A 2XX9A 2XXRA 1JW1A 3MP6A 3IORA 3VFJA 1XHYA 4R6HA 3TUSA 1O63A 5I84A 1XVXA 4EQ7A 4DXBA 5TP9B 4GD5A 1B32A 3K6UA 4GVOA 1XS5A 5A5XA 1PBQA 2IEEA 3FZVA 1LGBC 2OZZA 2ZNUA 3UGWA 5HM4B 3A09A 2X7QA 3BBRA 3B6QA 4EF2A 1MPBA 1A55A 1BTJA 5IKBA 1R1NA 4TLLB 3EPEA 2I6EA 3HCQA 1B4ZA 3FXQA 1P1NA 1ZKBA 2PYYA 3TFLA 1QW0A 4BLAA 1LAFE 3TTLA 4Q30B 3V89B 2PVUA 5I58B 3FUZA 2Q2CA 2HZLA 4ZZAA 1BKAA 5AA4A 2F6GA 3MW0A 1SI0A 4GXSB 4GXAA 4ELPA 2HFBA 4YKPA 4DCYA 2BJJX 3VLWA 3G3JA 1TWYA 2I4CA 4P0GA 1IEJA 4H8JA 1MPDA 1LFHA 3U72A 3DP8A 4HTGA 4H0WA 1ANFA 2AIXA 2I49A 3IOVA 3O9PA 3VXCA 3FJMA 2DXRA 2UVJA 3CSBA 2GHBA 5J1DA 1OMPA 2AYSA 1NMUA 3LC8A 2REJA 1N3WA 5B7DA 3T9VA 1VSOA 3FIRA 1MS7A 3IO4A 4WXJA 4K3FA 1OQGA 2P1SA 1LBCA 4GF8A 3TTRA 2F78A 2I4BA 3JYRA 4LONB 3CR9A 3PMXA 1YTVA 3CVGA 3C31A 4RA1A 4LVQA 1T0KA 1NNFA 4OHNA 4R74A 5DYHA 4DDDA 2F97A 3BFUA 5ICQA 1WDNA 1JVYA 1CB6A 3HSTA 3CG3A 2OBGA 5F1QA 2RINA 1Z7ME 2DWJA 1RKMA 1JETA 3MAMA 4H5GA 3ECRA 4YMBA 5K2XA 1EZPA 4U23A 2Z23A 3FJ7A 4UACA 4GQOA 3UP9A 2XXIA 3CIJA 3VDFA 1D9VA 5CBSA 4PETA 4YKIA 1FTMA 3RUMA 5AA2B 5EHMA 2RC7A 4DE8A 3O6HA 1RYOA 3EHTA 1FCKA 1GVCA 4FEDA 2VHAA 2DWHA 1FTJA 4QFLA 2Y7PA 3PUXE 3MP8A 2DS9A 3FVGA 3M3FA 4G77A 3FV2A 3O6IA 3UORA 2Y7KA 3DP6A 1DPPA 1CE2A 3S2VA 1N0TA 3SESA 1AIVA 5KCJA 3LSFB 3FVNA 1B6HA 5ITPA 1IXHA 1SW4A 3V83A 5KDTB 4O3AA 2QMWA 2Y7WA 1JVXA 2DOJA 1Y3NA 2B3FA 1MXVA 1SDXA 4GWOA 3W9VA 4JSOA 3CFXA 3RT8A 4OFOA 2RCBA 4RXLA 4EUOA 3OENA 1RYXA 2RC8A 4R6KA 3O29A 3RT6B 1H43A 3W9WA 3S9LC 2R71A 3TYHA 4N13A 1YAEA 2ESNA 4KCCA 3S9NC 5TPAA 3JZJA 4M1VA 2DE2A 4MLVA 5ICTA 2RKMA 3R26A 4QFOA 3OO6A 4I8CA 3PPOA 3USDA 4C0RA 1A99A 2F5XA 4MFIA 1USYH 1Q35A 3UA8A 1A7LA 3MVZA 2QS3A 1F9BA 4RYAA 4F39A 2HZKA 5H8QA 2AL4A 1PEBA 3KN7A 1JW5A 1QUIA 3PMWA 3DELB 1IIWA 4NF6B 4IO6A 5L9SA 1WODA 1KWHA 4ESWA 1Y4TA 3LSWA 2DVZA 3OXNA 1FQEA 4R9FA 4FORA 3FATA 4ND9A 1PB7A 4E0XA 1N7XA 3PUVE 1MDP1 4OENA 4ZZEA 3TCHA 5DEXB 1M5DA 1A54A 5I2NA 4F3PA 4BDOA 3K6VA 4ZDMA 1MY2A 4KCDA 4OQOA 2O1MA 5EHSA 1IQ7A 4JWXA 3LUYA 3IOUA 3I3VA 3PD9A 1MH4A 4LQ2A 3VV5A 3L6HA 1Y1MA 4EQ9A 4YAHX 3T9HB 5ISUA 5AA1A 3E9XA 1QUKA 3DLNA 1PB9A 3RTFB 3FVOA 4U2RA 5FTHA 3QUJA 2F36A 4H67A 5DVIA 4LZ5A 3MUQA 5JK4A 2UYFA 1B3GA 3QXMA 4G8NA 4G8MA 1LBBA 1NH8A 5JTYB 5H8FB 4F31B 5DVFA 3OELA 3U8QA 2ZNTA 2V84A 3S9EA 3U1OA 3MVYA 1UTHB 4XTCQ 4GFRA 3K01A 1A40A 2OK2A 3ZKLA 2I3WA 4FE8A 1JEUA 2H5YA 2HQ0A 3C33A 3UN6A 3V5AA 4ISUA 3N26A 2DSFA 5LOMA 2FA7A 2NOOA 1URGA 3N5LA 4PFWA 3QAXA 3GBAA 3TTMA 3IB0A 5CC2A 1JNFA 1PBPA 3PPQA 2H9BA 3R6UA 1Q1KA 4GLIA 1IITA 4KHZE 2GFEA 3OOAA 4YZZA 4TQUQ 4YU0A 1MXZA 1NFTA 3H03A 5EYFA 3FV1A 2ZNSA 5I56A 4BDNA 2R9JA 1B2HA 3THIA 4EXKA 4QRZA 3OEKA 2UXAA 1M5CA 1LAHE 2KLFA 4O3CA 4C1TA 3HO7A 1P1OA 4G68B 1FQFA 1AH5A 2VD3A 5DT6A 4KYEA 4KYDA 3C34A 1HSEA 1S7YA 3VXBA 2Z22A 1D4NA 4OERA 4ELQA 3H06B 2PX1A 4E0WA 2XX8A 2A5TA 1OLAA 1B40A 3N94A 1XC1A 4YB5A 4BDLA 1MDQA 1Y3QA 5A5XB 3DP4A 2XXVA 3VVEA 3KEIA 4RK9A 4F1YA 1ZLQA 2V3UA 1JEVA 1NL5A 1SYIA 3M3LA 3H4ZA 2X7PA 5BUUA 3HHGA 4NF8A 1QULA 1XT8A 1UTBA 2FNCA 3SDFA 3K1MA 1M5FA 3SEXA 3O66A 5H8SA 4XKRA 3IB1A 5BWJA 1ZU0A 5AE4A 5I58A 1FW0A 3TELA 3KJTA 1R9LA 4Z0IA 1I69A 1NNTA 2W7YA 3MJNA 3MBPA 4FECA 4I1DA 4BDQA 1AMFA 5AA4B 4JB7A 4NF4A 1JQFA 3ILTB 4GL0A 4QHQA 3K02A 1FTKA 3KSJA 4GOTA 1OVBA 1FQCA 2DXYA 3WAEA 4WEDA 2GRVA 2XXWA 4KR5A 3TPAA 4F1VA 2OWSA 3MPKA 3MPLA 3TDJA 5KZTA 4R73A 1MY4A 3CFZA 3FD3A 1LCTA 2R6GE 2Y84A 5CMKA 1D3KA 1B52A 4AB5A 1VFDA 5H8NA 2O69A 1URDA 1O64A 4U22A 2Z8EA 4OFJA 3AXFA 3SEVA 4P11A 2X26A 1N7WA 3MC2A 3EN3A 3MZBA 2Q8JA 3G3GA 3HHFA 4DXCA 1LFGA 1Y3PA 2I58A 2H4IA 4OETA 2CZLA 1B3EA 1DTGA 5CMCA 5ITOA 2OCUA 3GLBA 3GZGA 4U1ZA 3HV1A 1BLFA 3OEMA 1HSJA 4F3SA 1B58A 1MXYA 4HS7A 4NF5A 1QKAA 1B1XA 4XKPA 3ZSFA 4DLDA 2XD3A 1OIBA 1M5EA 3PMVA 2QS2A 1I6AA 2XHDA 5K2YA 3N6TA 4POWA 1B05A 3SETA 2RF1A 4ELRA 4X9TA 4F22A 4H1XA 4QFPA 1LCFA 3H6UA 4XKQA 1MPCA 3OO8A 4U21A 3O2AA 3U92A 1LB8A 4OZ9A 3IB2A 4KI0E 3K00A 5ELVA 1GTKA 1B3FA 3CSGA 1WVJA 1EU8A 1MG1A 2O1LA 3VE1B 3QUFA 3RQTA 1SW2A 5FHNA 3FXUA 5M2VA 2D21A 5KCJB 3LSXA 4EQBA 1EH3A 2UYEA 1IXIA 4GRKA 4ZEIA 3D4GA 1N04A 2I0BA 2XXPA 2UVGA 5B70A 1EZOA 2PBWA 1YPNA 4PFYA 3ZKKA 1MM7A 4R2FA 2CMOA 4UA8A 4FATA 4I62A 3LR1A 3KOTA 4HW8A 1BIYA 1NNKA 2DE3A 4F29A 3TZAA 3G3FA 1MQDA 4NWCA 1QJMA 3E3KA 3RY3A 2DVCA 3CI8A 4NEDA 4N07A 2F35A 1IZ1A 4MBPA 1SI1A 4MLQA 2ANJA 4F19A 2XXUA 1H44A 3MWBA 3PUZE 3JV9A 2Y7RA 5FHMA 3IAZA 2VGQA 5TU0A 1PC3A 3K0VA 3IL1B 4U4XA 3W15C 1B7ZA 1SD3A 4H6DA 1TXFA 4X1BA 4RJZA 2XX7A 1FQBA 4IO5A 4JDFA 3H6WA 5H8QB 3B6WA 4DIGA 4QSDA 1P1QA 4NF6A 3KG2A 5AA3A 5L9MA 2ABHA 1LFIA 2ZYOA 1IUDA 3S4UA 3RNNA 3IR1A 3Q29A 3PUWE 5HBCA 5CMMA 1TT1A 4ZEFA 5DVJA 2QL3A 2O51A 1MXUA 4OXVA 3O28A 1R6ZA 5HPQA 1QKBA 1USYE 1DOTA 5I2NB 2WKYA 1P1WA 3IOTA 4KQPA 1DMBA 2VP1A 1P1UA 4R75A 1IXGA 4Q5TA 5CBRA 5CM6A 2VD2A 1LAGE 4R6YA 4HCYA 5IAIA 3RN8A 2XXQA 2QSXA 3TMGA 4ELOA 2F7AA 3QK6A 5I2KA 3KBRA 2HXWA 1AOVA 4XKNA 5I57A 1UIVA 3VLUA 4YICA 5H8FA 4DXUA 4FEBA 3GBBA 3C36A 3RGYA 2ALUA 4QFKA 3O97A 2M8CA 1UIUA 4NWDA 2ONSA 3B6TA 4IB2A 4EXLA 1DSNA 2NUVA 4RPOA 3FXRA 4ZE8A 1H76A 1BP5A 2DQVA 5I59A 4Z7EA 3PU5A 3HN0A 4QF9A 5F7VA 2XD2A 4N6PA 2YPNA 2HCAA 4IGRA 1B0LA 2V25A 4FJPA 3RTWB 2I0CA 2QRYA 1D9YA 3KN3A 4OEVA 5H8HA 3EF7A 1ZJLA 4OEUA 1EZ9A 1MY1A 1XVYA 2XXXA 1MY3A 2XXHA 4OWDA 3PPNA 5I56B 3I6VA 3ODBA 4JWYA 3KFMA 1N3XA 1P99A 1Y9UA 1URSA 1S50A 4ZS9A 1OQHA 3CG1A 4IGTA 1II5A 4C1UA 4Q8RA 4OVJA 3E13X 4TLMB 3T9UA 5TP9A 4OESA 2DP8A 3TEPA 3FGSA 4EF1A 2B3BA 1ELJA 2HAVA 4RPNA 1I6QA 3G3IA 2F8DA 2A5TB 1LAXA 2A5SA 3Q25A 3RPWA 3A3CA 1MQGA 2FYIA 4PQJA 2NVUB 1B4HA 3VVDA 2UVHA 2Z8FA 4IY6A 3T9XB 3C4MA 1FTLA 3TCFA 4XIGQ 1MQHA 4OYVA 4NF8B 1UTBB 3T93B 5FHOA 3SEUA 1QVSA 1MXXA 3MVWA 2O68A 4GL8A 1B7UA 1H3DA 1TFAA 2RC9A 2OWTA 4LZ7A 3BKIB 2OLBA 4ZEDA 1B46A 1A8EA 4NF4B 2PT1A 4ZEBA 4KYSA 3EQ1A 1OVTA 4P0IA 3BFTA 2P2AA 2H99A 1IXCA 1NNPA 3LSLA 1J1NA 1NKXA 4F1UA 1US5A 1R9QA 3TKDA 1B5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7X A;  3TTN A;  1XOC A;  1FTO A;  2THI A;  2VOZ A;  4G68 C;  4R2B A;  3TCG A;  1POT A;  2P0S A;  4IO3 A;  2F7C A;  5L8D A;  5AA2 D;  1QUJ A;  1Y20 A;  4H65 A;  5H8N B;  3IJO B;  2ONR A;  3QIM A;  2O7I A;  2D5W A;  2DWI A;  4L17 A;  4MH5 A;  5CRY A;  3Q28 A;  4AB6 A;  3IJX B;  3G7W A;  4ECF A;  3PPR A;  3EHU A;  2PMS A;  4R72 A;  2QMX A;  3OSQ A;  1SBP A;  1A8F A;  1PB8 A;  4PFT A;  1VE4 A;  2QJE A;  3MZ1 A;  4RK2 A;  1N76 A;  2V3T A;  1B5J A;  1ATG A;  1ZBM A;  3E4R A;  3C9H A;  4H5F A;  3K1P A;  4I9D A;  1JW4 A;  2F6P A;  1SW5 A;  3QYT A;  1Z7N E;  3Q27 A;  3K2D A;  3O6G A;  4IO4 A;  3MQ9 A;  4M4G A;  1PDA A;  2ZXT A;  1YCJ A;  4YKJ A;  4NF5 B;  1GV8 A;  4F3B A;  1B51 A;  3WAF A;  3P7I A;  3PD8 A;  5AA2 A;  1FQD A;  3S9M C;  2UVI A;  4IO7 A;  1SQY A;  3IO6 A;  2ZYN A;  4ZEK A;  3VLV A;  3K4U A;  3OMB A;  3ILU B;  3T66 A;  3N6U A;  3B7D A;  2Q9T A;  2V3Q A;  4F2O A;  4JSD A;  1MQI A;  3TTK A;  4OMB A;  2H25 A;  4EDP A;  4IY5 A;  4JWO A;  4F18 A;  2E0S A;  3G3K A;  2V93 A;  4YB6 A;  3FVK A;  3L6G A;  3PV0 E;  4ONY A;  4WKM A;  4NMY A;  2O7U A;  1SVX B;  2DYX A;  4O3B A;  2Q89 A;  4LUB A;  1Y1Z A;  5JEI A;  4QFN A;  3ONM A;  3PPP A;  4JBZ A;  1VR5 A;  5KDT A;  4GIZ A;  1MH3 A;  4FIM A;  1AL3 A;  2YJP A;  4U4S A;  1SW1 A;  3UIF A;  3OD7 A;  4LQ5 A;  4R9G A;  4QSE A;  3A3U A;  4DCX A;  1LLS A;  4YKK A;  3IX1 A;  1ZIU A;  2YLN A;  4G8H A;  3F11 A;  4G4P A;  3H6T A;  3MVX A;  4F3G A;  1LB9 A;  3M8U A;  2GHA A;  3OO9 A;  4LZ8 A;  4BDR A;  4AQ4 A;  1VFE A;  5TPA B;  3D4C A;  3KGC A;  2E1S A;  3PGF A;  1HSL A;  4OTE A;  1OLC A;  2B65 A;  4X48 A;  3SER A;  4JXI A;  4MF3 A;  3FJG A;  1UQW A;  3MP1 A;  4HCW A;  1FQA A;  2PT2 A;  2Z8D A;  1H45 A;  4YMA A;  4WEP A;  4KD5 A;  3SKP A;  2QS4 A;  3C32 A;  1MXW A;  3UK4 A;  3K6X A;  4PE5 B;  2QPQ A;  3KOS A;  1O7T A;  1ZMG A;  2F7B A;  1B1H A;  3U93 A;  3MZ9 A;  3ZS6 A;  2F34 A;  2Y7I A;  3KJ7 A;  3KZG A;  2XXY A;  3T96 B;  2LAO A;  3GXA A;  1MY0 A;  5FTI A;  3KN8 A;  1B3L A;  2I3V A;  4G2Z A;  4PFU A;  3K6W A;  4F2Q A;  1LST A;  3H6V A;  3RLF E;  4POX A;  4KFQ A;  4Q0C A;  4IO2 A;  5DEX A;  1MRP A;  4U1O A;  2Q2A A;  2Q88 A;  5L9O A;  4OFL A;  4NE4 A;  3FAS A;  2H98 A;  1B5H A;  2I48 A;  4ESX A;  1TFD A;  3C35 A;  2HEU A;  1SYH A;  5CI5 A;  2IA4 A;  1N84 A;  1GR2 A;  4RNS A;  4X1D A;  3TQL A;  4KPT A;  3SEY A;  3IOW A;  1MM6 A;  4THI A;  4XXU A;  2REG A;  1B9J A;  3H3G A;  2HAU A;  2G29 A;  4LA9 A;  3VVF A;  4LAT A;  5I2K B;  5JTY A;  4QSC A;  4TOZ A;  3DM0 A;  1POY 1;  3U94 A;  1M5B A;  5I57 B;  1UTH A;  5CMB A;  1NH7 A;  2DWA A;  2OJT A;  3CFL A;  1B3H A;  3PUY E;  2ZYK A;  1I6B A;  3EHS A;  3TOD A;  2DE4 A;  2O6A A;  3OO7 A;  1US4 A;  2QS1 A;  2ZMB A;  3OSR A;  2RCA A;  3CRB A;  1B0H A;  1S9T A;  1Y4C A;  4NTL A;  4ZEC A;  2D3I A;  1L5T A;  2XXT A;  3LBS A;  2NXO A;  5I59 B;  4FAJ A;  3M3K A;  3T22 A;  4BDM A;  1DPE A;  3KSX A;  3H7M A;  4YB7 A;  2GH9 A;  4PP0 A;  3TQW A;  3QSL A;  2G93 A;  2NWJ A;  3I5O A;  3V8X B;  3TAJ A;  1B7H A;  4ZE9 A;  3HPI A;  3Q26 A;  1DTZ A;  4RY1 A;  4LP2 B;  3K1N A;  1MQJ A;  3IK6 B;  1GGG A;  4H8I A;  5H8H B;  3SEW A;  2ZYM A;  4G68 A;  1ZTY A;  5DTB A;  2ONK E;  2AL5 A;  2O84 X;  3G3H A;  4DZ1 A;  2XX9 A;  2XXR A;  1JW1 A;  3MP6 A;  3IOR A;  3VFJ A;  1XHY A;  4R6H A;  3TUS A;  1O63 A;  5I84 A;  1XVX A;  4EQ7 A;  4DXB A;  5TP9 B;  4GD5 A;  1B32 A;  3K6U A;  4GVO A;  1XS5 A;  5A5X A;  1PBQ A;  2IEE A;  3FZV A;  1LGB C;  2OZZ A;  2ZNU A;  3UGW A;  5HM4 B;  3A09 A;  2X7Q A;  3BBR A;  3B6Q A;  4EF2 A;  1MPB A;  1A55 A;  1BTJ A;  5IKB A;  1R1N A;  4TLL B;  3EPE A;  2I6E A;  3HCQ A;  1B4Z A;  3FXQ A;  1P1N A;  1ZKB A;  2PYY A;  3TFL A;  1QW0 A;  4BLA A;  1LAF E;  3TTL A;  4Q30 B;  3V89 B;  2PVU A;  5I58 B;  3FUZ A;  2Q2C A;  2HZL A;  4ZZA A;  1BKA A;  5AA4 A;  2F6G A;  3MW0 A;  1SI0 A;  4GXS B;  4GXA A;  4ELP A;  2HFB A;  4YKP A;  4DCY A;  2BJJ X;  3VLW A;  3G3J A;  1TWY A;  2I4C A;  4P0G A;  1IEJ A;  4H8J A;  1MPD A;  1LFH A;  3U72 A;  3DP8 A;  4HTG A;  4H0W A;  1ANF A;  2AIX A;  2I49 A;  3IOV A;  3O9P A;  3VXC A;  3FJM A;  2DXR A;  2UVJ A;  3CSB A;  2GHB A;  5J1D A;  1OMP A;  2AYS A;  1NMU A;  3LC8 A;  2REJ A;  1N3W A;  5B7D A;  3T9V A;  1VSO A;  3FIR A;  1MS7 A;  3IO4 A;  4WXJ A;  4K3F A;  1OQG A;  2P1S A;  1LBC A;  4GF8 A;  3TTR A;  2F78 A;  2I4B A;  3JYR A;  4LON B;  3CR9 A;  3PMX A;  1YTV A;  3CVG A;  3C31 A;  4RA1 A;  4LVQ A;  1T0K A;  1NNF A;  4OHN A;  4R74 A;  5DYH A;  4DDD A;  2F97 A;  3BFU A;  5ICQ A;  1WDN A;  1JVY A;  1CB6 A;  3HST A;  3CG3 A;  2OBG A;  5F1Q A;  2RIN A;  1Z7M E;  2DWJ A;  1RKM A;  1JET A;  3MAM A;  4H5G A;  3ECR A;  4YMB A;  5K2X A;  1EZP A;  4U23 A;  2Z23 A;  3FJ7 A;  4UAC A;  4GQO A;  3UP9 A;  2XXI A;  3CIJ A;  3VDF A;  1D9V A;  5CBS A;  4PET A;  4YKI A;  1FTM A;  3RUM A;  5AA2 B;  5EHM A;  2RC7 A;  4DE8 A;  3O6H A;  1RYO A;  3EHT A;  1FCK A;  1GVC A;  4FED A;  2VHA A;  2DWH A;  1FTJ A;  4QFL A;  2Y7P A;  3PUX E;  3MP8 A;  2DS9 A;  3FVG A;  3M3F A;  4G77 A;  3FV2 A;  3O6I A;  3UOR A;  2Y7K A;  3DP6 A;  1DPP A;  1CE2 A;  3S2V A;  1N0T A;  3SES A;  1AIV A;  5KCJ A;  3LSF B;  3FVN A;  1B6H A;  5ITP A;  1IXH A;  1SW4 A;  3V83 A;  5KDT B;  4O3A A;  2QMW A;  2Y7W A;  1JVX A;  2DOJ A;  1Y3N A;  2B3F A;  1MXV A;  1SDX A;  4GWO A;  3W9V A;  4JSO A;  3CFX A;  3RT8 A;  4OFO A;  2RCB A;  4RXL A;  4EUO A;  3OEN A;  1RYX A;  2RC8 A;  4R6K A;  3O29 A;  3RT6 B;  1H43 A;  3W9W A;  3S9L C;  2R71 A;  3TYH A;  4N13 A;  1YAE A;  2ESN A;  4KCC A;  3S9N C;  5TPA A;  3JZJ A;  4M1V A;  2DE2 A;  4MLV A;  5ICT A;  2RKM A;  3R26 A;  4QFO A;  3OO6 A;  4I8C A;  3PPO A;  3USD A;  4C0R A;  1A99 A;  2F5X A;  4MFI A;  1USY H;  1Q35 A;  3UA8 A;  1A7L A;  3MVZ A;  2QS3 A;  1F9B A;  4RYA A;  4F39 A;  2HZK A;  5H8Q A;  2AL4 A;  1PEB A;  3KN7 A;  1JW5 A;  1QUI A;  3PMW A;  3DEL B;  1IIW A;  4NF6 B;  4IO6 A;  5L9S A;  1WOD A;  1KWH A;  4ESW A;  1Y4T A;  3LSW A;  2DVZ A;  3OXN A;  1FQE A;  4R9F A;  4FOR A;  3FAT A;  4ND9 A;  1PB7 A;  4E0X A;  1N7X A;  3PUV E;  1MDP 1;  4OEN A;  4ZZE A;  3TCH A;  5DEX B;  1M5D A;  1A54 A;  5I2N A;  4F3P A;  4BDO A;  3K6V A;  4ZDM A;  1MY2 A;  4KCD A;  4OQO A;  2O1M A;  5EHS A;  1IQ7 A;  4JWX A;  3LUY A;  3IOU A;  3I3V A;  3PD9 A;  1MH4 A;  4LQ2 A;  3VV5 A;  3L6H A;  1Y1M A;  4EQ9 A;  4YAH X;  3T9H B;  5ISU A;  5AA1 A;  3E9X A;  1QUK A;  3DLN A;  1PB9 A;  3RTF B;  3FVO A;  4U2R A;  5FTH A;  3QUJ A;  2F36 A;  4H67 A;  5DVI A;  4LZ5 A;  3MUQ A;  5JK4 A;  2UYF A;  1B3G A;  3QXM A;  4G8N A;  4G8M A;  1LBB A;  1NH8 A;  5JTY B;  5H8F B;  4F31 B;  5DVF A;  3OEL A;  3U8Q A;  2ZNT A;  2V84 A;  3S9E A;  3U1O A;  3MVY A;  1UTH B;  4XTC Q;  4GFR A;  3K01 A;  1A40 A;  2OK2 A;  3ZKL A;  2I3W A;  4FE8 A;  1JEU A;  2H5Y A;  2HQ0 A;  3C33 A;  3UN6 A;  3V5A A;  4ISU A;  3N26 A;  2DSF A;  5LOM A;  2FA7 A;  2NOO A;  1URG A;  3N5L A;  4PFW A;  3QAX A;  3GBA A;  3TTM A;  3IB0 A;  5CC2 A;  1JNF A;  1PBP A;  3PPQ A;  2H9B A;  3R6U A;  1Q1K A;  4GLI A;  1IIT A;  4KHZ E;  2GFE A;  3OOA A;  4YZZ A;  4TQU Q;  4YU0 A;  1MXZ A;  1NFT A;  3H03 A;  5EYF A;  3FV1 A;  2ZNS A;  5I56 A;  4BDN A;  2R9J A;  1B2H A;  3THI A;  4EXK A;  4QRZ A;  3OEK A;  2UXA A;  1M5C A;  1LAH E;  2KLF A;  4O3C A;  4C1T A;  3HO7 A;  1P1O A;  4G68 B;  1FQF A;  1AH5 A;  2VD3 A;  5DT6 A;  4KYE A;  4KYD A;  3C34 A;  1HSE A;  1S7Y A;  3VXB A;  2Z22 A;  1D4N A;  4OER A;  4ELQ A;  3H06 B;  2PX1 A;  4E0W A;  2XX8 A;  2A5T A;  1OLA A;  1B40 A;  3N94 A;  1XC1 A;  4YB5 A;  4BDL A;  1MDQ A;  1Y3Q A;  5A5X B;  3DP4 A;  2XXV A;  3VVE A;  3KEI A;  4RK9 A;  4F1Y A;  1ZLQ A;  2V3U A;  1JEV A;  1NL5 A;  1SYI A;  3M3L A;  3H4Z A;  2X7P A;  5BUU A;  3HHG A;  4NF8 A;  1QUL A;  1XT8 A;  1UTB A;  2FNC A;  3SDF A;  3K1M A;  1M5F A;  3SEX A;  3O66 A;  5H8S A;  4XKR A;  3IB1 A;  5BWJ A;  1ZU0 A;  5AE4 A;  5I58 A;  1FW0 A;  3TEL A;  3KJT A;  1R9L A;  4Z0I A;  1I69 A;  1NNT A;  2W7Y A;  3MJN A;  3MBP A;  4FEC A;  4I1D A;  4BDQ A;  1AMF A;  5AA4 B;  4JB7 A;  4NF4 A;  1JQF A;  3ILT B;  4GL0 A;  4QHQ A;  3K02 A;  1FTK A;  3KSJ A;  4GOT A;  1OVB A;  1FQC A;  2DXY A;  3WAE A;  4WED A;  2GRV A;  2XXW A;  4KR5 A;  3TPA A;  4F1V A;  2OWS A;  3MPK A;  3MPL A;  3TDJ A;  5KZT A;  4R73 A;  1MY4 A;  3CFZ A;  3FD3 A;  1LCT A;  2R6G E;  2Y84 A;  5CMK A;  1D3K A;  1B52 A;  4AB5 A;  1VFD A;  5H8N A;  2O69 A;  1URD A;  1O64 A;  4U22 A;  2Z8E A;  4OFJ A;  3AXF A;  3SEV A;  4P11 A;  2X26 A;  1N7W A;  3MC2 A;  3EN3 A;  3MZB A;  2Q8J A;  3G3G A;  3HHF A;  4DXC A;  1LFG A;  1Y3P A;  2I58 A;  2H4I A;  4OET A;  2CZL A;  1B3E A;  1DTG A;  5CMC A;  5ITO A;  2OCU A;  3GLB A;  3GZG A;  4U1Z A;  3HV1 A;  1BLF A;  3OEM A;  1HSJ A;  4F3S A;  1B58 A;  1MXY A;  4HS7 A;  4NF5 A;  1QKA A;  1B1X A;  4XKP A;  3ZSF A;  4DLD A;  2XD3 A;  1OIB A;  1M5E A;  3PMV A;  2QS2 A;  1I6A A;  2XHD A;  5K2Y A;  3N6T A;  4POW A;  1B05 A;  3SET A;  2RF1 A;  4ELR A;  4X9T A;  4F22 A;  4H1X A;  4QFP A;  1LCF A;  3H6U A;  4XKQ A;  1MPC A;  3OO8 A;  4U21 A;  3O2A A;  3U92 A;  1LB8 A;  4OZ9 A;  3IB2 A;  4KI0 E;  3K00 A;  5ELV A;  1GTK A;  1B3F A;  3CSG A;  1WVJ A;  1EU8 A;  1MG1 A;  2O1L A;  3VE1 B;  3QUF A;  3RQT A;  1SW2 A;  5FHN A;  3FXU A;  5M2V A;  2D21 A;  5KCJ B;  3LSX A;  4EQB A;  1EH3 A;  2UYE A;  1IXI A;  4GRK A;  4ZEI A;  3D4G A;  1N04 A;  2I0B A;  2XXP A;  2UVG A;  5B70 A;  1EZO A;  2PBW A;  1YPN A;  4PFY A;  3ZKK A;  1MM7 A;  4R2F A;  2CMO A;  4UA8 A;  4FAT A;  4I62 A;  3LR1 A;  3KOT A;  4HW8 A;  1BIY A;  1NNK A;  2DE3 A;  4F29 A;  3TZA A;  3G3F A;  1MQD A;  4NWC A;  1QJM A;  3E3K A;  3RY3 A;  2DVC A;  3CI8 A;  4NED A;  4N07 A;  2F35 A;  1IZ1 A;  4MBP A;  1SI1 A;  4MLQ A;  2ANJ A;  4F19 A;  2XXU A;  1H44 A;  3MWB A;  3PUZ E;  3JV9 A;  2Y7R A;  5FHM A;  3IAZ A;  2VGQ A;  5TU0 A;  1PC3 A;  3K0V A;  3IL1 B;  4U4X A;  3W15 C;  1B7Z A;  1SD3 A;  4H6D A;  1TXF A;  4X1B A;  4RJZ A;  2XX7 A;  1FQB A;  4IO5 A;  4JDF A;  3H6W A;  5H8Q B;  3B6W A;  4DIG A;  4QSD A;  1P1Q A;  4NF6 A;  3KG2 A;  5AA3 A;  5L9M A;  2ABH A;  1LFI A;  2ZYO A;  1IUD A;  3S4U A;  3RNN A;  3IR1 A;  3Q29 A;  3PUW E;  5HBC A;  5CMM A;  1TT1 A;  4ZEF A;  5DVJ A;  2QL3 A;  2O51 A;  1MXU A;  4OXV A;  3O28 A;  1R6Z A;  5HPQ A;  1QKB A;  1USY E;  1DOT A;  5I2N B;  2WKY A;  1P1W A;  3IOT A;  4KQP A;  1DMB A;  2VP1 A;  1P1U A;  4R75 A;  1IXG A;  4Q5T A;  5CBR A;  5CM6 A;  2VD2 A;  1LAG E;  4R6Y A;  4HCY A;  5IAI A;  3RN8 A;  2XXQ A;  2QSX A;  3TMG A;  4ELO A;  2F7A A;  3QK6 A;  5I2K A;  3KBR A;  2HXW A;  1AOV A;  4XKN A;  5I57 A;  1UIV A;  3VLU A;  4YIC A;  5H8F A;  4DXU A;  4FEB A;  3GBB A;  3C36 A;  3RGY A;  2ALU A;  4QFK A;  3O97 A;  2M8C A;  1UIU A;  4NWD A;  2ONS A;  3B6T A;  4IB2 A;  4EXL A;  1DSN A;  2NUV A;  4RPO A;  3FXR A;  4ZE8 A;  1H76 A;  1BP5 A;  2DQV A;  5I59 A;  4Z7E A;  3PU5 A;  3HN0 A;  4QF9 A;  5F7V A;  2XD2 A;  4N6P A;  2YPN A;  2HCA A;  4IGR A;  1B0L A;  2V25 A;  4FJP A;  3RTW B;  2I0C A;  2QRY A;  1D9Y A;  3KN3 A;  4OEV A;  5H8H A;  3EF7 A;  1ZJL A;  4OEU A;  1EZ9 A;  1MY1 A;  1XVY A;  2XXX A;  1MY3 A;  2XXH A;  4OWD A;  3PPN A;  5I56 B;  3I6V A;  3ODB A;  4JWY A;  3KFM A;  1N3X A;  1P99 A;  1Y9U A;  1URS A;  1S50 A;  4ZS9 A;  1OQH A;  3CG1 A;  4IGT A;  1II5 A;  4C1U A;  4Q8R A;  4OVJ A;  3E13 X;  4TLM B;  3T9U A;  5TP9 A;  4OES A;  2DP8 A;  3TEP A;  3FGS A;  4EF1 A;  2B3B A;  1ELJ A;  2HAV A;  4RPN A;  1I6Q A;  3G3I A;  2F8D A;  2A5T B;  1LAX A;  2A5S A;  3Q25 A;  3RPW A;  3A3C A;  1MQG A;  2FYI A;  4PQJ A;  2NVU B;  1B4H A;  3VVD A;  2UVH A;  2Z8F A;  4IY6 A;  3T9X B;  3C4M A;  1FTL A;  3TCF A;  4XIG Q;  1MQH A;  4OYV A;  4NF8 B;  1UTB B;  3T93 B;  5FHO A;  3SEU A;  1QVS A;  1MXX A;  3MVW A;  2O68 A;  4GL8 A;  1B7U A;  1H3D A;  1TFA A;  2RC9 A;  2OWT A;  4LZ7 A;  3BKI B;  2OLB A;  4ZED A;  1B46 A;  1A8E A;  4NF4 B;  2PT1 A;  4ZEB A;  4KYS A;  3EQ1 A;  1OVT A;  4P0I A;  3BFT A;  2P2A A;  2H99 A;  1IXC A;  1NNP A;  3LSL A;  1J1N A;  1NKX A;  4F1U A;  1US5 A;  1R9Q A;  3TKD A;  1B5I A; 
#chains in the Genus database with same CATH topology
 3R7X A;  3TTN A;  1XOC A;  1FTO A;  2THI A;  2VOZ A;  4G61 A;  4G68 C;  4R2B A;  3TCG A;  1POT A;  2P0S A;  4IO3 A;  2F7C A;  5L8D A;  5AA2 D;  1QUJ A;  1FTA A;  1Y20 A;  4H65 A;  5H8N B;  2PFY A;  3IJO B;  2ONR A;  3QIM A;  2O7I A;  2D5W A;  2XWK A;  2DWI A;  4L17 A;  4MH5 A;  5ET5 A;  5CRY A;  3Q28 A;  1FRP A;  4AB6 A;  3IJX B;  3G7W A;  4ECF A;  3PPR A;  3EHU A;  2PMS A;  4R72 A;  3E79 A;  4GWU A;  2QMX A;  3OSQ A;  1SBP A;  1A8F A;  1PB8 A;  4PFT A;  1VE4 A;  2QJE A;  3MZ1 A;  4RK2 A;  1N76 A;  2V3T A;  1B5J A;  1ATG A;  1ZBM A;  3E4R A;  1FBF A;  3C9H A;  4H5F A;  5EQ8 A;  3K1P A;  2WYP A;  4I9D A;  2VPN A;  1JW4 A;  2F6P A;  1SW5 A;  3QYT A;  1Z7N E;  3Q27 A;  4PCD A;  3K2D A;  3O6G A;  4IO4 A;  3MQ9 A;  4M4G A;  1PDA A;  2ZXT A;  1YCJ A;  4YKJ A;  4NF5 B;  1GV8 A;  4F3B A;  1B51 A;  3WAF A;  3P7I A;  3PD8 A;  5AA2 A;  1FQD A;  3S9M C;  2UVI A;  4IO7 A;  1SQY A;  3IO6 A;  2ZYN A;  4ZEK A;  3VLV A;  3K4U A;  3OMB A;  3ILU B;  3T66 A;  3N6U A;  3B7D A;  2Q9T A;  2V3Q A;  4F2O A;  4JSD A;  1MQI A;  4PAF A;  4OMB A;  3TTK A;  2H25 A;  4EDP A;  4IY5 A;  4JWO A;  4F18 A;  5A5L A;  2E0S A;  1FBG A;  3G3K A;  2V93 A;  4YB6 A;  3FVK A;  4PFI A;  3L6G A;  3PV0 E;  4ONY A;  4WKM A;  4NMY A;  3QMF A;  2O7U A;  1SVX B;  2DYX A;  4O3B A;  2Q89 A;  4LUB A;  4NHB A;  2CZI A;  1AWB A;  1Y1Z A;  5JEI A;  4QFN A;  3ONM A;  3PPP A;  4JBZ A;  1VR5 A;  5KDT A;  1G0I A;  4GIZ A;  1MH3 A;  4FIM A;  2L5V A;  1AL3 A;  2YJP A;  4GX6 A;  4U4S A;  1SW1 A;  3UIF A;  4OA4 A;  3OD7 A;  4LQ5 A;  4R9G A;  4QSE A;  3A3U A;  4N91 A;  4DCX A;  1LLS A;  4YKK A;  3IX1 A;  1ZIU A;  2YLN A;  4G8H A;  3F11 A;  4G4P A;  3H6T A;  3MVX A;  4F3G A;  1LB9 A;  3M8U A;  2GHA A;  3MST A;  3OO9 A;  4LZ8 A;  5IZ1 A;  4BDR A;  4AQ4 A;  1VFE A;  5TPA B;  3D4C A;  4NGU A;  1VDW A;  3KGC A;  1FPB A;  2E1S A;  3PGF A;  1HSL A;  3RPL B;  4OTE A;  1OLC A;  2B65 A;  4X48 A;  3SER A;  4JXI A;  4MF3 A;  3FJG A;  4KXP A;  1UQW A;  3MP1 A;  4HCW A;  1FQA A;  2PT2 A;  2Z8D A;  1H45 A;  4GWZ A;  1EYJ A;  4WEP A;  4YMA A;  4KD5 A;  1NUW A;  3SKP A;  2QS4 A;  2Y5K A;  1FPJ A;  3C32 A;  1MXW A;  3UK4 A;  3K6X A;  4PE5 B;  2QPQ A;  1LEV A;  3KOS A;  1O7T A;  1ZMG A;  2F7B A;  1B1H A;  3U93 A;  3MZ9 A;  3ZS6 A;  2F34 A;  2Y7I A;  3KJ7 A;  3KZG A;  3NOH A;  4PDD A;  2XXY A;  3T96 B;  4XF5 A;  2LAO A;  3GXA A;  1MY0 A;  5FTI A;  3KN8 A;  1B3L A;  2I3V A;  4G2Z A;  4PFU A;  3K6W A;  4F2Q A;  1LST A;  3H6V A;  3RLF E;  4POX A;  4KFQ A;  4Q0C A;  4IO2 A;  5DEX A;  1MRP A;  4U1O A;  5EQ9 A;  2Q2A A;  2Q88 A;  4AS5 A;  5L9O A;  4OFL A;  4NE4 A;  3FAS A;  2H98 A;  4NF0 A;  1B5H A;  1LBY A;  2I48 A;  4ESX A;  1TFD A;  3C35 A;  2HEU A;  1SYH A;  5CI5 A;  2IA4 A;  1N84 A;  1GR2 A;  4N17 A;  4RNS A;  5EYH A;  4X1D A;  3TQL A;  4KPT A;  3KC1 A;  4UAB A;  3SEY A;  3IOW A;  1MM6 A;  4THI A;  1IME A;  2FIE A;  4XXU A;  2REG A;  1B9J A;  2KQZ A;  3H3G A;  2HAU A;  2G29 A;  4LA9 A;  3VVF A;  3SZP A;  4LAT A;  5I2K B;  5JTY A;  4QSC A;  4TOZ A;  3DM0 A;  1POY 1;  3U94 A;  1M5B A;  5I57 B;  1UTH A;  5CMB A;  1NH7 A;  2DWA A;  4PFB A;  5ET6 A;  2OJT A;  3CFL A;  1B3H A;  1INP A;  3PUY E;  2ZYK A;  1I6B A;  3EHS A;  2HPG A;  3TOD A;  2DE4 A;  2O6A A;  3OO7 A;  1US4 A;  2QS1 A;  1K9Y A;  2ZMB A;  3OSR A;  2RCA A;  3CRB A;  1B0H A;  1S9T A;  1Y4C A;  4NTL A;  4ZEC A;  2D3I A;  3ROJ A;  1L5T A;  2XXT A;  1NV1 A;  3LBS A;  2NXO A;  5I59 B;  4FAJ A;  3M3K A;  3T22 A;  4BDM A;  1DPE A;  3KSX A;  3H7M A;  4YB7 A;  2GH9 A;  4PP0 A;  3TQW A;  3QSL A;  2G93 A;  2NWJ A;  3I5O A;  3V8X B;  3TAJ A;  4O8M A;  1B7H A;  4ZE9 A;  3HPI A;  4QXD A;  3Q26 A;  5IZ3 A;  2F3D A;  1DTZ A;  4RY1 A;  4LP2 B;  3K1N A;  1MQJ A;  3IK6 B;  1GGG A;  4H8I A;  5H8H B;  3SEW A;  2ZYM A;  4G68 A;  1ZTY A;  5DTB A;  2ONK E;  2AL5 A;  2O84 X;  3G3H A;  5DW8 A;  4PC9 A;  1Q9D A;  2BJI A;  4DZ1 A;  1YZ0 A;  2XX9 A;  2XXR A;  1JW1 A;  3B50 A;  3MP6 A;  3IOR A;  3VFJ A;  1XHY A;  4R6H A;  3TUS A;  1O63 A;  5I84 A;  1XVX A;  4EQ7 A;  4DXB A;  5TP9 B;  4GD5 A;  1B32 A;  3K6U A;  4GVO A;  1XS5 A;  5A5X A;  1PBQ A;  2IEE A;  3FZV A;  4PDH A;  1LGB C;  2OZZ A;  1NV2 A;  2ZNU A;  3UGW A;  5HM4 B;  3A09 A;  2X7Q A;  3BBR A;  3B6Q A;  4EF2 A;  1MPB A;  1A55 A;  1EYI A;  1BTJ A;  4NQ8 A;  5IKB A;  1R1N A;  4TLL B;  3EPE A;  2I6E A;  3HCQ A;  1IMA A;  1B4Z A;  3FXQ A;  1P1N A;  1ZKB A;  2PYY A;  3TFL A;  5J16 A;  1QW0 A;  4BLA A;  1LAF E;  3TTL A;  4Q30 B;  3V89 B;  2PVU A;  5I58 B;  4PBH A;  3FUZ A;  4GBV A;  5EQ7 A;  2Q2C A;  2ZZV A;  2HZL A;  4ZZA A;  1BKA A;  4GX3 A;  5AA4 A;  2F6G A;  3MW0 A;  1SI0 A;  4GXS B;  4GXA A;  4ELP A;  4MHF A;  2HFB A;  4YKP A;  4DCY A;  2BJJ X;  3VLW A;  3G3J A;  1TWY A;  2I4C A;  2WBD A;  4P0G A;  1IEJ A;  2P3N A;  4GX4 A;  4H8J A;  4PF8 A;  4PFR A;  1MPD A;  1BK4 A;  1LFH A;  1JP4 A;  4XEQ A;  3U72 A;  3DP8 A;  4HTG A;  4H0W A;  5LTC A;  1ANF A;  2AIX A;  2I49 A;  3LV0 A;  3IOV A;  3O9P A;  3VXC A;  3FJM A;  2DXR A;  2UVJ A;  3CSB A;  4X8R A;  2GHB A;  5J1D A;  1OMP A;  2AYS A;  1NMU A;  3LC8 A;  2REJ A;  1N3W A;  5B7D A;  3T9V A;  1VSO A;  3FIR A;  1MS7 A;  3IO4 A;  4WXJ A;  4K3F A;  1OQG A;  2P1S A;  1LBC A;  4GF8 A;  3HFU A;  2JJK A;  3TTR A;  2F78 A;  2I4B A;  3JYR A;  4OVR A;  4LON B;  3CR9 A;  3PMX A;  1YTV A;  3CVG A;  3C31 A;  4RA1 A;  4LVQ A;  1T0K A;  1NNF A;  4OHN A;  4R74 A;  5DYH A;  4DDD A;  2F97 A;  3BFU A;  5ICQ A;  1WDN A;  1JVY A;  1CB6 A;  5EQA A;  3HST A;  3CG3 A;  2OBG A;  5F1Q A;  2RIN A;  4P1L A;  1Z7M E;  2DWJ A;  1LBZ A;  1RKM A;  1JET A;  3MAM A;  4H5G A;  3ECR A;  4YMB A;  5K2X A;  1EZP A;  4U23 A;  1LBW A;  4MNI A;  2Z23 A;  3EKI A;  3FJ7 A;  4UAC A;  4GQO A;  3UP9 A;  1FBP A;  2XXI A;  3CIJ A;  3VDF A;  1FPI A;  1D9V A;  4H45 A;  5CBS A;  4PET A;  4YKI A;  1FJ6 A;  4NG7 A;  4NAP A;  1FTM A;  3RUM A;  5AA2 B;  5EHM A;  2RC7 A;  4DE8 A;  3ISP A;  3O6H A;  1RYO A;  3EHT A;  1FCK A;  1GVC A;  4FED A;  2VHA A;  4GWX A;  2DWH A;  1FTJ A;  4QFL A;  2Y7P A;  3PUX E;  3MP8 A;  2DS9 A;  3FVG A;  3M3F A;  4G77 A;  3FV2 A;  3O6I A;  3UOR A;  2Y7K A;  3DP6 A;  1QGX A;  2B4M A;  1DPP A;  1CE2 A;  3S2V A;  1N0T A;  4HE2 A;  1KZ8 A;  3SES A;  1AIV A;  5KCJ A;  2CEY A;  3LSF B;  3FVN A;  1B6H A;  5ET7 A;  5ITP A;  1IXH A;  1SW4 A;  3V83 A;  5KDT B;  4O3A A;  2Y5L A;  2QMW A;  2Y7W A;  1JVX A;  2DOJ A;  1Y3N A;  2B3F A;  1MXV A;  1SDX A;  3T0J A;  4GWO A;  4I3Y A;  3W9V A;  4JSO A;  3CFX A;  3RT8 A;  4OFO A;  2RCB A;  4RXL A;  4EUO A;  3OEN A;  1RYX A;  2RC8 A;  4R6K A;  3O29 A;  3RT6 B;  1H43 A;  3W9W A;  2XXK A;  3S9L C;  2R71 A;  3TYH A;  4N13 A;  1YAE A;  2ESN A;  4KCC A;  3S9N C;  5TPA A;  2ZZW A;  3BIH A;  3JZJ A;  2VT5 A;  4M1V A;  2DE2 A;  4MLV A;  5ICT A;  2RKM A;  2FHY A;  3R26 A;  4PGP A;  4QFO A;  3OO6 A;  3A29 A;  4I8C A;  3PPO A;  3USD A;  4C0R A;  1A99 A;  2F5X A;  4MFI A;  4GWW A;  1USY H;  1Q35 A;  3UA8 A;  1A7L A;  3MVZ A;  4IR8 A;  2QS3 A;  1F9B A;  4RYA A;  4F39 A;  2HZK A;  5H8Q A;  2AL4 A;  1PEB A;  3KN7 A;  2KR0 A;  1JW5 A;  1QUI A;  3PMW A;  3DEL B;  1IIW A;  4NF6 B;  4IO6 A;  5L9S A;  1WOD A;  1KWH A;  4ESW A;  1Y4T A;  3LSW A;  2DVZ A;  3OXN A;  1FQE A;  4R9F A;  4FOR A;  3FAT A;  4ND9 A;  1PB7 A;  4E0X A;  1N7X A;  3CHG A;  3PUV E;  1MDP 1;  3U65 A;  4OEN A;  4ZZE A;  3TCH A;  5DEX B;  1M5D A;  1A54 A;  5I2N A;  4F3P A;  1DBZ A;  4BDO A;  3K6V A;  4ZDM A;  1MY2 A;  4KCD A;  4OQO A;  2O1M A;  5EHS A;  1IQ7 A;  4JWX A;  1RDX A;  3LUY A;  4N15 A;  3IOU A;  3I3V A;  3PD9 A;  1MH4 A;  4MCO A;  4LQ2 A;  3VV5 A;  3L6H A;  1Y1M A;  4EQ9 A;  4YAH X;  2CZH A;  3T9H B;  5ISU A;  5AA1 A;  2V4C A;  3E9X A;  1QUK A;  3DLN A;  1PB9 A;  3RTF B;  2FBP A;  3FVO A;  4U2R A;  5FTH A;  3QUJ A;  2F36 A;  4H67 A;  5DVI A;  4LZ5 A;  3MUQ A;  3MYU A;  5JK4 A;  2UYF A;  1B3G A;  3QXM A;  4G8N A;  2DDK A;  4G8M A;  1LBB A;  1NH8 A;  5JTY B;  5H8F B;  4F31 B;  2ZZX A;  5DVF A;  3OEL A;  3U8Q A;  2ZNT A;  2V84 A;  3S9E A;  1K9Z A;  3U1O A;  3MVY A;  1UTH B;  4XTC Q;  4GFR A;  3K01 A;  1A40 A;  2OK2 A;  3ZKL A;  4I40 A;  2I3W A;  4FE8 A;  1JEU A;  2H5Y A;  2HQ0 A;  3C33 A;  3UN6 A;  3V5A A;  1FPG A;  4ISU A;  3N26 A;  2DSF A;  5LOM A;  2FA7 A;  2NOO A;  1URG A;  3N5L A;  4PFW A;  3QAX A;  1EYK A;  2PFZ A;  1IMC A;  1NUX A;  3GBA A;  3TTM A;  3IB0 A;  5CC2 A;  1JNF A;  1PBP A;  1YYZ A;  2H9B A;  3PPQ A;  3R6U A;  1Q1K A;  4GLI A;  1IIT A;  4KHZ E;  2GFE A;  4P1E A;  3OOA A;  4YZZ A;  4TQU Q;  4YU0 A;  1MXZ A;  1NFT A;  3H03 A;  5EYF A;  1FPE A;  3FV1 A;  5IZ3 B;  4OVS A;  2ZNS A;  5I56 A;  4BDN A;  2R9J A;  1B2H A;  3THI A;  4EXK A;  4QRZ A;  3OEK A;  2UXA A;  1M5C A;  1LAH E;  2KLF A;  2GQ1 A;  4O3C A;  4C1T A;  3HO7 A;  1P1O A;  4G68 B;  5IM2 A;  2FIX A;  1FQF A;  1AH5 A;  2VD3 A;  5DT6 A;  4KYE A;  4N4U A;  4KYD A;  2XWO A;  3C34 A;  4LN5 A;  1HSE A;  1S7Y A;  3VXB A;  2Z22 A;  1D4N A;  5T3J A;  4OER A;  4ELQ A;  3H06 B;  4PAI A;  1G0H A;  2PX1 A;  4E0W A;  2XX8 A;  2A5T A;  1OLA A;  1B40 A;  3N94 A;  1XC1 A;  4YB5 A;  4BDL A;  1MDQ A;  1Y3Q A;  5A5X B;  3DP4 A;  5IGA A;  2XXV A;  3VVE A;  4PAK A;  1CNQ A;  1LBX A;  3KEI A;  4RK9 A;  5ET8 A;  4F1Y A;  1ZLQ A;  4P56 A;  2V3U A;  1JEV A;  1NL5 A;  4P8B A;  1SYI A;  3M3L A;  3H4Z A;  2X7P A;  5BUU A;  3HHG A;  4NF8 A;  2XWV A;  1QUL A;  1XT8 A;  1UTB A;  2FNC A;  3SDF A;  2Q74 A;  3K1M A;  1M5F A;  3SEX A;  1KA1 A;  3KC0 A;  4OVT A;  3O66 A;  5H8S A;  4XKR A;  3IB1 A;  5BWJ A;  1ZU0 A;  5AE4 A;  5I58 A;  1FW0 A;  3TEL A;  3KJT A;  1R9L A;  4Z0I A;  1I69 A;  1NNT A;  2W7Y A;  3MJN A;  4JVC A;  3MBP A;  4HE1 A;  4FEC A;  4I1D A;  4BDQ A;  1AMF A;  5AA4 B;  4JB7 A;  4NF4 A;  4N6K A;  1JQF A;  3ILT B;  4GL0 A;  4QHQ A;  3K02 A;  1FTK A;  3KSJ A;  4GOT A;  1OVB A;  4GWS A;  1FQC A;  2DXY A;  1XI6 A;  3WAE A;  4WED A;  2GRV A;  4N6D A;  2XXW A;  4KR5 A;  3TPA A;  4F1V A;  2OWS A;  2OX3 A;  3MPK A;  3MPL A;  3TDJ A;  5KZT A;  4R73 A;  1MY4 A;  3CFZ A;  3FD3 A;  1LCT A;  2R6G E;  2Y84 A;  1FPF A;  5CMK A;  1D3K A;  1B52 A;  4AB5 A;  4X04 A;  4MIJ A;  1VFD A;  5H8N A;  2O69 A;  2Q8M A;  1URD A;  1O64 A;  4U22 A;  2Z8E A;  4OFJ A;  3AXF A;  3SEV A;  4P11 A;  2X26 A;  1N7W A;  2WBB A;  1RDY A;  4FBP A;  3MC2 A;  3EN3 A;  5IZZ A;  3MZB A;  5FBP A;  2Q8J A;  5EYG A;  3G3G A;  3HHF A;  4DXC A;  1LFG A;  1Y3P A;  2I58 A;  2H4I A;  4OET A;  2CZL A;  1B3E A;  1DTG A;  5CMC A;  4AS4 A;  5ITO A;  2OCU A;  3GLB A;  3GZG A;  4U1Z A;  3HV1 A;  1BLF A;  4MJO A;  3OEM A;  1HSJ A;  4F3S A;  1B58 A;  1MXY A;  4HS7 A;  1FJ9 A;  4NF5 A;  1QKA A;  1B1X A;  4XKP A;  3ZSF A;  4DLD A;  2XD3 A;  1OIB A;  1M5E A;  3PMV A;  2QS2 A;  5I7I A;  1I6A A;  2XHD A;  4PE3 A;  5K2Y A;  3GYY A;  3N6T A;  4POW A;  2OWZ A;  1B05 A;  3SET A;  2RF1 A;  4ELR A;  4X9T A;  4F22 A;  4H1X A;  4QFP A;  1LCF A;  3H6U A;  4XKQ A;  1MPC A;  3OO8 A;  3D1R A;  1DCU A;  4U21 A;  3O2A A;  3U92 A;  1LB8 A;  4OZ9 A;  3IB2 A;  4KI0 E;  1NV5 A;  3K00 A;  5ELV A;  1NV3 A;  1FBH A;  1GTK A;  1B3F A;  1NV7 A;  2R8T A;  3CSG A;  1WVJ A;  4O7I A;  1EU8 A;  1MG1 A;  1FBC A;  2O1L A;  3VE1 B;  2VPO A;  3QUF A;  3RQT A;  1SW2 A;  5FHN A;  3FXU A;  5M2V A;  2D21 A;  3T1B A;  3LSX A;  4EQB A;  5KCJ B;  1EH3 A;  2UYE A;  1IXI A;  4GRK A;  4HE0 A;  4ZEI A;  3D4G A;  1N04 A;  2I0B A;  2XXP A;  1IMB A;  2UVG A;  4O94 A;  3IFC A;  5B70 A;  1EZO A;  4GWY A;  2QVU A;  2PBW A;  4I3E A;  1YPN A;  4PFY A;  3ZKK A;  1MM7 A;  4R2F A;  2CMO A;  2F3B A;  4UA8 A;  4FAT A;  4I62 A;  4PF6 A;  2FVZ A;  3LR1 A;  3KOT A;  4HW8 A;  1BIY A;  1NNK A;  2DE3 A;  4N8Y A;  4F29 A;  1FPK A;  4DI4 B;  3TZA A;  3G3F A;  1MQD A;  4NWC A;  1QJM A;  1RDZ A;  3E3K A;  3RY3 A;  1YXI A;  2DVC A;  3RPL A;  3CI8 A;  4P3L A;  4NED A;  4N07 A;  4P9K A;  2F35 A;  2QVR A;  1IZ1 A;  4MBP A;  1SI1 A;  4MLQ A;  2ANJ A;  1NV6 A;  4F19 A;  2XXU A;  1H44 A;  3MWB A;  3PUZ E;  3JV9 A;  2Y7R A;  5FHM A;  3IAZ A;  1FPL A;  2VGQ A;  5TU0 A;  4PGN A;  1PC3 A;  3K0V A;  3IL1 B;  4U4X A;  3W15 C;  1B7Z A;  1SD3 A;  4H6D A;  1KA0 A;  1TXF A;  3FXB A;  4X1B A;  4RJZ A;  2XX7 A;  1FQB A;  4IO5 A;  4JDF A;  3H6W A;  5H8Q B;  3B6W A;  4DIG A;  4QSD A;  1P1Q A;  4NF6 A;  3KG2 A;  5AA3 A;  5L9M A;  2ABH A;  1LFI A;  2ZYO A;  1IUD A;  3S4U A;  3RNN A;  3IR1 A;  4O7M A;  3Q29 A;  4OVP A;  3PUW E;  5HBC A;  5CMM A;  1TT1 A;  4ZEF A;  5DVJ A;  3RYD A;  2QL3 A;  2O51 A;  1MXU A;  4OXV A;  3O28 A;  2CEX A;  1R6Z A;  5HPQ A;  1QKB A;  1USY E;  1DOT A;  5I2N B;  2WKY A;  4MEV A;  1P1W A;  3IOT A;  2CZK A;  4PTK A;  3IFA A;  4JVD A;  4KQP A;  1DMB A;  2VP1 A;  1P1U A;  4R75 A;  1IXG A;  4PBQ A;  4Q5T A;  5CBR A;  5CM6 A;  2VD2 A;  1LAG E;  4R6Y A;  4HCY A;  5IAI A;  3RN8 A;  2XXQ A;  2QSX A;  1FPD A;  3TMG A;  2MKZ A;  4ELO A;  2F7A A;  4MNP A;  1NV0 A;  3QK6 A;  5I2K A;  3KBR A;  2HXW A;  1AOV A;  1LBV A;  4XKN A;  5I57 A;  1UIV A;  3VLU A;  4YIC A;  5F24 A;  4GBW A;  5H8F A;  4DXU A;  4FEB A;  3GBB A;  4QBA A;  3PTY A;  3C36 A;  4MMP A;  3RGY A;  2ALU A;  4QFK A;  5I5P A;  2WEF A;  3O97 A;  2M8C A;  1UIU A;  4JVI A;  4NWD A;  2ONS A;  3B6T A;  1NUZ A;  4IB2 A;  4EXL A;  1DSN A;  1NUY A;  2NUV A;  4RPO A;  1DK4 A;  4NX1 A;  3LUZ A;  3FXR A;  4ZE8 A;  1H76 A;  1BP5 A;  2DQV A;  5I59 A;  4Z7E A;  3PU5 A;  3HN0 A;  1IMD A;  4QF9 A;  5F7V A;  2XD2 A;  2XWI A;  4N6P A;  4N81 A;  2YPN A;  2HCA A;  4IGR A;  1NV4 A;  1B0L A;  2V25 A;  3FBP A;  4FJP A;  3RTW B;  2I0C A;  2QRY A;  1D9Y A;  3KN3 A;  1IMF A;  4HXV A;  4OEV A;  5H8H A;  3EF7 A;  1ZJL A;  4H46 A;  4OEU A;  1EZ9 A;  1FSA A;  1MY1 A;  1XVY A;  3B8B A;  2XXX A;  1MY3 A;  5ESY A;  2XXH A;  4OWD A;  3PPN A;  5I56 B;  3I6V A;  3ODB A;  4JWY A;  3KFM A;  3KBZ A;  1N3X A;  1P99 A;  1Y9U A;  2WX9 A;  1URS A;  1D9Q A;  1S50 A;  4ZS9 A;  1OQH A;  3CG1 A;  4IGT A;  1II5 A;  4C1U A;  4MAG A;  4Q8R A;  4OVJ A;  3E13 X;  4TLM B;  2HXR A;  3T9U A;  5TP9 A;  4OES A;  2DP8 A;  3TEP A;  3FGS A;  4EF1 A;  2B3B A;  1FBD A;  1ELJ A;  2HAV A;  1SPI A;  4RPN A;  1I6Q A;  3G3I A;  2F8D A;  2A5T B;  4NN3 A;  1LAX A;  2A5S A;  4MNC A;  3Q25 A;  3RPW A;  3A3C A;  1MQG A;  2FYI A;  2QVV A;  4PQJ A;  2NVU B;  1B4H A;  3VVD A;  2UVH A;  2P3V A;  2Z8F A;  4IY6 A;  3T9X B;  3C4M A;  1FBE A;  1FTL A;  2HHM A;  3TCF A;  4XIG Q;  1MQH A;  4OYV A;  4NF8 B;  1UTB B;  3T93 B;  5FHO A;  4N8G A;  3SEU A;  1QVS A;  1MXX A;  3MVW A;  2PCR A;  2XA5 A;  2O68 A;  4GL8 A;  1B7U A;  1NI9 A;  5I3S A;  3BIG A;  5LDZ A;  1H3D A;  1TFA A;  2RC9 A;  2B4L A;  2OWT A;  4LZ7 A;  3BKI B;  2OLB A;  4ZED A;  4DI3 D;  2QFL A;  1B46 A;  1A8E A;  4NF4 B;  2PT1 A;  4ZEB A;  4KYS A;  4P47 A;  3EQ1 A;  1OVT A;  4MX6 A;  4P0I A;  3BFT A;  2P2A A;  2H99 A;  1IXC A;  1NNP A;  2WYK A;  4OVQ A;  4XFE A;  3LSL A;  4OAN A;  1J1N A;  3E78 A;  1NKX A;  4F1U A;  1US5 A;  1R9Q A;  3TKD A;  1B5I A; 
#chains in the Genus database with same CATH homology
 3R7X A;  3TTN A;  1XOC A;  1FTO A;  2THI A;  2VOZ A;  4G68 C;  4R2B A;  3TCG A;  1POT A;  2P0S A;  4IO3 A;  2F7C A;  5L8D A;  5AA2 D;  1QUJ A;  1Y20 A;  4H65 A;  5H8N B;  3IJO B;  2ONR A;  3QIM A;  2O7I A;  2D5W A;  2DWI A;  4L17 A;  4MH5 A;  5CRY A;  3Q28 A;  4AB6 A;  3IJX B;  3G7W A;  4ECF A;  3PPR A;  3EHU A;  2PMS A;  4R72 A;  2QMX A;  3OSQ A;  1SBP A;  1A8F A;  1PB8 A;  4PFT A;  1VE4 A;  2QJE A;  3MZ1 A;  4RK2 A;  1N76 A;  2V3T A;  1B5J A;  1ATG A;  1ZBM A;  3E4R A;  3C9H A;  4H5F A;  3K1P A;  4I9D A;  1JW4 A;  2F6P A;  1SW5 A;  3QYT A;  1Z7N E;  3Q27 A;  3K2D A;  3O6G A;  4IO4 A;  3MQ9 A;  4M4G A;  1PDA A;  2ZXT A;  1YCJ A;  4YKJ A;  4NF5 B;  1GV8 A;  4F3B A;  1B51 A;  3WAF A;  3P7I A;  3PD8 A;  5AA2 A;  1FQD A;  3S9M C;  2UVI A;  4IO7 A;  1SQY A;  3IO6 A;  2ZYN A;  4ZEK A;  3VLV A;  3K4U A;  3OMB A;  3ILU B;  3T66 A;  3N6U A;  3B7D A;  2Q9T A;  2V3Q A;  4F2O A;  4JSD A;  1MQI A;  3TTK A;  4OMB A;  2H25 A;  4EDP A;  4IY5 A;  4JWO A;  4F18 A;  2E0S A;  3G3K A;  2V93 A;  4YB6 A;  3FVK A;  3L6G A;  3PV0 E;  4ONY A;  4WKM A;  4NMY A;  2O7U A;  1SVX B;  2DYX A;  4O3B A;  2Q89 A;  4LUB A;  1Y1Z A;  5JEI A;  4QFN A;  3ONM A;  3PPP A;  4JBZ A;  1VR5 A;  5KDT A;  4GIZ A;  1MH3 A;  4FIM A;  1AL3 A;  2YJP A;  4U4S A;  1SW1 A;  3UIF A;  3OD7 A;  4LQ5 A;  4R9G A;  4QSE A;  3A3U A;  4DCX A;  1LLS A;  4YKK A;  3IX1 A;  1ZIU A;  2YLN A;  4G8H A;  3F11 A;  4G4P A;  3H6T A;  3MVX A;  4F3G A;  1LB9 A;  3M8U A;  2GHA A;  3OO9 A;  4LZ8 A;  4BDR A;  4AQ4 A;  1VFE A;  5TPA B;  3D4C A;  3KGC A;  2E1S A;  3PGF A;  1HSL A;  4OTE A;  1OLC A;  2B65 A;  4X48 A;  3SER A;  4JXI A;  4MF3 A;  3FJG A;  1UQW A;  3MP1 A;  4HCW A;  1FQA A;  2PT2 A;  2Z8D A;  1H45 A;  4YMA A;  4WEP A;  4KD5 A;  3SKP A;  2QS4 A;  3C32 A;  1MXW A;  3UK4 A;  3K6X A;  4PE5 B;  2QPQ A;  3KOS A;  1O7T A;  1ZMG A;  2F7B A;  1B1H A;  3U93 A;  3MZ9 A;  3ZS6 A;  2F34 A;  2Y7I A;  3KJ7 A;  3KZG A;  2XXY A;  3T96 B;  2LAO A;  3GXA A;  1MY0 A;  5FTI A;  3KN8 A;  1B3L A;  2I3V A;  4G2Z A;  4PFU A;  3K6W A;  4F2Q A;  1LST A;  3H6V A;  3RLF E;  4POX A;  4KFQ A;  4Q0C A;  4IO2 A;  5DEX A;  1MRP A;  4U1O A;  2Q2A A;  2Q88 A;  5L9O A;  4OFL A;  4NE4 A;  3FAS A;  2H98 A;  1B5H A;  2I48 A;  4ESX A;  1TFD A;  3C35 A;  2HEU A;  1SYH A;  5CI5 A;  2IA4 A;  1N84 A;  1GR2 A;  4RNS A;  4X1D A;  3TQL A;  4KPT A;  3SEY A;  3IOW A;  1MM6 A;  4THI A;  4XXU A;  2REG A;  1B9J A;  3H3G A;  2HAU A;  2G29 A;  4LA9 A;  3VVF A;  4LAT A;  5I2K B;  5JTY A;  4QSC A;  4TOZ A;  3DM0 A;  1POY 1;  3U94 A;  1M5B A;  5I57 B;  1UTH A;  5CMB A;  1NH7 A;  2DWA A;  2OJT A;  3CFL A;  1B3H A;  3PUY E;  2ZYK A;  1I6B A;  3EHS A;  3TOD A;  2DE4 A;  2O6A A;  3OO7 A;  1US4 A;  2QS1 A;  2ZMB A;  3OSR A;  2RCA A;  3CRB A;  1B0H A;  1S9T A;  1Y4C A;  4NTL A;  4ZEC A;  2D3I A;  1L5T A;  2XXT A;  3LBS A;  2NXO A;  5I59 B;  4FAJ A;  3M3K A;  3T22 A;  4BDM A;  1DPE A;  3KSX A;  3H7M A;  4YB7 A;  2GH9 A;  4PP0 A;  3TQW A;  3QSL A;  2G93 A;  2NWJ A;  3I5O A;  3V8X B;  3TAJ A;  1B7H A;  4ZE9 A;  3HPI A;  3Q26 A;  1DTZ A;  4RY1 A;  4LP2 B;  3K1N A;  1MQJ A;  3IK6 B;  1GGG A;  4H8I A;  5H8H B;  3SEW A;  2ZYM A;  4G68 A;  1ZTY A;  5DTB A;  2ONK E;  2AL5 A;  2O84 X;  3G3H A;  4DZ1 A;  2XX9 A;  2XXR A;  1JW1 A;  3MP6 A;  3IOR A;  3VFJ A;  1XHY A;  4R6H A;  3TUS A;  1O63 A;  5I84 A;  1XVX A;  4EQ7 A;  4DXB A;  5TP9 B;  4GD5 A;  1B32 A;  3K6U A;  4GVO A;  1XS5 A;  5A5X A;  1PBQ A;  2IEE A;  3FZV A;  1LGB C;  2OZZ A;  2ZNU A;  3UGW A;  5HM4 B;  3A09 A;  2X7Q A;  3BBR A;  3B6Q A;  4EF2 A;  1MPB A;  1A55 A;  1BTJ A;  5IKB A;  1R1N A;  4TLL B;  3EPE A;  2I6E A;  3HCQ A;  1B4Z A;  3FXQ A;  1P1N A;  1ZKB A;  2PYY A;  3TFL A;  1QW0 A;  4BLA A;  1LAF E;  3TTL A;  4Q30 B;  3V89 B;  2PVU A;  5I58 B;  3FUZ A;  2Q2C A;  2HZL A;  4ZZA A;  1BKA A;  5AA4 A;  2F6G A;  3MW0 A;  1SI0 A;  4GXS B;  4GXA A;  4ELP A;  2HFB A;  4YKP A;  4DCY A;  2BJJ X;  3VLW A;  3G3J A;  1TWY A;  2I4C A;  4P0G A;  1IEJ A;  4H8J A;  1MPD A;  1LFH A;  3U72 A;  3DP8 A;  4HTG A;  4H0W A;  1ANF A;  2AIX A;  2I49 A;  3IOV A;  3O9P A;  3VXC A;  3FJM A;  2DXR A;  2UVJ A;  3CSB A;  2GHB A;  5J1D A;  1OMP A;  2AYS A;  1NMU A;  3LC8 A;  2REJ A;  1N3W A;  5B7D A;  3T9V A;  1VSO A;  3FIR A;  1MS7 A;  3IO4 A;  4WXJ A;  4K3F A;  1OQG A;  2P1S A;  1LBC A;  4GF8 A;  3TTR A;  2F78 A;  2I4B A;  3JYR A;  4LON B;  3CR9 A;  3PMX A;  1YTV A;  3CVG A;  3C31 A;  4RA1 A;  4LVQ A;  1T0K A;  1NNF A;  4OHN A;  4R74 A;  5DYH A;  4DDD A;  2F97 A;  3BFU A;  5ICQ A;  1WDN A;  1JVY A;  1CB6 A;  3HST A;  3CG3 A;  2OBG A;  5F1Q A;  2RIN A;  1Z7M E;  2DWJ A;  1RKM A;  1JET A;  3MAM A;  4H5G A;  3ECR A;  4YMB A;  5K2X A;  1EZP A;  4U23 A;  2Z23 A;  3FJ7 A;  4UAC A;  4GQO A;  3UP9 A;  2XXI A;  3CIJ A;  3VDF A;  1D9V A;  5CBS A;  4PET A;  4YKI A;  1FTM A;  3RUM A;  5AA2 B;  5EHM A;  2RC7 A;  4DE8 A;  3O6H A;  1RYO A;  3EHT A;  1FCK A;  1GVC A;  4FED A;  2VHA A;  2DWH A;  1FTJ A;  4QFL A;  2Y7P A;  3PUX E;  3MP8 A;  2DS9 A;  3FVG A;  3M3F A;  4G77 A;  3FV2 A;  3O6I A;  3UOR A;  2Y7K A;  3DP6 A;  1DPP A;  1CE2 A;  3S2V A;  1N0T A;  3SES A;  1AIV A;  5KCJ A;  3LSF B;  3FVN A;  1B6H A;  5ITP A;  1IXH A;  1SW4 A;  3V83 A;  5KDT B;  4O3A A;  2QMW A;  2Y7W A;  1JVX A;  2DOJ A;  1Y3N A;  2B3F A;  1MXV A;  1SDX A;  4GWO A;  3W9V A;  4JSO A;  3CFX A;  3RT8 A;  4OFO A;  2RCB A;  4RXL A;  4EUO A;  3OEN A;  1RYX A;  2RC8 A;  4R6K A;  3O29 A;  3RT6 B;  1H43 A;  3W9W A;  3S9L C;  2R71 A;  3TYH A;  4N13 A;  1YAE A;  2ESN A;  4KCC A;  3S9N C;  5TPA A;  3JZJ A;  4M1V A;  2DE2 A;  4MLV A;  5ICT A;  2RKM A;  3R26 A;  4QFO A;  3OO6 A;  4I8C A;  3PPO A;  3USD A;  4C0R A;  1A99 A;  2F5X A;  4MFI A;  1USY H;  1Q35 A;  3UA8 A;  1A7L A;  3MVZ A;  2QS3 A;  1F9B A;  4RYA A;  4F39 A;  2HZK A;  5H8Q A;  2AL4 A;  1PEB A;  3KN7 A;  1JW5 A;  1QUI A;  3PMW A;  3DEL B;  1IIW A;  4NF6 B;  4IO6 A;  5L9S A;  1WOD A;  1KWH A;  4ESW A;  1Y4T A;  3LSW A;  2DVZ A;  3OXN A;  1FQE A;  4R9F A;  4FOR A;  3FAT A;  4ND9 A;  1PB7 A;  4E0X A;  1N7X A;  3PUV E;  1MDP 1;  4OEN A;  4ZZE A;  3TCH A;  5DEX B;  1M5D A;  1A54 A;  5I2N A;  4F3P A;  4BDO A;  3K6V A;  4ZDM A;  1MY2 A;  4KCD A;  4OQO A;  2O1M A;  5EHS A;  1IQ7 A;  4JWX A;  3LUY A;  3IOU A;  3I3V A;  3PD9 A;  1MH4 A;  4LQ2 A;  3VV5 A;  3L6H A;  1Y1M A;  4EQ9 A;  4YAH X;  3T9H B;  5ISU A;  5AA1 A;  3E9X A;  1QUK A;  3DLN A;  1PB9 A;  3RTF B;  3FVO A;  4U2R A;  5FTH A;  3QUJ A;  2F36 A;  4H67 A;  5DVI A;  4LZ5 A;  3MUQ A;  5JK4 A;  2UYF A;  1B3G A;  3QXM A;  4G8N A;  4G8M A;  1LBB A;  1NH8 A;  5JTY B;  5H8F B;  4F31 B;  5DVF A;  3OEL A;  3U8Q A;  2ZNT A;  2V84 A;  3S9E A;  3U1O A;  3MVY A;  1UTH B;  4XTC Q;  4GFR A;  3K01 A;  1A40 A;  2OK2 A;  3ZKL A;  2I3W A;  4FE8 A;  1JEU A;  2H5Y A;  2HQ0 A;  3C33 A;  3UN6 A;  3V5A A;  4ISU A;  3N26 A;  2DSF A;  5LOM A;  2FA7 A;  2NOO A;  1URG A;  3N5L A;  4PFW A;  3QAX A;  3GBA A;  3TTM A;  3IB0 A;  5CC2 A;  1JNF A;  1PBP A;  3PPQ A;  2H9B A;  3R6U A;  1Q1K A;  4GLI A;  1IIT A;  4KHZ E;  2GFE A;  3OOA A;  4YZZ A;  4TQU Q;  4YU0 A;  1MXZ A;  1NFT A;  3H03 A;  5EYF A;  3FV1 A;  2ZNS A;  5I56 A;  4BDN A;  2R9J A;  1B2H A;  3THI A;  4EXK A;  4QRZ A;  3OEK A;  2UXA A;  1M5C A;  1LAH E;  2KLF A;  4O3C A;  4C1T A;  3HO7 A;  1P1O A;  4G68 B;  1FQF A;  1AH5 A;  2VD3 A;  5DT6 A;  4KYE A;  4KYD A;  3C34 A;  1HSE A;  1S7Y A;  3VXB A;  2Z22 A;  1D4N A;  4OER A;  4ELQ A;  3H06 B;  2PX1 A;  4E0W A;  2XX8 A;  2A5T A;  1OLA A;  1B40 A;  3N94 A;  1XC1 A;  4YB5 A;  4BDL A;  1MDQ A;  1Y3Q A;  5A5X B;  3DP4 A;  2XXV A;  3VVE A;  3KEI A;  4RK9 A;  4F1Y A;  1ZLQ A;  2V3U A;  1JEV A;  1NL5 A;  1SYI A;  3M3L A;  3H4Z A;  2X7P A;  5BUU A;  3HHG A;  4NF8 A;  1QUL A;  1XT8 A;  1UTB A;  2FNC A;  3SDF A;  3K1M A;  1M5F A;  3SEX A;  3O66 A;  5H8S A;  4XKR A;  3IB1 A;  5BWJ A;  1ZU0 A;  5AE4 A;  5I58 A;  1FW0 A;  3TEL A;  3KJT A;  1R9L A;  4Z0I A;  1I69 A;  1NNT A;  2W7Y A;  3MJN A;  3MBP A;  4FEC A;  4I1D A;  4BDQ A;  1AMF A;  5AA4 B;  4JB7 A;  4NF4 A;  1JQF A;  3ILT B;  4GL0 A;  4QHQ A;  3K02 A;  1FTK A;  3KSJ A;  4GOT A;  1OVB A;  1FQC A;  2DXY A;  3WAE A;  4WED A;  2GRV A;  2XXW A;  4KR5 A;  3TPA A;  4F1V A;  2OWS A;  3MPK A;  3MPL A;  3TDJ A;  5KZT A;  4R73 A;  1MY4 A;  3CFZ A;  3FD3 A;  1LCT A;  2R6G E;  2Y84 A;  5CMK A;  1D3K A;  1B52 A;  4AB5 A;  1VFD A;  5H8N A;  2O69 A;  1URD A;  1O64 A;  4U22 A;  2Z8E A;  4OFJ A;  3AXF A;  3SEV A;  4P11 A;  2X26 A;  1N7W A;  3MC2 A;  3EN3 A;  3MZB A;  2Q8J A;  3G3G A;  3HHF A;  4DXC A;  1LFG A;  1Y3P A;  2I58 A;  2H4I A;  4OET A;  2CZL A;  1B3E A;  1DTG A;  5CMC A;  5ITO A;  2OCU A;  3GLB A;  3GZG A;  4U1Z A;  3HV1 A;  1BLF A;  3OEM A;  1HSJ A;  4F3S A;  1B58 A;  1MXY A;  4HS7 A;  4NF5 A;  1QKA A;  1B1X A;  4XKP A;  3ZSF A;  4DLD A;  2XD3 A;  1OIB A;  1M5E A;  3PMV A;  2QS2 A;  1I6A A;  2XHD A;  5K2Y A;  3N6T A;  4POW A;  1B05 A;  3SET A;  2RF1 A;  4ELR A;  4X9T A;  4F22 A;  4H1X A;  4QFP A;  1LCF A;  3H6U A;  4XKQ A;  1MPC A;  3OO8 A;  4U21 A;  3O2A A;  3U92 A;  1LB8 A;  4OZ9 A;  3IB2 A;  4KI0 E;  3K00 A;  5ELV A;  1GTK A;  1B3F A;  3CSG A;  1WVJ A;  1EU8 A;  1MG1 A;  2O1L A;  3VE1 B;  3QUF A;  3RQT A;  1SW2 A;  5FHN A;  3FXU A;  5M2V A;  2D21 A;  5KCJ B;  3LSX A;  4EQB A;  1EH3 A;  2UYE A;  1IXI A;  4GRK A;  4ZEI A;  3D4G A;  1N04 A;  2I0B A;  2XXP A;  2UVG A;  5B70 A;  1EZO A;  2PBW A;  1YPN A;  4PFY A;  3ZKK A;  1MM7 A;  4R2F A;  2CMO A;  4UA8 A;  4FAT A;  4I62 A;  3LR1 A;  3KOT A;  4HW8 A;  1BIY A;  1NNK A;  2DE3 A;  4F29 A;  3TZA A;  3G3F A;  1MQD A;  4NWC A;  1QJM A;  3E3K A;  3RY3 A;  2DVC A;  3CI8 A;  4NED A;  4N07 A;  2F35 A;  1IZ1 A;  4MBP A;  1SI1 A;  4MLQ A;  2ANJ A;  4F19 A;  2XXU A;  1H44 A;  3MWB A;  3PUZ E;  3JV9 A;  2Y7R A;  5FHM A;  3IAZ A;  2VGQ A;  5TU0 A;  1PC3 A;  3K0V A;  3IL1 B;  4U4X A;  3W15 C;  1B7Z A;  1SD3 A;  4H6D A;  1TXF A;  4X1B A;  4RJZ A;  2XX7 A;  1FQB A;  4IO5 A;  4JDF A;  3H6W A;  5H8Q B;  3B6W A;  4DIG A;  4QSD A;  1P1Q A;  4NF6 A;  3KG2 A;  5AA3 A;  5L9M A;  2ABH A;  1LFI A;  2ZYO A;  1IUD A;  3S4U A;  3RNN A;  3IR1 A;  3Q29 A;  3PUW E;  5HBC A;  5CMM A;  1TT1 A;  4ZEF A;  5DVJ A;  2QL3 A;  2O51 A;  1MXU A;  4OXV A;  3O28 A;  1R6Z A;  5HPQ A;  1QKB A;  1USY E;  1DOT A;  5I2N B;  2WKY A;  1P1W A;  3IOT A;  4KQP A;  1DMB A;  2VP1 A;  1P1U A;  4R75 A;  1IXG A;  4Q5T A;  5CBR A;  5CM6 A;  2VD2 A;  1LAG E;  4R6Y A;  4HCY A;  5IAI A;  3RN8 A;  2XXQ A;  2QSX A;  3TMG A;  4ELO A;  2F7A A;  3QK6 A;  5I2K A;  3KBR A;  2HXW A;  1AOV A;  4XKN A;  5I57 A;  1UIV A;  3VLU A;  4YIC A;  5H8F A;  4DXU A;  4FEB A;  3GBB A;  3C36 A;  3RGY A;  2ALU A;  4QFK A;  3O97 A;  2M8C A;  1UIU A;  4NWD A;  2ONS A;  3B6T A;  4IB2 A;  4EXL A;  1DSN A;  2NUV A;  4RPO A;  3FXR A;  4ZE8 A;  1H76 A;  1BP5 A;  2DQV A;  5I59 A;  4Z7E A;  3PU5 A;  3HN0 A;  4QF9 A;  5F7V A;  2XD2 A;  4N6P A;  2YPN A;  2HCA A;  4IGR A;  1B0L A;  2V25 A;  4FJP A;  3RTW B;  2I0C A;  2QRY A;  1D9Y A;  3KN3 A;  4OEV A;  5H8H A;  3EF7 A;  1ZJL A;  4OEU A;  1EZ9 A;  1MY1 A;  1XVY A;  2XXX A;  1MY3 A;  2XXH A;  4OWD A;  3PPN A;  5I56 B;  3I6V A;  3ODB A;  4JWY A;  3KFM A;  1N3X A;  1P99 A;  1Y9U A;  1URS A;  1S50 A;  4ZS9 A;  1OQH A;  3CG1 A;  4IGT A;  1II5 A;  4C1U A;  4Q8R A;  4OVJ A;  3E13 X;  4TLM B;  3T9U A;  5TP9 A;  4OES A;  2DP8 A;  3TEP A;  3FGS A;  4EF1 A;  2B3B A;  1ELJ A;  2HAV A;  4RPN A;  1I6Q A;  3G3I A;  2F8D A;  2A5T B;  1LAX A;  2A5S A;  3Q25 A;  3RPW A;  3A3C A;  1MQG A;  2FYI A;  4PQJ A;  2NVU B;  1B4H A;  3VVD A;  2UVH A;  2Z8F A;  4IY6 A;  3T9X B;  3C4M A;  1FTL A;  3TCF A;  4XIG Q;  1MQH A;  4OYV A;  4NF8 B;  1UTB B;  3T93 B;  5FHO A;  3SEU A;  1QVS A;  1MXX A;  3MVW A;  2O68 A;  4GL8 A;  1B7U A;  1H3D A;  1TFA A;  2RC9 A;  2OWT A;  4LZ7 A;  3BKI B;  2OLB A;  4ZED A;  1B46 A;  1A8E A;  4NF4 B;  2PT1 A;  4ZEB A;  4KYS A;  3EQ1 A;  1OVT A;  4P0I A;  3BFT A;  2P2A A;  2H99 A;  1IXC A;  1NNP A;  3LSL A;  1J1N A;  1NKX A;  4F1U A;  1US5 A;  1R9Q A;  3TKD A;  1B5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...