1IFBA

Refined apoprotein structure of rat intestinal fatty acid binding protein produced in escherichia coli
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
b'AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTESTINAL FATTY ACID BINDING PROTEIN
publication title Refined apoprotein structure of rat intestinal fatty acid binding protein produced in Escherichia coli.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Fatty acid-binding protein
total genus 35
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 1990-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1ifbA00
4EDEA 1ICMA 3FW5A 1G74A 2JN3A 1DF3A 1LKEA 1QY0A 3FA7A 1SXWA 1U17A 4DQ4A 2ALLX 4ZHFA 4QGWA 4D6BA 1X8OA 1SXYA 1UREA 5H9KA 2HZQA 2HNXA 1GT1A 2FTBA 1CBSA 1B0OA 1GKAA 1JBHA 2AH7X 1VYGA 1I06A 1DZMA 1EXSA 2O62A 1FDQA 1DZJA 2CBRA 2WQAE 2NNQA 2RQ0A 5F7GA 4OS8A 5EDBA 1D2UA 1B56A 3CR6A 2QO4A 3I17A 2POAA 5HZ9A 5LJHA 1EQDA 3AKNA 3CWKA 5EPQA 4A1YA 3FA8A 1GKAB 1YWBA 1BEBA 1DZKA 4TQ2A 1YIVA 3NP1A 3G7XA 2RCQA 1GT5A 3APWA 5D47A 2WEWA 2L68A 3U03A 3TGAA 3F8AA 1DC9A 4IMOA 1YWCA 2WWPA 1G85A 2A2UA 1QY1A 2AT5X 4NLJA 5F6BA 5B29A 3B2LA 2JU3A 3CBCA 2FR3A 2PY1A 2MO5A 1BSQA 4ZHGA 2AT8X 3BY0A 4XMHA 1DFVA 3I0AA 4ORYA 4Y0RA 3WBGA 2L67A 3BLGA 4Y0QA 3EM0A 4ORSA 5BVQA 3TF6A 4A8ZA 1GGLA 4NP1A 1NP1A 1OBQA 5BVSA 3FIQA 2AT6X 1I04A 4PSQA 2JOZA 2QO5A 2E4JA 1TW4A 3IA8A 1OPBA 1SY3A 3EBKA 1SA8A 3VG7A 3D97A 5F6ZA 1LFOA 2R74A 5HCCC 1X8NA 3APVA 3BDRA 2P8GA 3NX1A 5DG4A 1DZPA 2WEXA 3C77X 3STKA 3ZUOA 5IO5A 5D8JA 5L8OA 2AT0X 2A2GA 5D45A 5LJDA 1OPAA 3FR2A 1CBQA 1QWDA 3FEPA 3HWEA 4XMCA 1U0XA 1X8QA 1KT6A 4YBUA 1JYJA 2K23A 4LKTA 3EYCA 1T8VA 4AZQA 1MVGA 4YCEA 3STMX 3FR4A 1A18A 2Q39A 1HMTA 2N93A 4YFQA 2G78A 5IO7A 3P6DA 3QKGA 1BSOA 1DV9A 5HA0A 4QGVA 1E00A 3MVFA 1CRBA 1XCAA 2L9CA 4MVIA 1T68X 1T0VA 3CQRA 5HCEC 5LJKA 1MX7A 1LIEA 4QGXA 3T1DA 3PP6A 3FELA 4I9SA 2OZQA 4AYHA 4YFPA 3VG6A 3P6GA 3UEXA 3CBSA 5HBSA 2X45A 2NNEA 1YWDA 1PEEA 3AKMA 3VG2A 5IO6A 1E02A 1MX8A 2FR2A 1O1UA 3DSZA 1L6MA 2OVAA 1P6PA 3KZAA 3KFFA 2HYSA 1KZWA 1ADLA 4WFVA 3FW4A 2MM3A 3BX7A 2WQ9A 5KICA 1LIDA 3KFHA 1OBUA 1S44A 1EALA 2EU7X 3P6FA 1LIFA 3HK1A 5EZ2A 2WUTA 1B8EA 1VYFA 4IBAA 5L8NA 5LJCA 2OVDA 4BQUA 1BLRA 3NQ9A 3HWFA 5JR8A 4D6AA 4QZUA 1KQXA 2CM4A 2R73A 1GT4A 5FENA 1X8UA 3WJDA 1ICNA 2L5PA 4HFOA 3BX8A 4O9SA 4M7MA 2FT9A 3PPTA 3UEWA 1O1VA 5KHPA 1A57A 1EIOA 5C0NA 1KT3A 1KT7A 4MVKA 3U9PC 4ZHCA 1GX8A 2CBSA 2CM9A 1N0SA 1G5WA 1PMPA 4GE1A 3STNA 3O2YA 3BU1A 1NGLA 2A3FX 5HTDA 3JS1A 2OFMX 3CMPA 1B4MA 4OMWA 3PH5A 4I3BA 1HN2A 2G79A 2W2FA 1MDCA 4ES7A 4LZUA 1CJ5A 2AMMX 2LB6A 4TLJA 5EEDA 4A60A 4TKBA 4ODDA 4AZMA 4ZGUA 1IKJA 1HBQA 5CE4A 1S2PA 3KFIA 1A3YA 3L4RA 2QO6A 3WJCA 2XKLA 3FMZA 1EPAA 3P6CA 3NPOA 4IB8A 4AW8A 3FENA 3WJFA 1ZNLA 1ERBA 4RUUA 1VPRA 5LJBA 2DM5A 4IB9A 1JJJA 4IB7A 3C78X 3FR5A 1H91A 3NX2A 4I3CA 1TVQA 1RLBE 1G7NA 1BBPA 1X8PA 2AKQA 5FFHA 4ALBA 3F9DA 4YCHA 3FA6A 4BOEA 4RUNA 4TKJA 2A0AA 1O8VA 3JSQA 4QYPA 1ZNHA 2QOSC 4OS0A 3HWDA 1A2DA 1FELA 3P6HA 3EMMA 3CQNA 1HQPA 1TOWA 1IKEA 3OJYC 5F1EA 2ACOA 4NLIA 1PM1X 4ZFXA 2R56A 3GAQA 4K19A 4UU3A 4YFRA 2GC9A 4ZHDA 1QY2A 1OEKA 4ARHA 1OBPA 3D96A 5F58A 1JZUA 4IMNA 4MVLA 1KOIA 1SXUA 3WJGA 2LFOA 1AVGI 1CBIA 4XMDA 4AZOA 2FLJA 5HZ8A 4ZCBA 1BWYA 4DQ3A 4CK4A 1BM5A 1SY2A 2G7BA 2LBAA 4GETA 2LKKA 1LIBA 3FA9A 1KQWA 1KT5A 5LJGA 4GRJA 4AZNA 1KZXA 2KT4B 1IFCA 5HZ6A 4BVMA 1NP4A 4NYQA 1EUOA 1LNMA 1FEMA 2FWVA 3O22A 3D95A 4ALOA 2X46A 4N7DA 3KFGA 4YH0A 5HCDC 1I4UA 5FAZA 4IAWA 1ACDA 1JV4A 4YKOA 1QG5A 1GM6A 2W2BA 1SY0A 2GTFX 3B2JA 4YBPA 1EPBA 4LZVA 5B27A 4ZHHA 1U18A 3B2HA 4OMXA 4QZTA 1AELA 1YUPA 4YGZA 2OFRX 4A1HA 4GH7A 2RD7C 4ZJ0A 4XMEA 3UEUA 1EIIA 2RCTA 1LF7A 4N7CA 1BRPA 3O19A 5DPQA 1ZNKA 2K62A 3ZQ3A 1JYDA 3TGCA 3TZSA 1JJXA 1YP7A 3NADA 4TKHA 1X89A 1IIUA 1AQBA 1OEJA 4YDAA 3Q6LA 2JU7A 3S26A 2F73A 5L8IA 1QQSA 4EEJA 3B2KA 4Y0PA 3KQ0A 5LJEA 3TGBA 3FLLA 1XKIA 1ZNEA 3EBWA 4ORRA 1LPJA 1BRQA 4GNYA 1HBPA 2WSJA 1GT3A 4EFGA 2ACPX 4LKPA 2ASNX 2W2AA 5HA1A 2A13A 4WBKA 4WFUA 2JU8A 3NQ3A 4UU2A 3SAOA 2ANSA 4AZPA 2BLGA 3WJEA 1SY1A 1E5PA 3HWGA 4ZH9A 3APUA 1S7DA 3WXQA 3ZUIA 4QAEA 3WJBA 1QFTA 4HPDA 4YGGA 1ML7A 3K3LA 5EEEA 4EXZA 5HWZA 2IFBA 3BSZE 3MBTA 5D4AA 2FRSA 2NNDA 4Y0SA 2AT3X 2FS6A 2OVEA 2HLVA 1GX9A 3VG3A 4TJZA 4NNTA 5H9AA 3ELXA 2Q4NA 1R0UA 1Z24A 3B2IA 4YMYA 4HPCA 4HPBA 2Q2PA 3APXA 1ALBA 3BRNA 2NP1A 4YGHA 1ZNDA 4ORXA 5KIDA 1EW3A 1LICA 2HMBA 2LBVA 1CBRA 3DTQA 1GXAA 4XMFA 5HAEA 3WVMA 3ELZA 2QM9A 2AL0X 4IB6A 5K06A 1OEEA 2YG2A 1E06A 1RBPA 4I3DA 2HZRA 2KTDA 1KXOA 4ZH6A 4M6SA 1QFVA 4NYRA 1KT4A 5EDCA 3PEDA 3PH6A 2WR6A 1YP6A 3NR3A 4YDBA 4IAXA 1MUPA 2XSTA 2Q9SA 1D3SA 3RSWA 5H9LA 1HMSA 3U0DA 1FTPA 1IFBA 4ZR2A 5HTEA 1YWAA 3UEVA 3FEKA 4XMGA 1I05A 5BVTA 5LKEA 1TOUA 4GNWA 5AQ6A 1AB0A 1X71A 1UZ2X 4R0BA 2GJ5A 4AZRA 5H9NA 4HPAA 1FE3A 5LKFA 1QABE 3VG5A 1BJ7A 2MJIA 1BSYA 4KIIA 2RA6A 5D48A 1IW2A 3PECA 2FS7A 5HZ5A 5H8TA 2CZTA 4ORWA 2CZUA 4NNSA 1KGLA 3RZYA 1ZRYA 1FENA 5HZQA 1SXXA 3VG4A 1TXLA 1ZNGA 1PBOA 4OS3A 3IFBA 4TNNA 1HMRA 3BS2A 3C76X 2Q2MA 4GKCA 4I9RA 4ORUA 4YKMA 4QYNA 3BU9A 1ERXA 3P6EA
chains in the Genus database with same CATH superfamily
4EDEA 1ICMA 3FW5A 1G74A 1VWHB 2JN3A 1DF3A 1LKEA 2BT9A 1QY0A 2ZAGA 4JHQA 3FA7A 2F01A 3FIDA 1SXWA 1U17A 2OYBO 2ALLX 3AEHA 4OEMA 4DQ4A 4QGWA 4ZHFA 1LCVA 1VWOB 4D6BA 1X8OA 1SXYA 4Y59A 4O3WA 1LUQA 1EI5A 4FBRA 1UREA 5H9KA 2RTOB 4FQBB 2HZQA 2HNXA 3VE1A 4BX6A 1GT1A 1SLGB 1CBSA 1B0OA 1GKAA 2BS6A 2FTBA 2RTKA 3D9WA 3F6ZB 4MVEA 1SWAA 1SWNA 2AH7X 2FKJA 1VYGA 2RTGB 4IABA 1I06A 4GDZA 2JGSA 2MF6A 2Z4HA 3PK2A 1DZMA 1EXSA 2PI3O 3RY1A 2BSZA 1RXJA 2O62A 1FDQA 1DZJA 2CBRA 5AJCA 4CPIA 4GJSA 2WQAE 4FBVA 2NNQA 2RQ0A 2RTPB 5F7GA 4B55A 4OS8A 2FKGA 1D2UA 1B56A 2OL8O 3CR6A 5EDBA 3T2XA 2QO4A 3I17A 2POAA 5HZ9A 5LJHA 1EQDA 3AKNA 3CWKA 3T6LA 4BX6B 4O49A 5EPQA 4A1YA 4KH8A 3FA8A 1SRJA 1GKAB 1NDJA 2IZEB 1YWBA 4JNJA 2UYWA 3D4RA 3P24A 1BEBA 1DZKA 4NV8A 4TQ2A 1YIVA 2X55A 3G7XA 2RCQA 1GT5A 3APWA 3NP1A 4GUZA 5D47A 2WEWA 5FQ7E 2L68A 2RTDB 3U03A 3TGAA 3F8AA 2VFBA 4ZGFA 3ZI8A 1DC9A 5FQ6E 4IMOA 1YWCA 2WWPA 4I6SA 3RWXA 1G85A 2A2UA 1QY1A 2AT5X 4NLJA 3E3CA 5F6BA 1N4JA 5B29A 3B2LA 4YVBA 2JU3A 3CBCA 2FR3A 2PY1A 2UZ2A 4U8UM 2MO5A 1BSQA 3VGWA 4ZHGA 1MOYA 2AT8X 3BY0A 4XMHA 1DFVA 3I0AA 4ORYA 4Y0RA 4CPHA 3WBGA 1MM9A 2L67A 3BLGA 1VWEB 3EM0A 4ORSA 4Y0QA 2QOMA 5BVQA 3TF6A 4A8ZA 2BHVA 1GGLA 4BGFA 4NP1A 4Z2PA 3SLOA 1NP1A 1OBQA 3FDCA 5BVSA 3FIQA 4CPFA 2AT6X 2KW1A 1I04A 1VWNB 2JOZA 4PSQA 1UYNX 1VWKB 2QO5A 2E4JA 2F09A 1SWTA 1TW4A 3IA8A 3JQOA 4GGTA 2VDFA 1OPBA 3WYPA 4BX5A 1SY3A 4GJVA 3X00A 4MISA 3EBKA 1I9HA 1SA8A 3VG7A 3D97A 5F6ZA 1RSTB 1LFOA 3RDXA 2R74A 5HCCC 1X8NA 2C1SA 3APVA 3BDRA 4JO6A 4CDFA 1UYOX 2P8GA 5B10O 5K67A 3NX1A 4L1NA 2LA7A 1PBYA 5DG4A 2X32A 3P02A 4QNIA 1DZPA 3V8UA 2WEXA 3C77X 4O4OA 3STKA 3ZUOA 5IO5A 5D8JA 4BX5B 3WZOA 5L8OA 2AT0X 2A2GA 4GD9A 5D45A 1Y55X 5LJDA 1OPAA 3FR2A 1CBQA 1QWDA 3FEPA 1LELA 3ZW1A 3HWEA 4COTA 2IZDB 4XMCA 1U0XA 1X8QA 1KT6A 4YBUA 1JYJA 2K23A 4LKTA 3RKGA 1SWQA 2X8TA 1AVDA 3EYCA 1T8VA 5IRAA 4Z28A 4AZQA 1MVGA 4YCEA 3STMX 3FR4A 2CAMA 1A18A 2Q39A 4GK9A 1HMTA 2JW1A 2N93A 4YFQA 2G78A 3CKFA 5IO7A 3P6DA 3QKGA 1BSOA 2Z4IA 3ZW1B 1DV9A 1SWPA 5K68A 5HA0A 4QGVA 1E00A 3VU1A 3MVFA 1CRBA 1XCAA 4ML7B 1VYOA 2L9CA 1T68X 4MVIA 1KFFA 4MEEA 1T0VA 4U8UN 3CQRA 4I60A 5HCEC 5LJKA 1MX7A 3RDQA 1LIEA 4O3XB 4QGXA 3T1DA 3VHIA 3PP6A 2IZIA 3FELA 4I9SA 2OZQA 4AYHA 4EQAC 4YFPA 3VG6A 3P6GA 1Y53X 5JD2A 3CBSA 5HBSA 3UEXA 4BX7A 1K3BA 2X45A 3UAQA 3OBLA 1E2TA 1WBIA 1K24A 1YWDA 2NNEA 3AKMA 1PEEA 3VG2A 1E02A 5IO6A 2GTLM 1MX8A 2FR2A 2ZAIA 1O1UA 2RTAA 4O3YA 3DSZA 1W5RA 1SWBA 1L6MA 2OVAA 1P6PA 3KZAA 3KFFA 2HYSA 1KZWA 1ADLA 4WFVA 3FW4A 2MM3A 3BX7A 2WQ9A 4GDAA 5KICA 1LIDA 3KFHA 1OBUA 1S44A 1EALA 2EU7X 3P6FA 1LIFA 3HK1A 3VHHA 5EZ2A 2WUTA 1B8EA 1VYFA 4IBAA 5L8NA 5LJCA 2OVDA 3RDMA 4BQUA 3LHNA 3MG5A 4ID2A 1BLRA 4O3ZA 3NQ9A 3HWFA 5JR8A 4D6AA 4QZUA 1AELA 1KQXA 2CM4A 2R73A 1GT4A 5FENA 1SWEA 1X8UA 3QQ2A 3WJDA 1Y9TA 1ICNA 2L5PA 4HFOA 4Z2VA 1Y52X 2ZSCA 1VWRB 3BX8A 2OF9A 1AVEA 2FT9A 3PDFA 3PPTA 1O1VA 4M7MA 4O9SA 3UEWA 1A57A 3WYQA 1KT3A 3S5VA 5C0NA 1KT7A 1EIOA 4MVKA 3U9PC 4ZHCA 1GX8A 2CBSA 4KT5A 2CM9A 1N0SA 2FHLA 3HPEA 5AEOA 2IZLB 5IXGA 1JMXA 1G5WA 1PMPA 4U46A 1SRGA 2KD2A 4GE1A 1HXLA 3STNA 3O2YA 3BU1A 1NGLA 2A3FX 3VE2A 3SZJA 5HTDA 1NC9A 4L3RA 3JS1A 2OFMX 3CMPA 1B4MA 1SWHA 4OMWA 3PH5A 4I3BA 1RAVA 1HN2A 2G79A 2W2FA 1MDCA 4ES7A 4LZUA 4WHIA 1CJ5A 2AMMX 2LB6A 4TLJA 1LCZA 5EEDA 2OY7A 3ZWEA 3RE6A 1SRFA 4O4XA 4A60A 4DCBA 4TKBA 4ODDA 3RY2A 3LTWA 2OY5O 4AZMA 2DJFA 1IKJA 4NV7A 4ZGUA 2I5ZO 2RTFB 1HBQA 2RTCB 5CE4A 1S2PA 2VFCA 3CKGA 3KFIA 2MWHA 3WZPA 1A3YA 3L4RA 2QO6A 4FGIB 3HOEA 3WJCA 2Y32A 2XKLA 3FMZA 1EPAA 3P6CA 3NPOA 4IB8A 4QQ1A 3FENA 3WJFA 4AW8A 4QRLA 3SOTA 3OE3A 3SZHA 1JMZA 1ZNLA 2OFAA 2OVSA 4LQZA 4CPHB 1ERBA 4RUUA 1VPRA 3RDOA 2DM5A 2A8GA 4IB9A 1PTSA 1JIWI 1GX3A 2OL6O 4IB7A 1I78A 4O4SA 4PJ2A 3C78X 3FR5A 1H91A 3NX2A 4I3CA 1SLEB 5IRUA 1TVQA 2GTLN 4MIRA 1RLBE 1G7NA 1BBPA 1X8PA 2AKQA 5FFHA 1N9YA 3F9DA 4YCHA 3FA6A 4ALBA 1SWLA 4BOEA 4RUNA 5KHPA 4TKJA 2A0AA 1MK5A 1O8VA 3WOVA 3JSQA 3AUMO 4QYPA 1W4TA 1ZNHA 2YMSA 2QOSC 5BYPA 3LV4A 2GH7A 4OS0A 3HWDA 4INNA 1A2DA 1FELA 3P6HA 3EMMA 3CQNA 1SWDA 1HQPA 1TOWA 1IKEA 4GGRA 2IZFB 3OJYC 5F1EA 2ACOA 4NLIA 1PM1X 4ZFXA 3MM0A 3S60A 2R56A 3GAQA 4K19A 4UU3A 4YFRA 1SWFA 2GC9A 4ZHDA 1QY2A 1OEKA 4ARHA 1OBPA 3D96A 5F58A 1JZUA 2QMIA 4IMNA 4MVLA 1KOIA 1SXUA 3WJGA 3ZW0A 2LFOA 2Y3FA 1AVGI 1CBIA 4XMDA 3RBYA 4AZOA 2FLJA 5HZ8A 4ZCBA 1HXZA 1BWYA 4DQ3A 1RXKA 5F2BA 4CK4A 1SY2A 1STSB 2G7BA 2LBAA 1BM5A 4GETA 2LKKA 1LIBA 3FA9A 1KQWA 1KT5A 2WPUA 4GRJA 5LJGA 2IZJA 4AZNA 1KZXA 2KT4B 1IFCA 5HZ6A 4BVMA 4GU8A 1NP4A 1SWGA 1EUOA 4NYQA 1FJ1E 1LNMA 1FEMA 2IZAA 5B3MO 2DJGA 2FWVA 3O22A 1NBXA 3D95A 4ALOA 4KC8A 2X46A 4N7DA 3KFGA 4YH0A 3ZW0B 2OY1O 5HCDC 3WZNA 1I4UA 5FAZA 4IAWA 1ACDA 2OY8A 2OF8A 3T6FA 1JV4A 4GZVA 1QG5A 4YKOA 1GM6A 3NBXX 2W2BA 1SY0A 2GTFX 3B2JA 4CDCA 4YBPA 1EPBA 4Z2OA 3FYFA 3RE5A 5B11O 4LZVA 5B27A 4ZHHA 1U18A 3B2HA 4OMXA 4QZTA 2C1QA 1YUPA 4NW4A 4YGZA 4U8UO 2OFRX 4A1HA 1VWAB 1RSUB 4GH7A 2RD7C 4ZJ0A 1IJ8A 1VWQB 4XMEA 3UEUA 1EIIA 2RCTA 4FBOA 4HWMA 1LF7A 1WUBA 4N7CA 1BRPA 2RTLA 3O19A 1ZNKA 2K62A 5DPQA 3ZQ3A 1JYDA 3TGCA 2RTNB 3TZSA 3KVNA 1JJXA 2RN4A 1YP7A 2QCBA 5LJBA 3NADA 2X34A 3EW1A 4GGZA 3HOLA 4BX7B 2RTBB 4I95A 1X89A 4TKHA 2MHDA 1IIUA 1AQBA 1VWJB 1N9MA 1OEJA 4YDAA 3Q6LA 2JU7A 3S26A 2F73A 5L8IA 1QQSA 4EEJA 3B2KA 4Y0PA 1SWJA 3KQ0A 5LJEA 3TGBA 3FLLA 2HKDA 2X56A 1XKIA 1ZNEA 2M4LA 3EBWA 4ORRA 3RDSA 1LPJA 1BRQA 1JJJA 1KL4A 1NQNA 4CSBA 1SREA 3PQSA 4GNYA 1HBPA 1Y0GA 2RTQB 2WSJA 1GT3A 4EFGA 4ON1A 1JBHA 2ACPX 4LKPA 2ASNX 4C5PA 2W2AA 2G5LA 3N91A 5HA1A 2A13A 2BS5A 3ZZVA 5B2AO 1SWCA 1LCWA 4CV7A 4WBKA 4WFUA 2JU8A 3NQ3A 4UU2A 3SAOA 2ANSA 2AVIA 4AZPA 2BLGA 3WJEA 5IRWA 1SY1A 1E5PA 2A5CA 3EW2A 3HWGA 4OKAA 3APUA 1S7DA 4ZH9A 1MEPA 4QAEA 3WJBA 3NQKA 1QFTA 3WXQA 3HTYA 4HPDA 4YGGA 1ML7A 3K3LA 4O4UA 5EEEA 4EXZA 5AJBA 2IFBA 3BSZE 3MBTA 3Q34A 4KCAA 5D4AA 5HWZA 2FRSA 3T2WA 2NNDA 4Y0SA 2AT3X 2FS6A 2OVEA 5CYBA 1SWRA 2HLVA 1GX9A 3VG3A 3MX7A 4TJZA 5L3YA 4NNTA 5H9AA 3ELXA 2Q4NA 1R0UA 1Z24A 2OFBA 3B2IA 4YMYA 4HPCA 4BJ8A 3OD9A 2IZBA 2Q2PA 4HPBA 3EC5A 3APXA 1ALBA 3BRNA 2NP1A 4YGHA 5FQ8E 4Z27A 1N7YA 1ZNDA 1N43A 4ORXA 5KIDA 5B5FA 1EW3A 1LICA 2HMBA 2LBVA 2FGSA 4EKVA 1CBRA 1W6FA 3DTQA 1GXAA 4XMFA 2X8FA 5HAEA 3WVMA 4KC7A 3ELZA 2QM9A 2AL0X 2RTHB 4IB6A 4OELA 2RTIB 5K06A 2RTRB 1OEEA 2YG2A 1JJUA 1E06A 1RBPA 1VWMB 4I3DA 3SLJA 2HZRA 2IZHB 2KTDA 1KXOA 2GTLO 4ZH6A 5CHKA 4M6SA 1QFVA 1LDQA 4NYRA 1KT4A 5EDCA 3PEDA 4Y5DA 3PH6A 1SMPI 4U3QA 2WR6A 1NQMA 1YP6A 1SWOA 3NR3A 1KL5A 4YDBA 4IAXA 3ZUIA 1MUPA 2BC3A 1VWPB 1VWCB 2IZGB 1D3SA 2Q9SA 2X4MA 2XSTA 1HMSA 3H3IA 3GE2A 4JGLA 5H9LA 3RSWA 1FTPA 3U0DA 1IFBA 4ZR2A 1JQPA 5HTEA 2X8SA 3SLTA 5CSEA 1YWAA 2FHNX 2KTSA 2RTMA 1SLFB 1RXHA 3UEVA 3FEKA 1Y9LA 2JMBA 1I05A 4XMGA 5BVTA 1SWKA 5LKEA 1SLDB 4CDDA 3VHMA 3ZW2A 1TOUA 1SWUA 1VWDB 2I5VO 4GNWA 2C4IA 4U9CA 5AQ6A 1AB0A 2RTEB 1X71A 1UZ2X 4R0BA 2GJ5A 1STPA 4AZRA 5H9NA 3SZIA 1LDOA 1VWFB 4HPAA 2A5BA 1VWIB 1STRB 1SRHA 2IZCB 4CDEA 1HY2A 1FE3A 5LKFA 1QABE 3VG5A 2IZKA 1BJ7A 4IRWA 2MJIA 5B5GA 1BSYA 1OSPO 4KIIA 2RA6A 5D48A 1IW2A 3PECA 3VPJE 2FS7A 2RTJA 5HZ5A 5H8TA 2CZTA 4Z6JA 2AF5A 2CZUA 4NNSA 4ORWA 3WZQA 3RZYA 1KGLA 1VWLB 1FENA 1SRIA 1ZRYA 5HZQA 1SXXA 3VG4A 1TXLA 4BCSA 1ZNGA 1PBOA 4OS3A 3PQUA 1DF8A 1VWBB 3IFBA 4DNEA 4TNNA 2G8CO 1HMRA 3BS2A 3C76X 1SWSA 2Q2MA 1KL3A 4GKCA 4I9RA 4ORUA 4BBOA 4YKMA 1HQQA 4QYNA 4CPEA 3BU9A 1VWGB 1ERXA 2Y3EA 3P6EA 3RDUA 2OL7A 3S5XA
chains in the Genus database with same CATH topology
4EDEA 1ICMA 3FW5A 1G74A 2JN3A 1DF3A 1LKEA 2BT9A 1QY0A 2ZAGA 3RBYA 3FA7A 1SXWA 1U17A 4DQ4A 2ALLX 4ZHFA 4QGWA 4D6BA 1X8OA 1SXYA 4O3WA 1EI5A 4FBRA 1UREA 5H9KA 4FQBB 2HZQA 2HNXA 3VE1A 1GT1A 2FTBA 1CBSA 1B0OA 1GKAA 2BS6A 2AH7X 4MVEA 3VU1A 3F6ZB 1JBHA 1VYGA 4IABA 1I06A 4GDZA 2Z4HA 1DZMA 1EXSA 2O62A 1FDQA 1DZJA 2CBRA 5AJCA 2WQAE 4FBVA 2NNQA 2RQ0A 5F7GA 4OS8A 5EDBA 1D2UA 1B56A 3CR6A 2QO4A 3I17A 2POAA 5HZ9A 5LJHA 1EQDA 3AKNA 3CWKA 4O49A 5EPQA 4A1YA 4KH8A 3FA8A 1GKAB 1YWBA 3P24A 3D4RA 1BEBA 1DZKA 4TQ2A 1YIVA 3NP1A 3G7XA 2RCQA 1GT5A 3APWA 5D47A 5FQ7E 2WEWA 2L68A 3U03A 3TGAA 3F8AA 4ZGFA 3ZI8A 1DC9A 5FQ6E 4IMOA 1YWCA 2WWPA 4I6SA 3RWXA 1G85A 2A2UA 1QY1A 2AT5X 4NLJA 3E3CA 5F6BA 5B29A 3B2LA 2JU3A 3CBCA 2FR3A 2PY1A 4U8UM 2MO5A 1BSQA 4ZHGA 2AT8X 3BY0A 4XMHA 1DFVA 3I0AA 4ORYA 4Y0RA 3WBGA 2L67A 3BLGA 4Y0QA 3EM0A 4ORSA 5BVQA 3TF6A 4A8ZA 2BHVA 1GGLA 4NP1A 1NP1A 1OBQA 5BVSA 3FIQA 2AT6X 2KW1A 1I04A 4PSQA 2JOZA 2QO5A 2E4JA 2F09A 1TW4A 3IA8A 3JQOA 1OPBA 1SY3A 4MISA 3EBKA 1SA8A 3VG7A 3D97A 5F6ZA 1LFOA 2R74A 5HCCC 1X8NA 3APVA 3BDRA 2P8GA 3NX1A 4L1NA 2LA7A 5DG4A 3P02A 4QNIA 1DZPA 3V8UA 2WEXA 3C77X 4O4OA 3STKA 3ZUOA 5IO5A 5D8JA 5L8OA 2AT0X 2A2GA 5D45A 5LJDA 1OPAA 3FR2A 1CBQA 1QWDA 3FEPA 3ZW1A 3HWEA 4COTA 4XMCA 1U0XA 1X8QA 1KT6A 4YBUA 1JYJA 2K23A 4LKTA 3RKGA 2X8TA 3EYCA 1T8VA 4AZQA 1MVGA 4YCEA 3STMX 3FR4A 1A18A 2Q39A 4GK9A 1HMTA 2JW1A 2N93A 4YFQA 2G78A 5IO7A 3P6DA 3QKGA 1BSOA 2Z4IA 3ZW1B 1DV9A 5HA0A 4QGVA 1E00A 3MVFA 1CRBA 1XCAA 4ML7B 2L9CA 4MVIA 1T68X 1T0VA 4U8UN 3CQRA 5HCEC 5LJKA 1MX7A 1LIEA 4O3XB 4QGXA 3T1DA 3PP6A 3FELA 4I9SA 2OZQA 4AYHA 4EQAC 4YFPA 3VG6A 3P6GA 3UEXA 3CBSA 5HBSA 2X45A 3UAQA 3OBLA 2NNEA 1YWDA 1PEEA 3AKMA 3VG2A 5IO6A 1E02A 2GTLM 1MX8A 2FR2A 2ZAIA 1O1UA 4O3YA 3DSZA 1L6MA 2OVAA 1P6PA 3KZAA 3KFFA 2HYSA 1KZWA 1ADLA 4WFVA 3FW4A 2MM3A 3BX7A 2WQ9A 5KICA 1LIDA 3KFHA 1OBUA 1S44A 1EALA 2EU7X 3P6FA 1LIFA 3HK1A 5EZ2A 2WUTA 1B8EA 1VYFA 4IBAA 5L8NA 5LJCA 2OVDA 4BQUA 3LHNA 4ID2A 1BLRA 4O3ZA 3NQ9A 3HWFA 5JR8A 4D6AA 4QZUA 1KQXA 2CM4A 2R73A 1GT4A 5FENA 1X8UA 3WJDA 1Y9TA 1ICNA 2L5PA 4HFOA 3BX8A 4O9SA 4M7MA 2FT9A 3PPTA 3UEWA 1O1VA 5KHPA 1A57A 1EIOA 5C0NA 1KT3A 3S5VA 1KT7A 4MVKA 3U9PC 4ZHCA 1GX8A 2CBSA 4KT5A 2CM9A 1N0SA 5AEOA 1G5WA 1PMPA 2KD2A 4GE1A 3STNA 3O2YA 3BU1A 1NGLA 2A3FX 3VE2A 5HTDA 4L3RA 3JS1A 2OFMX 3CMPA 1B4MA 4OMWA 3PH5A 4I3BA 1HN2A 2G79A 2W2FA 1MDCA 4ES7A 4LZUA 4WHIA 1CJ5A 2AMMX 2LB6A 4TLJA 5EEDA 3ZWEA 4O4XA 4A60A 4TKBA 4ODDA 4AZMA 4ZGUA 1IKJA 1HBQA 5CE4A 1S2PA 3KFIA 2MWHA 1A3YA 3L4RA 2QO6A 4FGIB 3HOEA 3WJCA 2XKLA 3FMZA 1EPAA 3P6CA 3NPOA 4IB8A 4QQ1A 3FENA 3WJFA 4AW8A 4QRLA 3SOTA 3OE3A 2OVSA 1ZNLA 4LQZA 1ERBA 4RUUA 1VPRA 5LJBA 2DM5A 4IB9A 1JJJA 4IB7A 1JIWI 4PJ2A 4O4SA 3C78X 3FR5A 1H91A 3NX2A 4I3CA 1TVQA 2GTLN 4MIRA 1RLBE 1G7NA 1BBPA 1X8PA 2AKQA 5FFHA 4ALBA 3F9DA 4YCHA 3FA6A 4BOEA 4RUNA 4TKJA 2A0AA 1O8VA 3WOVA 3JSQA 4QYPA 2YMSA 1ZNHA 2QOSC 5BYPA 3LV4A 4OS0A 3HWDA 4INNA 1A2DA 1FELA 3P6HA 3EMMA 3CQNA 1HQPA 1TOWA 1IKEA 3OJYC 5F1EA 2ACOA 4NLIA 1PM1X 4ZFXA 3S60A 2R56A 3GAQA 4K19A 4UU3A 4YFRA 2GC9A 4ZHDA 1QY2A 1OEKA 4ARHA 1OBPA 3D96A 5F58A 1JZUA 2QMIA 4IMNA 4MVLA 1KOIA 1SXUA 3WJGA 3ZW0A 2LFOA 1AVGI 1CBIA 4XMDA 4AZOA 2FLJA 5HZ8A 4ZCBA 1BWYA 4DQ3A 4CK4A 1BM5A 1SY2A 2G7BA 2LBAA 4GETA 2LKKA 1LIBA 3FA9A 1KQWA 1KT5A 5LJGA 4GRJA 4AZNA 1KZXA 2KT4B 1IFCA 5HZ6A 4BVMA 4GU8A 1NP4A 4NYQA 1EUOA 1LNMA 1FEMA 2FWVA 3O22A 3D95A 4ALOA 4KC8A 2X46A 4N7DA 3KFGA 4YH0A 3ZW0B 5HCDC 1I4UA 5FAZA 4IAWA 1ACDA 1JV4A 4GZVA 1QG5A 4YKOA 1GM6A 3NBXX 2W2BA 1SY0A 2GTFX 3B2JA 4YBPA 1EPBA 3FYFA 4LZVA 5B27A 4ZHHA 1U18A 3B2HA 4OMXA 4QZTA 1AELA 1YUPA 4NW4A 4YGZA 4U8UO 2OFRX 4A1HA 4GH7A 2RD7C 4ZJ0A 4XMEA 3UEUA 1EIIA 2RCTA 4FBOA 4HWMA 1LF7A 4N7CA 1BRPA 3O19A 5DPQA 1ZNKA 2K62A 3ZQ3A 1JYDA 3TGCA 3TZSA 1JJXA 2RN4A 1YP7A 3NADA 3HOLA 4TKHA 4I95A 1X89A 2MHDA 1IIUA 1AQBA 1OEJA 4YDAA 3Q6LA 2JU7A 3S26A 2F73A 5L8IA 1QQSA 4EEJA 3B2KA 4Y0PA 3KQ0A 5LJEA 3TGBA 3FLLA 1XKIA 1ZNEA 2M4LA 3EBWA 4ORRA 1LPJA 1BRQA 4CSBA 3PQSA 4GNYA 1HBPA 2WSJA 1GT3A 4EFGA 4ON1A 2ACPX 4LKPA 2ASNX 2W2AA 5HA1A 3N91A 2A13A 2BS5A 3ZZVA 4CV7A 4WBKA 4WFUA 2JU8A 3NQ3A 4UU2A 3SAOA 2ANSA 4AZPA 2BLGA 3WJEA 1SY1A 1E5PA 3HWGA 4ZH9A 3APUA 1S7DA 3WXQA 3ZUIA 4QAEA 3WJBA 3NQKA 1QFTA 3HTYA 4HPDA 4YGGA 1ML7A 3K3LA 4O4UA 5EEEA 4EXZA 5AJBA 2IFBA 3BSZE 3MBTA 4KCAA 5D4AA 5HWZA 2FRSA 2NNDA 4Y0SA 2AT3X 2FS6A 2OVEA 5CYBA 2HLVA 1GX9A 3VG3A 3MX7A 4TJZA 4NNTA 5H9AA 3ELXA 2Q4NA 1R0UA 1Z24A 3B2IA 4YMYA 4HPCA 3OD9A 4HPBA 2Q2PA 3APXA 1ALBA 3BRNA 2NP1A 4YGHA 5FQ8E 1ZNDA 4ORXA 5KIDA 1EW3A 1LICA 2HMBA 2LBVA 1CBRA 3DTQA 1GXAA 4XMFA 2X8FA 5HAEA 3WVMA 4KC7A 3ELZA 2QM9A 2AL0X 4IB6A 5K06A 1OEEA 2YG2A 1E06A 1RBPA 4I3DA 2HZRA 2KTDA 1KXOA 2GTLO 4ZH6A 4M6SA 1QFVA 4NYRA 1KT4A 5EDCA 3PEDA 3PH6A 1SMPI 4U3QA 2WR6A 1YP6A 3NR3A 4YDBA 4IAXA 1MUPA 2XSTA 2Q9SA 1D3SA 3H3IA 5H9LA 3RSWA 1HMSA 4JGLA 3GE2A 3U0DA 1FTPA 1IFBA 4ZR2A 5HTEA 2X8SA 1YWAA 2KTSA 3UEVA 3FEKA 1Y9LA 2JMBA 1I05A 4XMGA 5BVTA 5LKEA 3ZW2A 1TOUA 4GNWA 4U9CA 5AQ6A 1AB0A 1X71A 1UZ2X 4R0BA 2GJ5A 4AZRA 5H9NA 4HPAA 1FE3A 5LKFA 1QABE 3VG5A 1BJ7A 2MJIA 1BSYA 4KIIA 2RA6A 5D48A 1IW2A 3PECA 3VPJE 2FS7A 5HZ5A 5H8TA 2CZTA 4ORWA 2CZUA 4NNSA 1KGLA 3RZYA 1ZRYA 1FENA 5HZQA 1SXXA 3VG4A 1TXLA 1ZNGA 1PBOA 4OS3A 3PQUA 3IFBA 4TNNA 1HMRA 3BS2A 3C76X 2Q2MA 4GKCA 4I9RA 4ORUA 4YKMA 4QYNA 3BU9A 1ERXA 3P6EA 3S5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EDE A;  1ICM A;  3FW5 A;  1G74 A;  2JN3 A;  1DF3 A;  1LKE A;  1QY0 A;  3FA7 A;  1SXW A;  1U17 A;  4DQ4 A;  2ALL X;  4ZHF A;  4QGW A;  4D6B A;  1X8O A;  1SXY A;  1URE A;  5H9K A;  2HZQ A;  2HNX A;  1GT1 A;  2FTB A;  1CBS A;  1B0O A;  1GKA A;  1JBH A;  2AH7 X;  1VYG A;  1I06 A;  1DZM A;  1EXS A;  2O62 A;  1FDQ A;  1DZJ A;  2CBR A;  2WQA E;  2NNQ A;  2RQ0 A;  5F7G A;  4OS8 A;  5EDB A;  1D2U A;  1B56 A;  3CR6 A;  2QO4 A;  3I17 A;  2POA A;  5HZ9 A;  5LJH A;  1EQD A;  3AKN A;  3CWK A;  5EPQ A;  4A1Y A;  3FA8 A;  1GKA B;  1YWB A;  1BEB A;  1DZK A;  4TQ2 A;  1YIV A;  3NP1 A;  3G7X A;  2RCQ A;  1GT5 A;  3APW A;  5D47 A;  2WEW A;  2L68 A;  3U03 A;  3TGA A;  3F8A A;  1DC9 A;  4IMO A;  1YWC A;  2WWP A;  1G85 A;  2A2U A;  1QY1 A;  2AT5 X;  4NLJ A;  5F6B A;  5B29 A;  3B2L A;  2JU3 A;  3CBC A;  2FR3 A;  2PY1 A;  2MO5 A;  1BSQ A;  4ZHG A;  2AT8 X;  3BY0 A;  4XMH A;  1DFV A;  3I0A A;  4ORY A;  4Y0R A;  3WBG A;  2L67 A;  3BLG A;  4Y0Q A;  3EM0 A;  4ORS A;  5BVQ A;  3TF6 A;  4A8Z A;  1GGL A;  4NP1 A;  1NP1 A;  1OBQ A;  5BVS A;  3FIQ A;  2AT6 X;  1I04 A;  4PSQ A;  2JOZ A;  2QO5 A;  2E4J A;  1TW4 A;  3IA8 A;  1OPB A;  1SY3 A;  3EBK A;  1SA8 A;  3VG7 A;  3D97 A;  5F6Z A;  1LFO A;  2R74 A;  5HCC C;  1X8N A;  3APV A;  3BDR A;  2P8G A;  3NX1 A;  5DG4 A;  1DZP A;  2WEX A;  3C77 X;  3STK A;  3ZUO A;  5IO5 A;  5D8J A;  5L8O A;  2AT0 X;  2A2G A;  5D45 A;  5LJD A;  1OPA A;  3FR2 A;  1CBQ A;  1QWD A;  3FEP A;  3HWE A;  4XMC A;  1U0X A;  1X8Q A;  1KT6 A;  4YBU A;  1JYJ A;  2K23 A;  4LKT A;  3EYC A;  1T8V A;  4AZQ A;  1MVG A;  4YCE A;  3STM X;  3FR4 A;  1A18 A;  2Q39 A;  1HMT A;  2N93 A;  4YFQ A;  2G78 A;  5IO7 A;  3P6D A;  3QKG A;  1BSO A;  1DV9 A;  5HA0 A;  4QGV A;  1E00 A;  3MVF A;  1CRB A;  1XCA A;  2L9C A;  4MVI A;  1T68 X;  1T0V A;  3CQR A;  5HCE C;  5LJK A;  1MX7 A;  1LIE A;  4QGX A;  3T1D A;  3PP6 A;  3FEL A;  4I9S A;  2OZQ A;  4AYH A;  4YFP A;  3VG6 A;  3P6G A;  3UEX A;  3CBS A;  5HBS A;  2X45 A;  2NNE A;  1YWD A;  1PEE A;  3AKM A;  3VG2 A;  5IO6 A;  1E02 A;  1MX8 A;  2FR2 A;  1O1U A;  3DSZ A;  1L6M A;  2OVA A;  1P6P A;  3KZA A;  3KFF A;  2HYS A;  1KZW A;  1ADL A;  4WFV A;  3FW4 A;  2MM3 A;  3BX7 A;  2WQ9 A;  5KIC A;  1LID A;  3KFH A;  1OBU A;  1S44 A;  1EAL A;  2EU7 X;  3P6F A;  1LIF A;  3HK1 A;  5EZ2 A;  2WUT A;  1B8E A;  1VYF A;  4IBA A;  5L8N A;  5LJC A;  2OVD A;  4BQU A;  1BLR A;  3NQ9 A;  3HWF A;  5JR8 A;  4D6A A;  4QZU A;  1KQX A;  2CM4 A;  2R73 A;  1GT4 A;  5FEN A;  1X8U A;  3WJD A;  1ICN A;  2L5P A;  4HFO A;  3BX8 A;  4O9S A;  4M7M A;  2FT9 A;  3PPT A;  3UEW A;  1O1V A;  5KHP A;  1A57 A;  1EIO A;  5C0N A;  1KT3 A;  1KT7 A;  4MVK A;  3U9P C;  4ZHC A;  1GX8 A;  2CBS A;  2CM9 A;  1N0S A;  1G5W A;  1PMP A;  4GE1 A;  3STN A;  3O2Y A;  3BU1 A;  1NGL A;  2A3F X;  5HTD A;  3JS1 A;  2OFM X;  3CMP A;  1B4M A;  4OMW A;  3PH5 A;  4I3B A;  1HN2 A;  2G79 A;  2W2F A;  1MDC A;  4ES7 A;  4LZU A;  1CJ5 A;  2AMM X;  2LB6 A;  4TLJ A;  5EED A;  4A60 A;  4TKB A;  4ODD A;  4AZM A;  4ZGU A;  1IKJ A;  1HBQ A;  5CE4 A;  1S2P A;  3KFI A;  1A3Y A;  3L4R A;  2QO6 A;  3WJC A;  2XKL A;  3FMZ A;  1EPA A;  3P6C A;  3NPO A;  4IB8 A;  4AW8 A;  3FEN A;  3WJF A;  1ZNL A;  1ERB A;  4RUU A;  1VPR A;  5LJB A;  2DM5 A;  4IB9 A;  1JJJ A;  4IB7 A;  3C78 X;  3FR5 A;  1H91 A;  3NX2 A;  4I3C A;  1TVQ A;  1RLB E;  1G7N A;  1BBP A;  1X8P A;  2AKQ A;  5FFH A;  4ALB A;  3F9D A;  4YCH A;  3FA6 A;  4BOE A;  4RUN A;  4TKJ A;  2A0A A;  1O8V A;  3JSQ A;  4QYP A;  1ZNH A;  2QOS C;  4OS0 A;  3HWD A;  1A2D A;  1FEL A;  3P6H A;  3EMM A;  3CQN A;  1HQP A;  1TOW A;  1IKE A;  3OJY C;  5F1E A;  2ACO A;  4NLI A;  1PM1 X;  4ZFX A;  2R56 A;  3GAQ A;  4K19 A;  4UU3 A;  4YFR A;  2GC9 A;  4ZHD A;  1QY2 A;  1OEK A;  4ARH A;  1OBP A;  3D96 A;  5F58 A;  1JZU A;  4IMN A;  4MVL A;  1KOI A;  1SXU A;  3WJG A;  2LFO A;  1AVG I;  1CBI A;  4XMD A;  4AZO A;  2FLJ A;  5HZ8 A;  4ZCB A;  1BWY A;  4DQ3 A;  4CK4 A;  1BM5 A;  1SY2 A;  2G7B A;  2LBA A;  4GET A;  2LKK A;  1LIB A;  3FA9 A;  1KQW A;  1KT5 A;  5LJG A;  4GRJ A;  4AZN A;  1KZX A;  2KT4 B;  1IFC A;  5HZ6 A;  4BVM A;  1NP4 A;  4NYQ A;  1EUO A;  1LNM A;  1FEM A;  2FWV A;  3O22 A;  3D95 A;  4ALO A;  2X46 A;  4N7D A;  3KFG A;  4YH0 A;  5HCD C;  1I4U A;  5FAZ A;  4IAW A;  1ACD A;  1JV4 A;  4YKO A;  1QG5 A;  1GM6 A;  2W2B A;  1SY0 A;  2GTF X;  3B2J A;  4YBP A;  1EPB A;  4LZV A;  5B27 A;  4ZHH A;  1U18 A;  3B2H A;  4OMX A;  4QZT A;  1AEL A;  1YUP A;  4YGZ A;  2OFR X;  4A1H A;  4GH7 A;  2RD7 C;  4ZJ0 A;  4XME A;  3UEU A;  1EII A;  2RCT A;  1LF7 A;  4N7C A;  1BRP A;  3O19 A;  5DPQ A;  1ZNK A;  2K62 A;  3ZQ3 A;  1JYD A;  3TGC A;  3TZS A;  1JJX A;  1YP7 A;  3NAD A;  4TKH A;  1X89 A;  1IIU A;  1AQB A;  1OEJ A;  4YDA A;  3Q6L A;  2JU7 A;  3S26 A;  2F73 A;  5L8I A;  1QQS A;  4EEJ A;  3B2K A;  4Y0P A;  3KQ0 A;  5LJE A;  3TGB A;  3FLL A;  1XKI A;  1ZNE A;  3EBW A;  4ORR A;  1LPJ A;  1BRQ A;  4GNY A;  1HBP A;  2WSJ A;  1GT3 A;  4EFG A;  2ACP X;  4LKP A;  2ASN X;  2W2A A;  5HA1 A;  2A13 A;  4WBK A;  4WFU A;  2JU8 A;  3NQ3 A;  4UU2 A;  3SAO A;  2ANS A;  4AZP A;  2BLG A;  3WJE A;  1SY1 A;  1E5P A;  3HWG A;  4ZH9 A;  3APU A;  1S7D A;  3WXQ A;  3ZUI A;  4QAE A;  3WJB A;  1QFT A;  4HPD A;  4YGG A;  1ML7 A;  3K3L A;  5EEE A;  4EXZ A;  5HWZ A;  2IFB A;  3BSZ E;  3MBT A;  5D4A A;  2FRS A;  2NND A;  4Y0S A;  2AT3 X;  2FS6 A;  2OVE A;  2HLV A;  1GX9 A;  3VG3 A;  4TJZ A;  4NNT A;  5H9A A;  3ELX A;  2Q4N A;  1R0U A;  1Z24 A;  3B2I A;  4YMY A;  4HPC A;  4HPB A;  2Q2P A;  3APX A;  1ALB A;  3BRN A;  2NP1 A;  4YGH A;  1ZND A;  4ORX A;  5KID A;  1EW3 A;  1LIC A;  2HMB A;  2LBV A;  1CBR A;  3DTQ A;  1GXA A;  4XMF A;  5HAE A;  3WVM A;  3ELZ A;  2QM9 A;  2AL0 X;  4IB6 A;  5K06 A;  1OEE A;  2YG2 A;  1E06 A;  1RBP A;  4I3D A;  2HZR A;  2KTD A;  1KXO A;  4ZH6 A;  4M6S A;  1QFV A;  4NYR A;  1KT4 A;  5EDC A;  3PED A;  3PH6 A;  2WR6 A;  1YP6 A;  3NR3 A;  4YDB A;  4IAX A;  1MUP A;  2XST A;  2Q9S A;  1D3S A;  3RSW A;  5H9L A;  1HMS A;  3U0D A;  1FTP A;  1IFB A;  4ZR2 A;  5HTE A;  1YWA A;  3UEV A;  3FEK A;  4XMG A;  1I05 A;  5BVT A;  5LKE A;  1TOU A;  4GNW A;  5AQ6 A;  1AB0 A;  1X71 A;  1UZ2 X;  4R0B A;  2GJ5 A;  4AZR A;  5H9N A;  4HPA A;  1FE3 A;  5LKF A;  1QAB E;  3VG5 A;  1BJ7 A;  2MJI A;  1BSY A;  4KII A;  2RA6 A;  5D48 A;  1IW2 A;  3PEC A;  2FS7 A;  5HZ5 A;  5H8T A;  2CZT A;  4ORW A;  2CZU A;  4NNS A;  1KGL A;  3RZY A;  1ZRY A;  1FEN A;  5HZQ A;  1SXX A;  3VG4 A;  1TXL A;  1ZNG A;  1PBO A;  4OS3 A;  3IFB A;  4TNN A;  1HMR A;  3BS2 A;  3C76 X;  2Q2M A;  4GKC A;  4I9R A;  4ORU A;  4YKM A;  4QYN A;  3BU9 A;  1ERX A;  3P6E A; 
#chains in the Genus database with same CATH topology
 4EDE A;  1ICM A;  3FW5 A;  1G74 A;  1VWH B;  2JN3 A;  1DF3 A;  1LKE A;  2BT9 A;  1QY0 A;  2ZAG A;  4JHQ A;  3FA7 A;  2F01 A;  3FID A;  1SXW A;  1U17 A;  2OYB O;  2ALL X;  3AEH A;  4OEM A;  4DQ4 A;  4QGW A;  4ZHF A;  1LCV A;  1VWO B;  4D6B A;  1X8O A;  1SXY A;  4Y59 A;  4O3W A;  1LUQ A;  1EI5 A;  4FBR A;  1URE A;  5H9K A;  2RTO B;  4FQB B;  2HZQ A;  2HNX A;  3VE1 A;  4BX6 A;  1GT1 A;  1SLG B;  1CBS A;  1B0O A;  1GKA A;  2BS6 A;  2FTB A;  2RTK A;  3D9W A;  3F6Z B;  4MVE A;  1SWA A;  1SWN A;  2AH7 X;  2FKJ A;  1VYG A;  2RTG B;  4IAB A;  1I06 A;  4GDZ A;  2JGS A;  2MF6 A;  2Z4H A;  3PK2 A;  1DZM A;  1EXS A;  2PI3 O;  3RY1 A;  2BSZ A;  1RXJ A;  2O62 A;  1FDQ A;  1DZJ A;  2CBR A;  5AJC A;  4CPI A;  4GJS A;  2WQA E;  4FBV A;  2NNQ A;  2RQ0 A;  2RTP B;  5F7G A;  4B55 A;  4OS8 A;  2FKG A;  1D2U A;  1B56 A;  2OL8 O;  3CR6 A;  5EDB A;  3T2X A;  2QO4 A;  3I17 A;  2POA A;  5HZ9 A;  5LJH A;  1EQD A;  3AKN A;  3CWK A;  3T6L A;  4BX6 B;  4O49 A;  5EPQ A;  4A1Y A;  4KH8 A;  3FA8 A;  1SRJ A;  1GKA B;  1NDJ A;  2IZE B;  1YWB A;  4JNJ A;  2UYW A;  3D4R A;  3P24 A;  1BEB A;  1DZK A;  4NV8 A;  4TQ2 A;  1YIV A;  2X55 A;  3G7X A;  2RCQ A;  1GT5 A;  3APW A;  3NP1 A;  4GUZ A;  5D47 A;  2WEW A;  5FQ7 E;  2L68 A;  2RTD B;  3U03 A;  3TGA A;  3F8A A;  2VFB A;  4ZGF A;  3ZI8 A;  1DC9 A;  5FQ6 E;  4IMO A;  1YWC A;  2WWP A;  4I6S A;  3RWX A;  1G85 A;  2A2U A;  1QY1 A;  2AT5 X;  4NLJ A;  3E3C A;  5F6B A;  1N4J A;  5B29 A;  3B2L A;  4YVB A;  2JU3 A;  3CBC A;  2FR3 A;  2PY1 A;  2UZ2 A;  4U8U M;  2MO5 A;  1BSQ A;  3VGW A;  4ZHG A;  1MOY A;  2AT8 X;  3BY0 A;  4XMH A;  1DFV A;  3I0A A;  4ORY A;  4Y0R A;  4CPH A;  3WBG A;  1MM9 A;  2L67 A;  3BLG A;  1VWE B;  3EM0 A;  4ORS A;  4Y0Q A;  2QOM A;  5BVQ A;  3TF6 A;  4A8Z A;  2BHV A;  1GGL A;  4BGF A;  4NP1 A;  4Z2P A;  3SLO A;  1NP1 A;  1OBQ A;  3FDC A;  5BVS A;  3FIQ A;  4CPF A;  2AT6 X;  2KW1 A;  1I04 A;  1VWN B;  2JOZ A;  4PSQ A;  1UYN X;  1VWK B;  2QO5 A;  2E4J A;  2F09 A;  1SWT A;  1TW4 A;  3IA8 A;  3JQO A;  4GGT A;  2VDF A;  1OPB A;  3WYP A;  4BX5 A;  1SY3 A;  4GJV A;  3X00 A;  4MIS A;  3EBK A;  1I9H A;  1SA8 A;  3VG7 A;  3D97 A;  5F6Z A;  1RST B;  1LFO A;  3RDX A;  2R74 A;  5HCC C;  1X8N A;  2C1S A;  3APV A;  3BDR A;  4JO6 A;  4CDF A;  1UYO X;  2P8G A;  5B10 O;  5K67 A;  3NX1 A;  4L1N A;  2LA7 A;  1PBY A;  5DG4 A;  2X32 A;  3P02 A;  4QNI A;  1DZP A;  3V8U A;  2WEX A;  3C77 X;  4O4O A;  3STK A;  3ZUO A;  5IO5 A;  5D8J A;  4BX5 B;  3WZO A;  5L8O A;  2AT0 X;  2A2G A;  4GD9 A;  5D45 A;  1Y55 X;  5LJD A;  1OPA A;  3FR2 A;  1CBQ A;  1QWD A;  3FEP A;  1LEL A;  3ZW1 A;  3HWE A;  4COT A;  2IZD B;  4XMC A;  1U0X A;  1X8Q A;  1KT6 A;  4YBU A;  1JYJ A;  2K23 A;  4LKT A;  3RKG A;  1SWQ A;  2X8T A;  1AVD A;  3EYC A;  1T8V A;  5IRA A;  4Z28 A;  4AZQ A;  1MVG A;  4YCE A;  3STM X;  3FR4 A;  2CAM A;  1A18 A;  2Q39 A;  4GK9 A;  1HMT A;  2JW1 A;  2N93 A;  4YFQ A;  2G78 A;  3CKF A;  5IO7 A;  3P6D A;  3QKG A;  1BSO A;  2Z4I A;  3ZW1 B;  1DV9 A;  1SWP A;  5K68 A;  5HA0 A;  4QGV A;  1E00 A;  3VU1 A;  3MVF A;  1CRB A;  1XCA A;  4ML7 B;  1VYO A;  2L9C A;  1T68 X;  4MVI A;  1KFF A;  4MEE A;  1T0V A;  4U8U N;  3CQR A;  4I60 A;  5HCE C;  5LJK A;  1MX7 A;  3RDQ A;  1LIE A;  4O3X B;  4QGX A;  3T1D A;  3VHI A;  3PP6 A;  2IZI A;  3FEL A;  4I9S A;  2OZQ A;  4AYH A;  4EQA C;  4YFP A;  3VG6 A;  3P6G A;  1Y53 X;  5JD2 A;  3CBS A;  5HBS A;  3UEX A;  4BX7 A;  1K3B A;  2X45 A;  3UAQ A;  3OBL A;  1E2T A;  1WBI A;  1K24 A;  1YWD A;  2NNE A;  3AKM A;  1PEE A;  3VG2 A;  1E02 A;  5IO6 A;  2GTL M;  1MX8 A;  2FR2 A;  2ZAI A;  1O1U A;  2RTA A;  4O3Y A;  3DSZ A;  1W5R A;  1SWB A;  1L6M A;  2OVA A;  1P6P A;  3KZA A;  3KFF A;  2HYS A;  1KZW A;  1ADL A;  4WFV A;  3FW4 A;  2MM3 A;  3BX7 A;  2WQ9 A;  4GDA A;  5KIC A;  1LID A;  3KFH A;  1OBU A;  1S44 A;  1EAL A;  2EU7 X;  3P6F A;  1LIF A;  3HK1 A;  3VHH A;  5EZ2 A;  2WUT A;  1B8E A;  1VYF A;  4IBA A;  5L8N A;  5LJC A;  2OVD A;  3RDM A;  4BQU A;  3LHN A;  3MG5 A;  4ID2 A;  1BLR A;  4O3Z A;  3NQ9 A;  3HWF A;  5JR8 A;  4D6A A;  4QZU A;  1AEL A;  1KQX A;  2CM4 A;  2R73 A;  1GT4 A;  5FEN A;  1SWE A;  1X8U A;  3QQ2 A;  3WJD A;  1Y9T A;  1ICN A;  2L5P A;  4HFO A;  4Z2V A;  1Y52 X;  2ZSC A;  1VWR B;  3BX8 A;  2OF9 A;  1AVE A;  2FT9 A;  3PDF A;  3PPT A;  1O1V A;  4M7M A;  4O9S A;  3UEW A;  1A57 A;  3WYQ A;  1KT3 A;  3S5V A;  5C0N A;  1KT7 A;  1EIO A;  4MVK A;  3U9P C;  4ZHC A;  1GX8 A;  2CBS A;  4KT5 A;  2CM9 A;  1N0S A;  2FHL A;  3HPE A;  5AEO A;  2IZL B;  5IXG A;  1JMX A;  1G5W A;  1PMP A;  4U46 A;  1SRG A;  2KD2 A;  4GE1 A;  1HXL A;  3STN A;  3O2Y A;  3BU1 A;  1NGL A;  2A3F X;  3VE2 A;  3SZJ A;  5HTD A;  1NC9 A;  4L3R A;  3JS1 A;  2OFM X;  3CMP A;  1B4M A;  1SWH A;  4OMW A;  3PH5 A;  4I3B A;  1RAV A;  1HN2 A;  2G79 A;  2W2F A;  1MDC A;  4ES7 A;  4LZU A;  4WHI A;  1CJ5 A;  2AMM X;  2LB6 A;  4TLJ A;  1LCZ A;  5EED A;  2OY7 A;  3ZWE A;  3RE6 A;  1SRF A;  4O4X A;  4A60 A;  4DCB A;  4TKB A;  4ODD A;  3RY2 A;  3LTW A;  2OY5 O;  4AZM A;  2DJF A;  1IKJ A;  4NV7 A;  4ZGU A;  2I5Z O;  2RTF B;  1HBQ A;  2RTC B;  5CE4 A;  1S2P A;  2VFC A;  3CKG A;  3KFI A;  2MWH A;  3WZP A;  1A3Y A;  3L4R A;  2QO6 A;  4FGI B;  3HOE A;  3WJC A;  2Y32 A;  2XKL A;  3FMZ A;  1EPA A;  3P6C A;  3NPO A;  4IB8 A;  4QQ1 A;  3FEN A;  3WJF A;  4AW8 A;  4QRL A;  3SOT A;  3OE3 A;  3SZH A;  1JMZ A;  1ZNL A;  2OFA A;  2OVS A;  4LQZ A;  4CPH B;  1ERB A;  4RUU A;  1VPR A;  3RDO A;  2DM5 A;  2A8G A;  4IB9 A;  1PTS A;  1JIW I;  1GX3 A;  2OL6 O;  4IB7 A;  1I78 A;  4O4S A;  4PJ2 A;  3C78 X;  3FR5 A;  1H91 A;  3NX2 A;  4I3C A;  1SLE B;  5IRU A;  1TVQ A;  2GTL N;  4MIR A;  1RLB E;  1G7N A;  1BBP A;  1X8P A;  2AKQ A;  5FFH A;  1N9Y A;  3F9D A;  4YCH A;  3FA6 A;  4ALB A;  1SWL A;  4BOE A;  4RUN A;  5KHP A;  4TKJ A;  2A0A A;  1MK5 A;  1O8V A;  3WOV A;  3JSQ A;  3AUM O;  4QYP A;  1W4T A;  1ZNH A;  2YMS A;  2QOS C;  5BYP A;  3LV4 A;  2GH7 A;  4OS0 A;  3HWD A;  4INN A;  1A2D A;  1FEL A;  3P6H A;  3EMM A;  3CQN A;  1SWD A;  1HQP A;  1TOW A;  1IKE A;  4GGR A;  2IZF B;  3OJY C;  5F1E A;  2ACO A;  4NLI A;  1PM1 X;  4ZFX A;  3MM0 A;  3S60 A;  2R56 A;  3GAQ A;  4K19 A;  4UU3 A;  4YFR A;  1SWF A;  2GC9 A;  4ZHD A;  1QY2 A;  1OEK A;  4ARH A;  1OBP A;  3D96 A;  5F58 A;  1JZU A;  2QMI A;  4IMN A;  4MVL A;  1KOI A;  1SXU A;  3WJG A;  3ZW0 A;  2LFO A;  2Y3F A;  1AVG I;  1CBI A;  4XMD A;  3RBY A;  4AZO A;  2FLJ A;  5HZ8 A;  4ZCB A;  1HXZ A;  1BWY A;  4DQ3 A;  1RXK A;  5F2B A;  4CK4 A;  1SY2 A;  1STS B;  2G7B A;  2LBA A;  1BM5 A;  4GET A;  2LKK A;  1LIB A;  3FA9 A;  1KQW A;  1KT5 A;  2WPU A;  4GRJ A;  5LJG A;  2IZJ A;  4AZN A;  1KZX A;  2KT4 B;  1IFC A;  5HZ6 A;  4BVM A;  4GU8 A;  1NP4 A;  1SWG A;  1EUO A;  4NYQ A;  1FJ1 E;  1LNM A;  1FEM A;  2IZA A;  5B3M O;  2DJG A;  2FWV A;  3O22 A;  1NBX A;  3D95 A;  4ALO A;  4KC8 A;  2X46 A;  4N7D A;  3KFG A;  4YH0 A;  3ZW0 B;  2OY1 O;  5HCD C;  3WZN A;  1I4U A;  5FAZ A;  4IAW A;  1ACD A;  2OY8 A;  2OF8 A;  3T6F A;  1JV4 A;  4GZV A;  1QG5 A;  4YKO A;  1GM6 A;  3NBX X;  2W2B A;  1SY0 A;  2GTF X;  3B2J A;  4CDC A;  4YBP A;  1EPB A;  4Z2O A;  3FYF A;  3RE5 A;  5B11 O;  4LZV A;  5B27 A;  4ZHH A;  1U18 A;  3B2H A;  4OMX A;  4QZT A;  2C1Q A;  1YUP A;  4NW4 A;  4YGZ A;  4U8U O;  2OFR X;  4A1H A;  1VWA B;  1RSU B;  4GH7 A;  2RD7 C;  4ZJ0 A;  1IJ8 A;  1VWQ B;  4XME A;  3UEU A;  1EII A;  2RCT A;  4FBO A;  4HWM A;  1LF7 A;  1WUB A;  4N7C A;  1BRP A;  2RTL A;  3O19 A;  1ZNK A;  2K62 A;  5DPQ A;  3ZQ3 A;  1JYD A;  3TGC A;  2RTN B;  3TZS A;  3KVN A;  1JJX A;  2RN4 A;  1YP7 A;  2QCB A;  5LJB A;  3NAD A;  2X34 A;  3EW1 A;  4GGZ A;  3HOL A;  4BX7 B;  2RTB B;  4I95 A;  1X89 A;  4TKH A;  2MHD A;  1IIU A;  1AQB A;  1VWJ B;  1N9M A;  1OEJ A;  4YDA A;  3Q6L A;  2JU7 A;  3S26 A;  2F73 A;  5L8I A;  1QQS A;  4EEJ A;  3B2K A;  4Y0P A;  1SWJ A;  3KQ0 A;  5LJE A;  3TGB A;  3FLL A;  2HKD A;  2X56 A;  1XKI A;  1ZNE A;  2M4L A;  3EBW A;  4ORR A;  3RDS A;  1LPJ A;  1BRQ A;  1JJJ A;  1KL4 A;  1NQN A;  4CSB A;  1SRE A;  3PQS A;  4GNY A;  1HBP A;  1Y0G A;  2RTQ B;  2WSJ A;  1GT3 A;  4EFG A;  4ON1 A;  1JBH A;  2ACP X;  4LKP A;  2ASN X;  4C5P A;  2W2A A;  2G5L A;  3N91 A;  5HA1 A;  2A13 A;  2BS5 A;  3ZZV A;  5B2A O;  1SWC A;  1LCW A;  4CV7 A;  4WBK A;  4WFU A;  2JU8 A;  3NQ3 A;  4UU2 A;  3SAO A;  2ANS A;  2AVI A;  4AZP A;  2BLG A;  3WJE A;  5IRW A;  1SY1 A;  1E5P A;  2A5C A;  3EW2 A;  3HWG A;  4OKA A;  3APU A;  1S7D A;  4ZH9 A;  1MEP A;  4QAE A;  3WJB A;  3NQK A;  1QFT A;  3WXQ A;  3HTY A;  4HPD A;  4YGG A;  1ML7 A;  3K3L A;  4O4U A;  5EEE A;  4EXZ A;  5AJB A;  2IFB A;  3BSZ E;  3MBT A;  3Q34 A;  4KCA A;  5D4A A;  5HWZ A;  2FRS A;  3T2W A;  2NND A;  4Y0S A;  2AT3 X;  2FS6 A;  2OVE A;  5CYB A;  1SWR A;  2HLV A;  1GX9 A;  3VG3 A;  3MX7 A;  4TJZ A;  5L3Y A;  4NNT A;  5H9A A;  3ELX A;  2Q4N A;  1R0U A;  1Z24 A;  2OFB A;  3B2I A;  4YMY A;  4HPC A;  4BJ8 A;  3OD9 A;  2IZB A;  2Q2P A;  4HPB A;  3EC5 A;  3APX A;  1ALB A;  3BRN A;  2NP1 A;  4YGH A;  5FQ8 E;  4Z27 A;  1N7Y A;  1ZND A;  1N43 A;  4ORX A;  5KID A;  5B5F A;  1EW3 A;  1LIC A;  2HMB A;  2LBV A;  2FGS A;  4EKV A;  1CBR A;  1W6F A;  3DTQ A;  1GXA A;  4XMF A;  2X8F A;  5HAE A;  3WVM A;  4KC7 A;  3ELZ A;  2QM9 A;  2AL0 X;  2RTH B;  4IB6 A;  4OEL A;  2RTI B;  5K06 A;  2RTR B;  1OEE A;  2YG2 A;  1JJU A;  1E06 A;  1RBP A;  1VWM B;  4I3D A;  3SLJ A;  2HZR A;  2IZH B;  2KTD A;  1KXO A;  2GTL O;  4ZH6 A;  5CHK A;  4M6S A;  1QFV A;  1LDQ A;  4NYR A;  1KT4 A;  5EDC A;  3PED A;  4Y5D A;  3PH6 A;  1SMP I;  4U3Q A;  2WR6 A;  1NQM A;  1YP6 A;  1SWO A;  3NR3 A;  1KL5 A;  4YDB A;  4IAX A;  3ZUI A;  1MUP A;  2BC3 A;  1VWP B;  1VWC B;  2IZG B;  1D3S A;  2Q9S A;  2X4M A;  2XST A;  1HMS A;  3H3I A;  3GE2 A;  4JGL A;  5H9L A;  3RSW A;  1FTP A;  3U0D A;  1IFB A;  4ZR2 A;  1JQP A;  5HTE A;  2X8S A;  3SLT A;  5CSE A;  1YWA A;  2FHN X;  2KTS A;  2RTM A;  1SLF B;  1RXH A;  3UEV A;  3FEK A;  1Y9L A;  2JMB A;  1I05 A;  4XMG A;  5BVT A;  1SWK A;  5LKE A;  1SLD B;  4CDD A;  3VHM A;  3ZW2 A;  1TOU A;  1SWU A;  1VWD B;  2I5V O;  4GNW A;  2C4I A;  4U9C A;  5AQ6 A;  1AB0 A;  2RTE B;  1X71 A;  1UZ2 X;  4R0B A;  2GJ5 A;  1STP A;  4AZR A;  5H9N A;  3SZI A;  1LDO A;  1VWF B;  4HPA A;  2A5B A;  1VWI B;  1STR B;  1SRH A;  2IZC B;  4CDE A;  1HY2 A;  1FE3 A;  5LKF A;  1QAB E;  3VG5 A;  2IZK A;  1BJ7 A;  4IRW A;  2MJI A;  5B5G A;  1BSY A;  1OSP O;  4KII A;  2RA6 A;  5D48 A;  1IW2 A;  3PEC A;  3VPJ E;  2FS7 A;  2RTJ A;  5HZ5 A;  5H8T A;  2CZT A;  4Z6J A;  2AF5 A;  2CZU A;  4NNS A;  4ORW A;  3WZQ A;  3RZY A;  1KGL A;  1VWL B;  1FEN A;  1SRI A;  1ZRY A;  5HZQ A;  1SXX A;  3VG4 A;  1TXL A;  4BCS A;  1ZNG A;  1PBO A;  4OS3 A;  3PQU A;  1DF8 A;  1VWB B;  3IFB A;  4DNE A;  4TNN A;  2G8C O;  1HMR A;  3BS2 A;  3C76 X;  1SWS A;  2Q2M A;  1KL3 A;  4GKC A;  4I9R A;  4ORU A;  4BBO A;  4YKM A;  1HQQ A;  4QYN A;  4CPE A;  3BU9 A;  1VWG B;  1ERX A;  2Y3E A;  3P6E A;  3RDU A;  2OL7 A;  3S5X A; 
#chains in the Genus database with same CATH homology
 4EDE A;  1ICM A;  3FW5 A;  1G74 A;  2JN3 A;  1DF3 A;  1LKE A;  2BT9 A;  1QY0 A;  2ZAG A;  3RBY A;  3FA7 A;  1SXW A;  1U17 A;  4DQ4 A;  2ALL X;  4ZHF A;  4QGW A;  4D6B A;  1X8O A;  1SXY A;  4O3W A;  1EI5 A;  4FBR A;  1URE A;  5H9K A;  4FQB B;  2HZQ A;  2HNX A;  3VE1 A;  1GT1 A;  2FTB A;  1CBS A;  1B0O A;  1GKA A;  2BS6 A;  2AH7 X;  4MVE A;  3VU1 A;  3F6Z B;  1JBH A;  1VYG A;  4IAB A;  1I06 A;  4GDZ A;  2Z4H A;  1DZM A;  1EXS A;  2O62 A;  1FDQ A;  1DZJ A;  2CBR A;  5AJC A;  2WQA E;  4FBV A;  2NNQ A;  2RQ0 A;  5F7G A;  4OS8 A;  5EDB A;  1D2U A;  1B56 A;  3CR6 A;  2QO4 A;  3I17 A;  2POA A;  5HZ9 A;  5LJH A;  1EQD A;  3AKN A;  3CWK A;  4O49 A;  5EPQ A;  4A1Y A;  4KH8 A;  3FA8 A;  1GKA B;  1YWB A;  3P24 A;  3D4R A;  1BEB A;  1DZK A;  4TQ2 A;  1YIV A;  3NP1 A;  3G7X A;  2RCQ A;  1GT5 A;  3APW A;  5D47 A;  5FQ7 E;  2WEW A;  2L68 A;  3U03 A;  3TGA A;  3F8A A;  4ZGF A;  3ZI8 A;  1DC9 A;  5FQ6 E;  4IMO A;  1YWC A;  2WWP A;  4I6S A;  3RWX A;  1G85 A;  2A2U A;  1QY1 A;  2AT5 X;  4NLJ A;  3E3C A;  5F6B A;  5B29 A;  3B2L A;  2JU3 A;  3CBC A;  2FR3 A;  2PY1 A;  4U8U M;  2MO5 A;  1BSQ A;  4ZHG A;  2AT8 X;  3BY0 A;  4XMH A;  1DFV A;  3I0A A;  4ORY A;  4Y0R A;  3WBG A;  2L67 A;  3BLG A;  4Y0Q A;  3EM0 A;  4ORS A;  5BVQ A;  3TF6 A;  4A8Z A;  2BHV A;  1GGL A;  4NP1 A;  1NP1 A;  1OBQ A;  5BVS A;  3FIQ A;  2AT6 X;  2KW1 A;  1I04 A;  4PSQ A;  2JOZ A;  2QO5 A;  2E4J A;  2F09 A;  1TW4 A;  3IA8 A;  3JQO A;  1OPB A;  1SY3 A;  4MIS A;  3EBK A;  1SA8 A;  3VG7 A;  3D97 A;  5F6Z A;  1LFO A;  2R74 A;  5HCC C;  1X8N A;  3APV A;  3BDR A;  2P8G A;  3NX1 A;  4L1N A;  2LA7 A;  5DG4 A;  3P02 A;  4QNI A;  1DZP A;  3V8U A;  2WEX A;  3C77 X;  4O4O A;  3STK A;  3ZUO A;  5IO5 A;  5D8J A;  5L8O A;  2AT0 X;  2A2G A;  5D45 A;  5LJD A;  1OPA A;  3FR2 A;  1CBQ A;  1QWD A;  3FEP A;  3ZW1 A;  3HWE A;  4COT A;  4XMC A;  1U0X A;  1X8Q A;  1KT6 A;  4YBU A;  1JYJ A;  2K23 A;  4LKT A;  3RKG A;  2X8T A;  3EYC A;  1T8V A;  4AZQ A;  1MVG A;  4YCE A;  3STM X;  3FR4 A;  1A18 A;  2Q39 A;  4GK9 A;  1HMT A;  2JW1 A;  2N93 A;  4YFQ A;  2G78 A;  5IO7 A;  3P6D A;  3QKG A;  1BSO A;  2Z4I A;  3ZW1 B;  1DV9 A;  5HA0 A;  4QGV A;  1E00 A;  3MVF A;  1CRB A;  1XCA A;  4ML7 B;  2L9C A;  4MVI A;  1T68 X;  1T0V A;  4U8U N;  3CQR A;  5HCE C;  5LJK A;  1MX7 A;  1LIE A;  4O3X B;  4QGX A;  3T1D A;  3PP6 A;  3FEL A;  4I9S A;  2OZQ A;  4AYH A;  4EQA C;  4YFP A;  3VG6 A;  3P6G A;  3UEX A;  3CBS A;  5HBS A;  2X45 A;  3UAQ A;  3OBL A;  2NNE A;  1YWD A;  1PEE A;  3AKM A;  3VG2 A;  5IO6 A;  1E02 A;  2GTL M;  1MX8 A;  2FR2 A;  2ZAI A;  1O1U A;  4O3Y A;  3DSZ A;  1L6M A;  2OVA A;  1P6P A;  3KZA A;  3KFF A;  2HYS A;  1KZW A;  1ADL A;  4WFV A;  3FW4 A;  2MM3 A;  3BX7 A;  2WQ9 A;  5KIC A;  1LID A;  3KFH A;  1OBU A;  1S44 A;  1EAL A;  2EU7 X;  3P6F A;  1LIF A;  3HK1 A;  5EZ2 A;  2WUT A;  1B8E A;  1VYF A;  4IBA A;  5L8N A;  5LJC A;  2OVD A;  4BQU A;  3LHN A;  4ID2 A;  1BLR A;  4O3Z A;  3NQ9 A;  3HWF A;  5JR8 A;  4D6A A;  4QZU A;  1KQX A;  2CM4 A;  2R73 A;  1GT4 A;  5FEN A;  1X8U A;  3WJD A;  1Y9T A;  1ICN A;  2L5P A;  4HFO A;  3BX8 A;  4O9S A;  4M7M A;  2FT9 A;  3PPT A;  3UEW A;  1O1V A;  5KHP A;  1A57 A;  1EIO A;  5C0N A;  1KT3 A;  3S5V A;  1KT7 A;  4MVK A;  3U9P C;  4ZHC A;  1GX8 A;  2CBS A;  4KT5 A;  2CM9 A;  1N0S A;  5AEO A;  1G5W A;  1PMP A;  2KD2 A;  4GE1 A;  3STN A;  3O2Y A;  3BU1 A;  1NGL A;  2A3F X;  3VE2 A;  5HTD A;  4L3R A;  3JS1 A;  2OFM X;  3CMP A;  1B4M A;  4OMW A;  3PH5 A;  4I3B A;  1HN2 A;  2G79 A;  2W2F A;  1MDC A;  4ES7 A;  4LZU A;  4WHI A;  1CJ5 A;  2AMM X;  2LB6 A;  4TLJ A;  5EED A;  3ZWE A;  4O4X A;  4A60 A;  4TKB A;  4ODD A;  4AZM A;  4ZGU A;  1IKJ A;  1HBQ A;  5CE4 A;  1S2P A;  3KFI A;  2MWH A;  1A3Y A;  3L4R A;  2QO6 A;  4FGI B;  3HOE A;  3WJC A;  2XKL A;  3FMZ A;  1EPA A;  3P6C A;  3NPO A;  4IB8 A;  4QQ1 A;  3FEN A;  3WJF A;  4AW8 A;  4QRL A;  3SOT A;  3OE3 A;  2OVS A;  1ZNL A;  4LQZ A;  1ERB A;  4RUU A;  1VPR A;  5LJB A;  2DM5 A;  4IB9 A;  1JJJ A;  4IB7 A;  1JIW I;  4PJ2 A;  4O4S A;  3C78 X;  3FR5 A;  1H91 A;  3NX2 A;  4I3C A;  1TVQ A;  2GTL N;  4MIR A;  1RLB E;  1G7N A;  1BBP A;  1X8P A;  2AKQ A;  5FFH A;  4ALB A;  3F9D A;  4YCH A;  3FA6 A;  4BOE A;  4RUN A;  4TKJ A;  2A0A A;  1O8V A;  3WOV A;  3JSQ A;  4QYP A;  2YMS A;  1ZNH A;  2QOS C;  5BYP A;  3LV4 A;  4OS0 A;  3HWD A;  4INN A;  1A2D A;  1FEL A;  3P6H A;  3EMM A;  3CQN A;  1HQP A;  1TOW A;  1IKE A;  3OJY C;  5F1E A;  2ACO A;  4NLI A;  1PM1 X;  4ZFX A;  3S60 A;  2R56 A;  3GAQ A;  4K19 A;  4UU3 A;  4YFR A;  2GC9 A;  4ZHD A;  1QY2 A;  1OEK A;  4ARH A;  1OBP A;  3D96 A;  5F58 A;  1JZU A;  2QMI A;  4IMN A;  4MVL A;  1KOI A;  1SXU A;  3WJG A;  3ZW0 A;  2LFO A;  1AVG I;  1CBI A;  4XMD A;  4AZO A;  2FLJ A;  5HZ8 A;  4ZCB A;  1BWY A;  4DQ3 A;  4CK4 A;  1BM5 A;  1SY2 A;  2G7B A;  2LBA A;  4GET A;  2LKK A;  1LIB A;  3FA9 A;  1KQW A;  1KT5 A;  5LJG A;  4GRJ A;  4AZN A;  1KZX A;  2KT4 B;  1IFC A;  5HZ6 A;  4BVM A;  4GU8 A;  1NP4 A;  4NYQ A;  1EUO A;  1LNM A;  1FEM A;  2FWV A;  3O22 A;  3D95 A;  4ALO A;  4KC8 A;  2X46 A;  4N7D A;  3KFG A;  4YH0 A;  3ZW0 B;  5HCD C;  1I4U A;  5FAZ A;  4IAW A;  1ACD A;  1JV4 A;  4GZV A;  1QG5 A;  4YKO A;  1GM6 A;  3NBX X;  2W2B A;  1SY0 A;  2GTF X;  3B2J A;  4YBP A;  1EPB A;  3FYF A;  4LZV A;  5B27 A;  4ZHH A;  1U18 A;  3B2H A;  4OMX A;  4QZT A;  1AEL A;  1YUP A;  4NW4 A;  4YGZ A;  4U8U O;  2OFR X;  4A1H A;  4GH7 A;  2RD7 C;  4ZJ0 A;  4XME A;  3UEU A;  1EII A;  2RCT A;  4FBO A;  4HWM A;  1LF7 A;  4N7C A;  1BRP A;  3O19 A;  5DPQ A;  1ZNK A;  2K62 A;  3ZQ3 A;  1JYD A;  3TGC A;  3TZS A;  1JJX A;  2RN4 A;  1YP7 A;  3NAD A;  3HOL A;  4TKH A;  4I95 A;  1X89 A;  2MHD A;  1IIU A;  1AQB A;  1OEJ A;  4YDA A;  3Q6L A;  2JU7 A;  3S26 A;  2F73 A;  5L8I A;  1QQS A;  4EEJ A;  3B2K A;  4Y0P A;  3KQ0 A;  5LJE A;  3TGB A;  3FLL A;  1XKI A;  1ZNE A;  2M4L A;  3EBW A;  4ORR A;  1LPJ A;  1BRQ A;  4CSB A;  3PQS A;  4GNY A;  1HBP A;  2WSJ A;  1GT3 A;  4EFG A;  4ON1 A;  2ACP X;  4LKP A;  2ASN X;  2W2A A;  5HA1 A;  3N91 A;  2A13 A;  2BS5 A;  3ZZV A;  4CV7 A;  4WBK A;  4WFU A;  2JU8 A;  3NQ3 A;  4UU2 A;  3SAO A;  2ANS A;  4AZP A;  2BLG A;  3WJE A;  1SY1 A;  1E5P A;  3HWG A;  4ZH9 A;  3APU A;  1S7D A;  3WXQ A;  3ZUI A;  4QAE A;  3WJB A;  3NQK A;  1QFT A;  3HTY A;  4HPD A;  4YGG A;  1ML7 A;  3K3L A;  4O4U A;  5EEE A;  4EXZ A;  5AJB A;  2IFB A;  3BSZ E;  3MBT A;  4KCA A;  5D4A A;  5HWZ A;  2FRS A;  2NND A;  4Y0S A;  2AT3 X;  2FS6 A;  2OVE A;  5CYB A;  2HLV A;  1GX9 A;  3VG3 A;  3MX7 A;  4TJZ A;  4NNT A;  5H9A A;  3ELX A;  2Q4N A;  1R0U A;  1Z24 A;  3B2I A;  4YMY A;  4HPC A;  3OD9 A;  4HPB A;  2Q2P A;  3APX A;  1ALB A;  3BRN A;  2NP1 A;  4YGH A;  5FQ8 E;  1ZND A;  4ORX A;  5KID A;  1EW3 A;  1LIC A;  2HMB A;  2LBV A;  1CBR A;  3DTQ A;  1GXA A;  4XMF A;  2X8F A;  5HAE A;  3WVM A;  4KC7 A;  3ELZ A;  2QM9 A;  2AL0 X;  4IB6 A;  5K06 A;  1OEE A;  2YG2 A;  1E06 A;  1RBP A;  4I3D A;  2HZR A;  2KTD A;  1KXO A;  2GTL O;  4ZH6 A;  4M6S A;  1QFV A;  4NYR A;  1KT4 A;  5EDC A;  3PED A;  3PH6 A;  1SMP I;  4U3Q A;  2WR6 A;  1YP6 A;  3NR3 A;  4YDB A;  4IAX A;  1MUP A;  2XST A;  2Q9S A;  1D3S A;  3H3I A;  5H9L A;  3RSW A;  1HMS A;  4JGL A;  3GE2 A;  3U0D A;  1FTP A;  1IFB A;  4ZR2 A;  5HTE A;  2X8S A;  1YWA A;  2KTS A;  3UEV A;  3FEK A;  1Y9L A;  2JMB A;  1I05 A;  4XMG A;  5BVT A;  5LKE A;  3ZW2 A;  1TOU A;  4GNW A;  4U9C A;  5AQ6 A;  1AB0 A;  1X71 A;  1UZ2 X;  4R0B A;  2GJ5 A;  4AZR A;  5H9N A;  4HPA A;  1FE3 A;  5LKF A;  1QAB E;  3VG5 A;  1BJ7 A;  2MJI A;  1BSY A;  4KII A;  2RA6 A;  5D48 A;  1IW2 A;  3PEC A;  3VPJ E;  2FS7 A;  5HZ5 A;  5H8T A;  2CZT A;  4ORW A;  2CZU A;  4NNS A;  1KGL A;  3RZY A;  1ZRY A;  1FEN A;  5HZQ A;  1SXX A;  3VG4 A;  1TXL A;  1ZNG A;  1PBO A;  4OS3 A;  3PQU A;  3IFB A;  4TNN A;  1HMR A;  3BS2 A;  3C76 X;  2Q2M A;  4GKC A;  4I9R A;  4ORU A;  4YKM A;  4QYN A;  3BU9 A;  1ERX A;  3P6E A;  3S5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...