1IFCA

Refinement of the structure of recombinant rat intestinal fatty acid-binding apoprotein at 1.2 angstroms resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
b'AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTESTINAL FATTY ACID BINDING PROTEIN
publication title Refinement of the structure of recombinant rat intestinal fatty acid-binding apoprotein at 1.2-A resolution.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Lipid binding protein
total genus 35
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 1991-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1ifcA00
3F8AA 1E02A 4EFGA 2AH7X 4ZHDA 2A0AA 4Y0RA 1KOIA 2JN3A 1CBRA 1SY2A 1MUPA 3EBKA 3FW5A 5F6ZA 1EIOA 3T1DA 3WXQA 1KT3A 1OEJA 2WWPA 5EEDA 3P6GA 5FFHA 1LKEA 1KQXA 4YFRA 1KT5A 3AKMA 4QZUA 1SY0A 3UEWA 3P6FA 2O62A 1B8EA 1D2UA 4GRJA 4YGHA 5H9NA 1LIEA 3P6CA 5DPQA 3CMPA 2R73A 2L67A 1OPAA 2WUTA 2RQ0A 1I06A 4EEJA 3FA6A 4ARHA 1X8PA 2KTDA 3P6HA 4Y0PA 5L8NA 3JSQA 2K23A 4ZGUA 1BWYA 2Q2PA 2GTFX 1BSQA 1U18A 3MVFA 2LB6A 1CBQA 1KT6A 4TNNA 4IB6A 3TGBA 3O22A 3L4RA 5BVTA 3KFIA 3PPTA 4KIIA 5HAEA 3BLGA 4DQ3A 1GX8A 4HPAA 4NYRA 4HFOA 1GXAA 1P6PA 1KGLA 4EDEA 1YIVA 3OJYC 3BRNA 2OZQA 1QFVA 4ZHHA 1DFVA 2A2GA 1ML7A 4A8ZA 3P6EA 4TKBA 3TGCA 1R0UA 5LJKA 2OVEA 1AQBA 2G7BA 1X8QA 1RBPA 1X8NA 3APWA 4NLJA 4QZTA 5F1EA 1TOWA 4RUUA 2AT0X 1JV4A 4XMDA 1IFCA 3KZAA 5F6BA 2X46A 3Q6LA 5FAZA 3HWGA 1FELA 1ICMA 2Q4NA 5HWZA 1S2PA 3NR3A 3BY0A 4ZFXA 2QO5A 1IFBA 4YGZA 3WJFA 1MVGA 3B2HA 2Q9SA 1GGLA 2POAA 4LKPA 4ZJ0A 1EW3A 5IO5A 3PEDA 1G85A 1ZNKA 5H9LA 4QAEA 1OBUA 2K62A 4GH7A 4MVKA 2AT5X 2G78A 1ERXA 3ZUOA 2G79A 3D95A 3FR5A 2IFBA 1QY2A 4YFPA 2CM9A 3U03A 5H9AA 1VPRA 2FR2A 3BS2A 4M7MA 5F7GA 4ZHCA 1DV9A 1CJ5A 4A1HA 1PM1X 4A1YA 1JBHA 1EALA 1GT3A 4ORYA 5EDCA 4QGXA 3ZQ3A 2FT9A 4ORXA 2AKQA 1EPAA 1JYJA 1EIIA 1X89A 4QGWA 4Y0QA 2CZUA 1QY1A 1OBPA 1YWAA 1MX8A 3B2JA 1DZMA 5HBSA 3RSWA 4GNYA 3FEKA 4LKTA 4ALOA 1GT4A 1G74A 3WVMA 4IAXA 1G5WA 1QY0A 2ALLX 2AT8X 5KIDA 1KT7A 2RCTA 3RZYA 1QQSA 4OS3A 3WJCA 4ORRA 3HWEA 1G7NA 1ZNDA 4K19A 3EYCA 3TZSA 5D48A 5LJEA 2HZQA 1I05A 3KQ0A 4AZPA 5AQ6A 1BEBA 3VG3A 4IB7A 2NP1A 4YKMA 2ACOA 5HCEC 5HZ6A 4YKOA 4DQ4A 4ZHGA 1YWCA 2YG2A 4OMXA 4AZMA 1LICA 4N7DA 2N93A 3FA8A 2A13A 1X71A 1U0XA 4O9SA 1PMPA 1OPBA 2JU3A 4D6AA 4IBAA 5HA1A 1JJXA 1ERBA 1NP4A 1SXYA 3O19A 4MVIA 1CRBA 4TJZA 2RA6A 4HPBA 4XMGA 2CZTA 5KHPA 3FR2A 2AT3X 1FEMA 3NX1A 1YP6A 2WQ9A 4WBKA 1B56A 1HN2A 1SXXA 1BSYA 1GX9A 2AL0X 2KT4B 4R0BA 4WFUA 3B2LA 1PEEA 2HZRA 2X45A 3HWDA 1JZUA 1LPJA 4LZVA 4YDBA 1NGLA 5K06A 4NP1A 4EXZA 2HNXA 3HWFA 3MBTA 1A18A 2GJ5A 4YBPA 3TGAA 3APUA 1SA8A 5IO7A 1AELA 1IKJA 3C76X 1BBPA 2HYSA 5DG4A 1JYDA 4YGGA 5LJBA 3CBSA 1ACDA 1BLRA 1ZNLA 5H9KA 3PH6A 2FR3A 1E00A 1QFTA 4CK4A 1QABE 3WJGA 4OMWA 1HMSA 1SY3A 5D4AA 1UREA 1NP1A 2LKKA 4WFVA 1KXOA 3CR6A 1Z24A 2QO6A 3BX8A 3D96A 2AT6X 1U17A 2OFRX 3CWKA 3VG5A 5H8TA 3CQNA 4AZOA 4I9SA 1VYFA 4OS0A 1JJJA 1O8VA 2L5PA 2DM5A 1KT4A 4XMCA 2A2UA 1LIFA 2AMMX 4D6BA 3ELZA 3WJDA 2FS7A 4UU3A 1HMTA 2XSTA 4ORWA 3NP1A 1PBOA 2WEWA 3WJEA 3WJBA 4GKCA 1AB0A 2JOZA 3APXA 4I3CA 4M6SA 3KFHA 1BJ7A 1YP7A 2RCQA 1DZJA 1S7DA 1DZKA 4YBUA 4YCEA 1FTPA 3UEXA 5L8OA 4NLIA 2GC9A 2OVDA 1QWDA 2ASNX 1HMRA 1ADLA 1FE3A 2A3FX 2BLGA 5HZQA 5EDBA 1ZNGA 4LZUA 4YDAA 3FR4A 1BM5A 3D97A 2OFMX 4A60A 3STKA 1T0VA 1ALBA 3QKGA 4HPCA 3FMZA 3S26A 5B29A 2QM9A 3FENA 1MX7A 2E4JA 1FDQA 2W2AA 4HPDA 5BVSA 1A2DA 3SAOA 1OEKA 2XKLA 2MM3A 5LJGA 1RLBE 4PSQA 4IAWA 2R56A 3JS1A 1DZPA 3U0DA 1EPBA 1LF7A 5HTEA 4ODDA 1LIBA 3ELXA 3BX7A 4AZRA 4IMOA 5BVQA 5FENA 1IKEA 4ZR2A 4QGVA 4YFQA 3I17A 3EBWA 1GT1A 2L68A 1TXLA 4NNTA 3PECA 3EM0A 1ZRYA 1N0SA 3NX2A 5KICA 1IIUA 4QYPA 4NYQA 2FRSA 4ES7A 2QOSC 1B4MA 5EEEA 2NNEA 5JR8A 3IFBA 4I9RA 1KQWA 1FENA 1YWDA 1E5PA 4ZCBA 3PP6A 1IW2A 1UZ2X 1A57A 1HBQA 3B2KA 4AZQA 1TOUA 1EUOA 5EZ2A 2FWVA 2CBRA 2LBAA 3O2YA 4UU2A 3STMX 3U9PC 1CBSA 1HQPA 3FW4A 2Q39A 3WBGA 1T8VA 3I0AA 3VG2A 1SXWA 1BSOA 5HTDA 1YUPA 1BRPA 1CBIA 4YCHA 3FEPA 5L8IA 4ZH9A 1EXSA 1BRQA 2WR6A 1DF3A 4NNSA 2HMBA 3NPOA 5D8JA 2WEXA 2FS6A 3DSZA 3G7XA 1LFOA 5IO6A 4TLJA 4BVMA 5LKFA 1LIDA 5D45A 2MJIA 4GE1A 4TKHA 1HBPA 4YH0A 2R74A 3C78X 1TW4A 4TQ2A 4ZHFA 4MVLA 3FA7A 4ORSA 1KZXA 4XMFA 1OEEA 3FLLA 4GNWA 3CBCA 1I04A 5F58A 3IA8A 5LJHA 1GT5A 3KFFA 3ZUIA 1LNMA 4OS8A 5HZ9A 2JU7A 3P6DA 2CM4A 3STNA 1GM6A 1I4UA 2PY1A 1A3YA 1TVQA 2CBSA 3F9DA 2QO4A 3BSZE 4GETA 5D47A 4BQUA 3HK1A 5HA0A 5HZ5A 1L6MA 1ZNEA 3APVA 5LKEA 2ACPX 2ANSA 1OBQA 1XKIA 1H91A 3FELA 2WQAE 2LFOA 4QYNA 2JU8A 3DTQA 2F73A 3FIQA 3K3LA 4IB8A 3VG4A 4AZNA 1XCAA 4TKJA 3NQ9A 3TF6A 2Q2MA 5B27A 2NNDA 4ALBA 1X8OA 3EMMA 5HCDC 2FTBA 1S44A 1D3SA 3NQ3A 3VG7A 4ORUA 1B0OA 2NNQA 1SY1A 3AKNA 4I3BA 3UEVA 1E06A 3CQRA 1T68X 1YWBA 3UEUA 4XMHA 1X8UA 2W2FA 3NADA 2HLVA 2LBVA 1EQDA 3GAQA 4AW8A 2WSJA 4ZH6A 1KZWA 5LJDA 1QG5A 1VYGA 1GKAB 4BOEA 4IMNA 3BDRA 3FA9A 2P8GA 2FLJA 5C0NA 2L9CA 4YMYA 5LJCA 5HCCC 2EU7X 4I3DA 4Y0SA 1DC9A 4XMEA 3KFGA 5CE4A 5HZ8A 4RUNA 1ICNA 1ZNHA 3BU9A 4IB9A 1MDCA 1O1VA 3BU1A 3VG6A 2RD7C 3PH5A 1SXUA 4N7CA 4AYHA 5EPQA 1O1UA 2W2BA 1GKAA 2OVAA 1AVGI 3B2IA 2MO5A 3C77X
chains in the Genus database with same CATH superfamily
3F8AA 1E02A 4EFGA 5FQ8E 2C1SA 2AH7X 4ZHDA 1I78A 2A0AA 4Y0RA 1KOIA 1VWKB 2JN3A 1CBRA 4DCBA 1SY2A 1MUPA 3EBKA 3FW5A 5F6ZA 2X55A 4CPHA 1EIOA 1WBIA 3T1DA 4O4UA 1LUQA 3WXQA 1KT3A 1OEJA 2WWPA 3VPJE 5EEDA 3P6GA 5FFHA 1MEPA 1LKEA 4BGFA 1DF8A 1KL4A 1KQXA 3RDUA 4YFRA 1KT5A 3AKMA 3ZW0B 4QZUA 3T6FA 1GX3A 1SY0A 4FBOA 4GK9A 4CPIA 2Z4HA 2BT9A 5CHKA 1VWDB 3SLOA 3UEWA 3P6FA 1STPA 1B8EA 1D2UA 2O62A 4GRJA 4YGHA 5H9NA 3SZHA 4YVBA 1LIEA 3P6CA 4NW4A 3CMPA 5DPQA 2R73A 2IZCB 1AVEA 2L67A 1OPAA 2WUTA 2RQ0A 2OF8A 1I06A 4EEJA 1SREA 3FA6A 2OF9A 1JMXA 1NQMA 4ARHA 3FDCA 1X8PA 2KTDA 3P6HA 4Y0PA 5L8NA 3JSQA 2K23A 3ZW0A 1SWSA 2Y3EA 3RDQA 2GTFX 2Q2PA 1BSQA 1U18A 3H3IA 2LB6A 3MVFA 3ZWEA 1CBQA 1KT6A 2OL8O 2RTJA 1SWUA 4TNNA 4IB6A 2GH7A 2OFBA 2IZBA 3O22A 1SWLA 4O4SA 3L4RA 4YH0A 3RDXA 1VWOB 5BVTA 3KFIA 3PPTA 4DNEA 4KIIA 1VWHB 5HAEA 4QRLA 3BLGA 4DQ3A 5B5FA 4ZGFA 1GX8A 4HPAA 4NYRA 4HFOA 1GXAA 1P6PA 2IZEB 1KGLA 4EDEA 1YIVA 3OJYC 3BRNA 2OZQA 2A8GA 1QFVA 4JNJA 4ZHHA 1DFVA 2A2GA 1ML7A 5FQ6E 4A8ZA 3P6EA 4TKBA 3TGCA 1R0UA 4NV8A 5LJKA 2OVEA 1AQBA 2RTCB 2G7BA 1X8QA 1RBPA 1X8NA 3OE3A 3APWA 5K68A 4NLJA 1N9YA 3FYFA 2IZAA 4QZTA 1TOWA 1SWJA 2AT0X 4RUUA 1JV4A 5F1EA 4BX5B 1K24A 4XMDA 1SWRA 1IFCA 1SLGB 3KZAA 5B2AO 3HPEA 2X46A 3Q6LA 5F6BA 5FAZA 3HWGA 1FELA 1ICMA 2Q4NA 5HWZA 1S2PA 3NR3A 3RY2A 3BY0A 1SWKA 2ZSCA 4ZFXA 1RXHA 4WHIA 2QO5A 3T6LA 5BYPA 3PK2A 1IFBA 2GTLM 2RTIB 3QQ2A 4YGZA 3WJFA 1MVGA 3B2HA 4CDEA 1NQNA 2Q9SA 1GGLA 2POAA 4LKPA 4ZJ0A 1EW3A 5IO5A 5IXGA 3F6ZB 3PEDA 2UZ2A 1G85A 4L3RA 1RSUB 1ZNKA 5H9LA 4QAEA 1OBUA 2K62A 4GH7A 4MVKA 2C1QA 2AT5X 2G78A 1ERXA 4GJSA 3ZUOA 3RE6A 4B55A 2G79A 3D95A 3FR5A 4GDAA 1VWFB 1QY2A 2I5ZO 2IFBA 3OBLA 4YFPA 2CM9A 3U03A 5H9AA 1VPRA 2FR2A 2GTLN 3BS2A 4M7MA 3P02A 5F7GA 2FHNX 3MX7A 4MEEA 4ZHCA 1DV9A 2RTNB 1CJ5A 4CV7A 4I60A 4A1HA 1PM1X 4A1YA 3VHIA 1JBHA 1EALA 4GUZA 1GT3A 2BSZA 4ORYA 4QGXA 5EDCA 3ZI8A 3ZQ3A 2FT9A 1Y53X 4ORXA 2AKQA 2CAMA 3NBXX 3RY1A 1EPAA 1JYJA 2JMBA 1X89A 4COTA 1EIIA 4QGWA 4U8UM 4Y0QA 2CZUA 3RKGA 1QY1A 4KCAA 4KC7A 1OBPA 1YWAA 1MX8A 5IRUA 3B2JA 3RE5A 5HZ6A 1DZMA 5HBSA 3RSWA 4GNYA 3FEKA 4LKTA 4ALOA 3X00A 4I95A 1GT4A 1G74A 1SWTA 3TGBA 3PQSA 2MHDA 3WVMA 4IAXA 1G5WA 1QY0A 2ALLX 2AT8X 5KIDA 1KT7A 1Y9LA 2QOMA 1W4TA 4O3ZA 3VU1A 2RCTA 3RZYA 1QQSA 4GD9A 4OS3A 2RTPB 4ORRA 3HWEA 1G7NA 1ZNDA 4K19A 3EYCA 3WJCA 3TZSA 4INNA 5D48A 5LJEA 4U8UN 2HZQA 1I05A 3RDMA 2X56A 3KQ0A 2IZLB 4AZPA 4Z2OA 5AQ6A 4CPEA 1BEBA 2OY8A 3VG3A 4IB7A 1RAVA 2NP1A 4YKMA 2ACOA 2OL7A 4QQ1A 2IZJA 4YKOA 5HCEC 1SWQA 2RTAA 4CPFA 4DQ4A 1YWCA 1SLEB 1JQPA 2YG2A 4OMXA 1LICA 1N43A 2A5BA 2FKGA 4I6SA 3SLTA 4N7DA 3EC5A 1KL3A 4Y5DA 2N93A 1IJ8A 3FA8A 2A13A 2X8FA 1X71A 3EW1A 1U0XA 1KFFA 4O9SA 1PMPA 1LCWA 1OPBA 1UYNX 2JU3A 4D6AA 4IBAA 5HA1A 2YMSA 1ERBA 1NP4A 1SXYA 3O19A 4PJ2A 2FKJA 4MVIA 1JJXA 3SOTA 1CRBA 4TJZA 2RA6A 4HPBA 4XMGA 2CZTA 5KHPA 3FR2A 4KH8A 2AT3X 1FJ1E 1FEMA 1SWPA 3NX1A 1YP6A 2WQ9A 1SWGA 4WBKA 1B56A 1HN2A 2X34A 1SXXA 1BSYA 1STSB 1GX9A 2AL0X 2KT4B 4R0BA 3ZW2A 4WFUA 3B2LA 1PEEA 2HZRA 4Z2PA 2X45A 2LA7A 3HWDA 1JZUA 1LPJA 2BC3A 1JIWI 3UAQA 4LZVA 4YDBA 1NGLA 5K06A 4NP1A 4Z28A 1VWAB 2DJFA 2HNXA 2IZHB 2RTKA 3HWFA 5AJBA 3MBTA 4EXZA 4GDZA 1A18A 2GJ5A 4YBPA 2VDFA 3TGAA 3APUA 1EI5A 1SA8A 1SWCA 2KTSA 3HTYA 5B3MO 3FIDA 3ZW1B 5IO7A 1IKJA 3C76X 3MG5A 1BBPA 2HYSA 5DG4A 3VGWA 1VWEB 4O3YA 1JYDA 2Y32A 1SRJA 4YGGA 5LJBA 3CBSA 4JHQA 1ACDA 2C4IA 1BLRA 1ZNLA 5H9KA 4BX7B 1LCZA 3RBYA 3PH6A 4GGRA 2OVSA 4OELA 2FR3A 4Y59A 1E00A 1QFTA 1SMPI 2RTHB 4CK4A 5L3YA 1QABE 3WJGA 1LCVA 1NDJA 1HMSA 4OMWA 1SY3A 2IZFB 5D4AA 4Z27A 1UREA 1NP1A 2LKKA 2WPUA 1SWEA 2RTEB 4WFVA 1KXOA 2X32A 3CR6A 1Z24A 2QO6A 2VFBA 5F2BA 3BX8A 3D96A 4O4OA 2AT6X 1U17A 2OFRX 3CWKA 3VG5A 3ZW1A 5H8TA 3CQNA 4AZOA 4I9SA 1VYFA 2OY1O 4OS0A 1JJJA 1O8VA 2L5PA 1HY2A 2DM5A 2RTQB 2HKDA 1KT4A 4XMCA 2A2UA 3SZJA 3Q34A 1LIFA 2AMMX 4MISA 3ELZA 4BX7A 4D6BA 3WJDA 2FS7A 4UU3A 2FHLA 2GTLO 1HMTA 2XSTA 3LV4A 4ORWA 1VWGB 2RTBB 3NP1A 1PBOA 2OYBO 1HXZA 2WEWA 1SRFA 3WJEA 3WYQA 3WJBA 1VWLB 4GKCA 3T2XA 1AB0A 2F09A 2MF6A 2KD2A 4U9CA 1BWYA 4OKAA 3WZPA 2JOZA 1RXKA 3APXA 4I3CA 4M6SA 3P24A 3KFHA 1BJ7A 3LHNA 4BX5A 2F01A 1STRB 1YP7A 1RXJA 3S60A 2RCQA 3RDSA 3AEHA 1DZJA 2RTDB 1S7DA 4ID2A 1DZKA 1RSTB 1SLFB 4YBUA 4YCEA 2OFAA 4BBOA 1FTPA 3UEXA 5L8OA 4NLIA 2GC9A 2OVDA 1QWDA 2ASNX 3T2WA 4LQZA 1HMRA 1UYOX 1ADLA 1FE3A 1N7YA 1VWJB 2A3FX 2BLGA 5HZQA 5EDBA 2DJGA 1OSPO 1ZNGA 2A5CA 4LZUA 4YDAA 2BS6A 2G8CO 3CKGA 3FR4A 2OY5O 1BM5A 1HXLA 4EKVA 3D97A 4HWMA 1JJUA 1SLDB 4FBRA 5AEOA 2OFMX 4U3QA 5CYBA 1E2TA 3VHHA 4JGLA 4A60A 1SWNA 3STKA 1LDOA 1W5RA 4BJ8A 1T0VA 1ALBA 3QKGA 4HPCA 1WUBA 3FMZA 2RTOB 2QM9A 4L1NA 3S26A 2FGSA 3FENA 1MX7A 2E4JA 5B29A 1FDQA 4ZHGA 2PI3O 2W2AA 4HPDA 5BVSA 2ZAIA 1A2DA 3SAOA 1OEKA 5B10O 2XKLA 2MM3A 1SWFA 5LJGA 1RLBE 4PSQA 4C5PA 4IAWA 2IZIA 2R56A 3JS1A 1DZPA 4CDCA 3U0DA 1EPBA 1LF7A 1VWPB 3HOLA 4ODDA 5B11O 5HTEA 1LIBA 4O3WA 1PBYA 4CPHB 4IRWA 3ELXA 3BX7A 3E3CA 4AZRA 1LDQA 4IMOA 5BVQA 5FENA 4NV7A 1IKEA 4ZR2A 3ZZVA 4YFQA 4QGVA 3I17A 4FBVA 5CSEA 3EBWA 1GT1A 2L68A 1TXLA 4NNTA 3PECA 3EM0A 1ZRYA 1N0SA 3SZIA 3NX2A 4GZVA 1SWDA 3JQOA 5KICA 3EW2A 2X8TA 1MM9A 4FQBB 1IIUA 4QYPA 1VWNB 4NYQA 3AUMO 3VE2A 2FRSA 4ES7A 3WZNA 2QOSC 1B4MA 5EEEA 2NNEA 5JR8A 3IFBA 1SRGA 2AF5A 4I9RA 2RTGB 3RWXA 1KQWA 1FENA 1YWDA 3HOEA 1E5PA 4ZCBA 3PP6A 1IW2A 1UZ2X 2ZAGA 4GU8A 4O49A 4Z2VA 1A57A 1HBQA 2RTFB 3B2KA 1TOUA 1EUOA 5EZ2A 4AZQA 2FWVA 3PQUA 2CBRA 2LBAA 3O2YA 4UU2A 3S5VA 3STMX 2RTLA 3U9PC 1CBSA 1HQPA 3FW4A 1VWQB 2Q39A 3WBGA 1VWMB 1T8VA 1LELA 1VWCB 1SWBA 3I0AA 1SXWA 3VG2A 1BSOA 5HTDA 1YUPA 1BRPA 1CBIA 4YCHA 3FEPA 5L8IA 4ZH9A 2RTMA 1EXSA 1BRQA 4MVEA 2WR6A 1DF3A 3WOVA 4NNSA 2Y3FA 4CDDA 4MIRA 2HMBA 1N4JA 3NPOA 3D9WA 2M4LA 5D8JA 2WEXA 2FS6A 3DSZA 3G7XA 1LFOA 1SRIA 1MK5A 5IO6A 2I5VO 4TLJA 1JMZA 3WZQA 1HQQA 1AVDA 4BVMA 5LKFA 4JO6A 1LIDA 5D45A 1Y55X 2MJIA 5JD2A 4KC8A 5B5GA 1W6FA 4GE1A 1HBPA 4TKHA 2R74A 3C78X 2AVIA 3CKFA 1TW4A 4O3XB 4TQ2A 4MVLA 3FA7A 4ZHFA 2RTRB 4ORSA 4FGIB 1KZXA 3WYPA 4XMFA 1OEEA 3FLLA 1PTSA 3VHMA 1Y0GA 4GNWA 3CBCA 1I04A 1Y52X 3LTWA 5F58A 3IA8A 5IRAA 5LJHA 1VWBB 1GT5A 3KFFA 3ZUIA 3VE1A 5K67A 1LNMA 5AJCA 4OS8A 5HZ9A 2IZGB 2JU7A 2IZKA 3P6DA 2CM4A 1KL5A 1GM6A 1I4UA 2PY1A 3KVNA 4GGZA 3N91A 3STNA 1A3YA 2RN4A 3MM0A 1TVQA 1SWHA 1AELA 2CBSA 3F9DA 2QO4A 3BSZE 4GETA 4GJVA 5D47A 4BQUA 3HK1A 5HA0A 2MWHA 1L6MA 1ZNEA 3APVA 5HZ5A 5LKEA 2ACPX 2ANSA 1OBQA 1XKIA 1H91A 3FELA 2WQAE 2LFOA 4QYNA 2JU8A 3DTQA 2F73A 1SWOA 3FIQA 3K3LA 4IB8A 1VWIB 3VG4A 4AZNA 4BCSA 1XCAA 4TKJA 2VFCA 3NQ9A 2G5LA 2BHVA 3TF6A 2Q2MA 1NBXA 5B27A 2NNDA 4ALBA 1X8OA 3EMMA 5HCDC 2FTBA 1S44A 1D3SA 3NQ3A 4AZMA 3VG7A 1MOYA 4ORUA 2JGSA 1B0OA 3OD9A 3RDOA 2NNQA 1SY1A 3SLJA 3PDFA 3AKNA 4I3BA 3UEVA 1E06A 4ML7B 3CQRA 1T68X 1YWBA 4GGTA 3UEUA 4U8UO 4XMHA 4BX6B 1X8UA 2W2FA 4KT5A 2X8SA 3NADA 1SRHA 2HLVA 2QCBA 2LBVA 1EQDA 3GAQA 4ON1A 4Z6JA 4AW8A 2WSJA 3D4RA 4ZH6A 1KZWA 1VWRB 5LJDA 2Z4IA 1QG5A 2KW1A 4U46A 1VYGA 1GKAB 2BS5A 4BOEA 4CDFA 4IMNA 3NQKA 2OY7A 2UYWA 3BDRA 5FQ7E 4O4XA 3GE2A 3V8UA 3FA9A 2P8GA 2FLJA 5C0NA 2JW1A 1VYOA 2L9CA 4YMYA 5LJCA 1SWAA 2X4MA 5HCCC 2EU7X 4I3DA 3WZOA 4Y0SA 1DC9A 1NC9A 4XMEA 3KFGA 4BX6A 4IABA 1K3BA 5CE4A 5HZ8A 2IZDB 4RUNA 1ICNA 1ZNHA 3BU9A 4IB9A 4CSBA 1MDCA 1O1VA 3BU1A 3VG6A 1I9HA 2RD7C 1Y9TA 2OL6O 1SXUA 3PH5A 4N7CA 4QNIA 4AYHA 4ZGUA 5IRWA 2QMIA 1O1UA 5EPQA 4OEMA 2W2BA 1N9MA 1GKAA 2OVAA 3S5XA 1AVGI 3B2IA 4EQAC 2MO5A 3C77X
chains in the Genus database with same CATH topology
3F8AA 1E02A 4EFGA 5FQ8E 2AH7X 4ZHDA 2A0AA 4Y0RA 1KOIA 2JN3A 1CBRA 1SY2A 1MUPA 3EBKA 3FW5A 5F6ZA 1EIOA 3T1DA 4O4UA 3WXQA 1KT3A 1OEJA 2WWPA 3VPJE 5EEDA 3P6GA 5FFHA 1LKEA 1KQXA 4YFRA 1KT5A 3AKMA 3ZW0B 4QZUA 1SY0A 4FBOA 4GK9A 2Z4HA 2BT9A 3UEWA 3P6FA 2O62A 1B8EA 1D2UA 4GRJA 4YGHA 5H9NA 1LIEA 3P6CA 4NW4A 3CMPA 5DPQA 2R73A 2L67A 1OPAA 2WUTA 2RQ0A 1I06A 4EEJA 3FA6A 4ARHA 1X8PA 2KTDA 3P6HA 4Y0PA 5L8NA 3JSQA 2K23A 3ZW0A 4ZGUA 1BWYA 2GTFX 2Q2PA 1BSQA 1U18A 3H3IA 2LB6A 3MVFA 3ZWEA 1CBQA 1KT6A 4TNNA 4IB6A 3TGBA 4O4SA 3O22A 3L4RA 5BVTA 3KFIA 3PPTA 4KIIA 5HAEA 4QRLA 3BLGA 4DQ3A 4ZGFA 1GX8A 4HPAA 4NYRA 4HFOA 1GXAA 1P6PA 1KGLA 4EDEA 1YIVA 3OJYC 3BRNA 2OZQA 1QFVA 4ZHHA 1DFVA 2A2GA 1ML7A 5FQ6E 4A8ZA 3P6EA 4TKBA 3TGCA 1R0UA 5LJKA 2OVEA 1AQBA 2G7BA 1X8QA 1RBPA 1X8NA 3OE3A 3APWA 4NLJA 3FYFA 4QZTA 5F1EA 1TOWA 4RUUA 2AT0X 1JV4A 4XMDA 1IFCA 5AEOA 3KZAA 5F6BA 2X46A 3Q6LA 5FAZA 3HWGA 1FELA 1ICMA 2Q4NA 5HWZA 1S2PA 3NR3A 3BY0A 4ZFXA 4WHIA 2QO5A 5BYPA 1IFBA 2GTLM 4YGZA 3WJFA 1MVGA 3B2HA 2Q9SA 1GGLA 2POAA 4LKPA 4ZJ0A 1EW3A 5IO5A 3F6ZB 3PEDA 1G85A 4L3RA 1ZNKA 5H9LA 4QAEA 1OBUA 2K62A 4GH7A 4MVKA 2AT5X 2G78A 1ERXA 3ZUOA 2G79A 3D95A 3FR5A 2IFBA 1QY2A 3OBLA 4YFPA 2CM9A 3U03A 5H9AA 1VPRA 2FR2A 2GTLN 3BS2A 4M7MA 3P02A 5F7GA 3MX7A 4ZHCA 1DV9A 1CJ5A 4CV7A 4A1HA 1PM1X 4A1YA 1JBHA 1EALA 1GT3A 4ORYA 5EDCA 4QGXA 3ZQ3A 3ZI8A 2FT9A 4ORXA 2AKQA 3NBXX 4COTA 1EPAA 1JYJA 2JMBA 1X89A 1EIIA 4QGWA 4U8UM 4Y0QA 2CZUA 3RKGA 1QY1A 4KCAA 4KC7A 1OBPA 1YWAA 1MX8A 3B2JA 1DZMA 5HBSA 3RSWA 4GNYA 3FEKA 4LKTA 4ALOA 4I95A 1GT4A 1G74A 3PQSA 2MHDA 3WVMA 4IAXA 1G5WA 1QY0A 2ALLX 2AT8X 5KIDA 1KT7A 1Y9LA 4O3ZA 3VU1A 2RCTA 3RZYA 1QQSA 4OS3A 3WJCA 4ORRA 3HWEA 1G7NA 1ZNDA 4K19A 3EYCA 3TZSA 4INNA 5D48A 5LJEA 4U8UN 2HZQA 1I05A 3KQ0A 4AZPA 5AQ6A 1BEBA 3VG3A 4IB7A 2NP1A 4YKMA 2ACOA 5HCEC 4QQ1A 5HZ6A 4YKOA 4DQ4A 4ZHGA 1YWCA 2YG2A 4OMXA 4AZMA 1LICA 4I6SA 4N7DA 2N93A 3FA8A 2A13A 2X8FA 1X71A 1U0XA 4O9SA 1PMPA 1OPBA 2JU3A 4D6AA 4IBAA 5HA1A 2YMSA 1ERBA 1NP4A 1SXYA 3O19A 4PJ2A 1JJXA 4MVIA 3SOTA 1CRBA 4TJZA 2RA6A 4HPBA 4XMGA 2CZTA 5KHPA 3FR2A 4KH8A 2AT3X 1FEMA 3NX1A 1YP6A 2WQ9A 4WBKA 1B56A 1HN2A 1SXXA 1BSYA 1GX9A 2AL0X 2KT4B 4R0BA 3ZW2A 4WFUA 3B2LA 1PEEA 2HZRA 2X45A 2LA7A 3HWDA 1JZUA 1LPJA 1JIWI 3UAQA 4LZVA 4YDBA 1NGLA 5K06A 4NP1A 4EXZA 2HNXA 5AJBA 3HWFA 3MBTA 4GDZA 1A18A 2GJ5A 4YBPA 3TGAA 3APUA 1EI5A 1SA8A 3HTYA 2KTSA 3ZW1B 5IO7A 1AELA 1IKJA 3C76X 1BBPA 2HYSA 5DG4A 4O3YA 1JYDA 4YGGA 5LJBA 3CBSA 1ACDA 1BLRA 1ZNLA 5H9KA 3RBYA 3PH6A 2OVSA 2FR3A 1E00A 1QFTA 1SMPI 4CK4A 1QABE 3WJGA 4OMWA 1HMSA 1SY3A 5D4AA 1UREA 1NP1A 2LKKA 4WFVA 1KXOA 3CR6A 1Z24A 2QO6A 3BX8A 3D96A 4O4OA 2AT6X 1U17A 2OFRX 3CWKA 3VG5A 3ZW1A 5H8TA 3CQNA 4AZOA 4I9SA 1VYFA 4OS0A 1JJJA 1O8VA 2L5PA 2DM5A 1KT4A 4XMCA 2A2UA 1LIFA 2AMMX 4MISA 3ELZA 4D6BA 3WJDA 2FS7A 4UU3A 2GTLO 1HMTA 2XSTA 3LV4A 4ORWA 3NP1A 1PBOA 2WEWA 3WJEA 3WJBA 4GKCA 1AB0A 2F09A 2KD2A 4U9CA 2JOZA 3APXA 4I3CA 4M6SA 3P24A 3KFHA 1BJ7A 3LHNA 1YP7A 3S60A 2RCQA 1DZJA 1S7DA 4ID2A 1DZKA 4YBUA 4YCEA 1FTPA 3UEXA 5L8OA 4NLIA 2GC9A 2OVDA 1QWDA 2ASNX 4LQZA 1HMRA 1ADLA 1FE3A 2A3FX 2BLGA 5HZQA 5EDBA 1ZNGA 4LZUA 4YDAA 2BS6A 3FR4A 1BM5A 3D97A 4HWMA 4FBRA 2OFMX 4U3QA 5CYBA 4JGLA 4A60A 3STKA 1T0VA 1ALBA 3QKGA 4HPCA 3FMZA 4L1NA 3S26A 2QM9A 5B29A 3FENA 1MX7A 2E4JA 1FDQA 2W2AA 4HPDA 5BVSA 2ZAIA 1A2DA 3SAOA 1OEKA 2XKLA 2MM3A 5LJGA 1RLBE 4PSQA 4IAWA 2R56A 3JS1A 1DZPA 3U0DA 1EPBA 1LF7A 3HOLA 5HTEA 4ODDA 1LIBA 4O3WA 3ELXA 3BX7A 3E3CA 4AZRA 4IMOA 5BVQA 5FENA 1IKEA 4ZR2A 3ZZVA 4YFQA 4QGVA 3I17A 4FBVA 3EBWA 1GT1A 2L68A 1TXLA 4NNTA 3PECA 3EM0A 1ZRYA 1N0SA 3NX2A 4GZVA 3JQOA 5KICA 2X8TA 4FQBB 1IIUA 4QYPA 3VE2A 4NYQA 2FRSA 4ES7A 2QOSC 1B4MA 5EEEA 2NNEA 5JR8A 3IFBA 4I9RA 3RWXA 1KQWA 1FENA 1YWDA 3HOEA 1E5PA 4ZCBA 3PP6A 1IW2A 1UZ2X 2ZAGA 4GU8A 4O49A 1A57A 1HBQA 3B2KA 4AZQA 1TOUA 1EUOA 5EZ2A 2FWVA 3PQUA 2CBRA 2LBAA 3O2YA 4UU2A 3S5VA 3STMX 3U9PC 1CBSA 1HQPA 3FW4A 2Q39A 3WBGA 1T8VA 3I0AA 3VG2A 1SXWA 1BSOA 5HTDA 1YUPA 1BRPA 1CBIA 4YCHA 3FEPA 5L8IA 4ZH9A 1EXSA 1BRQA 4MVEA 2WR6A 1DF3A 3WOVA 4NNSA 4MIRA 2HMBA 3NPOA 2M4LA 5D8JA 2WEXA 2FS6A 3DSZA 3G7XA 1LFOA 5IO6A 4TLJA 4BVMA 5LKFA 1LIDA 5D45A 2MJIA 4KC8A 4GE1A 4TKHA 1HBPA 4YH0A 2R74A 3C78X 4O3XB 1TW4A 4TQ2A 4ZHFA 4MVLA 3FA7A 4ORSA 4FGIB 1KZXA 4XMFA 1OEEA 3FLLA 4GNWA 3CBCA 1I04A 5F58A 3IA8A 5LJHA 1GT5A 3KFFA 3ZUIA 3VE1A 1LNMA 5AJCA 4OS8A 5HZ9A 2JU7A 3P6DA 2CM4A 3STNA 1GM6A 1I4UA 2PY1A 3N91A 1A3YA 2RN4A 1TVQA 2CBSA 3F9DA 2QO4A 3BSZE 4GETA 5D47A 4BQUA 3HK1A 5HA0A 2MWHA 1L6MA 1ZNEA 3APVA 5HZ5A 5LKEA 2ACPX 2ANSA 1OBQA 1XKIA 1H91A 3FELA 2WQAE 2LFOA 4QYNA 2JU8A 3DTQA 2F73A 3FIQA 3K3LA 4IB8A 3VG4A 4AZNA 1XCAA 4TKJA 3NQ9A 2BHVA 3TF6A 2Q2MA 5B27A 2NNDA 4ALBA 1X8OA 3EMMA 5HCDC 2FTBA 1S44A 1D3SA 3NQ3A 3VG7A 4ORUA 1B0OA 3OD9A 2NNQA 1SY1A 3AKNA 4I3BA 3UEVA 1E06A 4ML7B 3CQRA 1T68X 1YWBA 3UEUA 4U8UO 4XMHA 1X8UA 2W2FA 4KT5A 2X8SA 3NADA 2HLVA 2LBVA 1EQDA 3GAQA 4ON1A 4AW8A 2WSJA 3D4RA 4ZH6A 1KZWA 5LJDA 2Z4IA 1QG5A 2KW1A 1VYGA 1GKAB 2BS5A 4BOEA 4IMNA 3NQKA 3BDRA 5FQ7E 4O4XA 3GE2A 3V8UA 3FA9A 2P8GA 2FLJA 5C0NA 2JW1A 2L9CA 4YMYA 5LJCA 5HCCC 2EU7X 4I3DA 4Y0SA 1DC9A 4XMEA 3KFGA 4IABA 5CE4A 5HZ8A 4RUNA 1ICNA 1ZNHA 3BU9A 4IB9A 4CSBA 1MDCA 1O1VA 3BU1A 3VG6A 2RD7C 1Y9TA 3PH5A 1SXUA 4N7CA 4QNIA 4AYHA 2QMIA 1O1UA 5EPQA 2W2BA 1GKAA 2OVAA 3S5XA 1AVGI 3B2IA 4EQAC 2MO5A 3C77X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8A A;  1E02 A;  4EFG A;  2AH7 X;  4ZHD A;  2A0A A;  4Y0R A;  1KOI A;  2JN3 A;  1CBR A;  1SY2 A;  1MUP A;  3EBK A;  3FW5 A;  5F6Z A;  1EIO A;  3T1D A;  3WXQ A;  1KT3 A;  1OEJ A;  2WWP A;  5EED A;  3P6G A;  5FFH A;  1LKE A;  1KQX A;  4YFR A;  1KT5 A;  3AKM A;  4QZU A;  1SY0 A;  3UEW A;  3P6F A;  2O62 A;  1B8E A;  1D2U A;  4GRJ A;  4YGH A;  5H9N A;  1LIE A;  3P6C A;  5DPQ A;  3CMP A;  2R73 A;  2L67 A;  1OPA A;  2WUT A;  2RQ0 A;  1I06 A;  4EEJ A;  3FA6 A;  4ARH A;  1X8P A;  2KTD A;  3P6H A;  4Y0P A;  5L8N A;  3JSQ A;  2K23 A;  4ZGU A;  1BWY A;  2Q2P A;  2GTF X;  1BSQ A;  1U18 A;  3MVF A;  2LB6 A;  1CBQ A;  1KT6 A;  4TNN A;  4IB6 A;  3TGB A;  3O22 A;  3L4R A;  5BVT A;  3KFI A;  3PPT A;  4KII A;  5HAE A;  3BLG A;  4DQ3 A;  1GX8 A;  4HPA A;  4NYR A;  4HFO A;  1GXA A;  1P6P A;  1KGL A;  4EDE A;  1YIV A;  3OJY C;  3BRN A;  2OZQ A;  1QFV A;  4ZHH A;  1DFV A;  2A2G A;  1ML7 A;  4A8Z A;  3P6E A;  4TKB A;  3TGC A;  1R0U A;  5LJK A;  2OVE A;  1AQB A;  2G7B A;  1X8Q A;  1RBP A;  1X8N A;  3APW A;  4NLJ A;  4QZT A;  5F1E A;  1TOW A;  4RUU A;  2AT0 X;  1JV4 A;  4XMD A;  1IFC A;  3KZA A;  5F6B A;  2X46 A;  3Q6L A;  5FAZ A;  3HWG A;  1FEL A;  1ICM A;  2Q4N A;  5HWZ A;  1S2P A;  3NR3 A;  3BY0 A;  4ZFX A;  2QO5 A;  1IFB A;  4YGZ A;  3WJF A;  1MVG A;  3B2H A;  2Q9S A;  1GGL A;  2POA A;  4LKP A;  4ZJ0 A;  1EW3 A;  5IO5 A;  3PED A;  1G85 A;  1ZNK A;  5H9L A;  4QAE A;  1OBU A;  2K62 A;  4GH7 A;  4MVK A;  2AT5 X;  2G78 A;  1ERX A;  3ZUO A;  2G79 A;  3D95 A;  3FR5 A;  2IFB A;  1QY2 A;  4YFP A;  2CM9 A;  3U03 A;  5H9A A;  1VPR A;  2FR2 A;  3BS2 A;  4M7M A;  5F7G A;  4ZHC A;  1DV9 A;  1CJ5 A;  4A1H A;  1PM1 X;  4A1Y A;  1JBH A;  1EAL A;  1GT3 A;  4ORY A;  5EDC A;  4QGX A;  3ZQ3 A;  2FT9 A;  4ORX A;  2AKQ A;  1EPA A;  1JYJ A;  1EII A;  1X89 A;  4QGW A;  4Y0Q A;  2CZU A;  1QY1 A;  1OBP A;  1YWA A;  1MX8 A;  3B2J A;  1DZM A;  5HBS A;  3RSW A;  4GNY A;  3FEK A;  4LKT A;  4ALO A;  1GT4 A;  1G74 A;  3WVM A;  4IAX A;  1G5W A;  1QY0 A;  2ALL X;  2AT8 X;  5KID A;  1KT7 A;  2RCT A;  3RZY A;  1QQS A;  4OS3 A;  3WJC A;  4ORR A;  3HWE A;  1G7N A;  1ZND A;  4K19 A;  3EYC A;  3TZS A;  5D48 A;  5LJE A;  2HZQ A;  1I05 A;  3KQ0 A;  4AZP A;  5AQ6 A;  1BEB A;  3VG3 A;  4IB7 A;  2NP1 A;  4YKM A;  2ACO A;  5HCE C;  5HZ6 A;  4YKO A;  4DQ4 A;  4ZHG A;  1YWC A;  2YG2 A;  4OMX A;  4AZM A;  1LIC A;  4N7D A;  2N93 A;  3FA8 A;  2A13 A;  1X71 A;  1U0X A;  4O9S A;  1PMP A;  1OPB A;  2JU3 A;  4D6A A;  4IBA A;  5HA1 A;  1JJX A;  1ERB A;  1NP4 A;  1SXY A;  3O19 A;  4MVI A;  1CRB A;  4TJZ A;  2RA6 A;  4HPB A;  4XMG A;  2CZT A;  5KHP A;  3FR2 A;  2AT3 X;  1FEM A;  3NX1 A;  1YP6 A;  2WQ9 A;  4WBK A;  1B56 A;  1HN2 A;  1SXX A;  1BSY A;  1GX9 A;  2AL0 X;  2KT4 B;  4R0B A;  4WFU A;  3B2L A;  1PEE A;  2HZR A;  2X45 A;  3HWD A;  1JZU A;  1LPJ A;  4LZV A;  4YDB A;  1NGL A;  5K06 A;  4NP1 A;  4EXZ A;  2HNX A;  3HWF A;  3MBT A;  1A18 A;  2GJ5 A;  4YBP A;  3TGA A;  3APU A;  1SA8 A;  5IO7 A;  1AEL A;  1IKJ A;  3C76 X;  1BBP A;  2HYS A;  5DG4 A;  1JYD A;  4YGG A;  5LJB A;  3CBS A;  1ACD A;  1BLR A;  1ZNL A;  5H9K A;  3PH6 A;  2FR3 A;  1E00 A;  1QFT A;  4CK4 A;  1QAB E;  3WJG A;  4OMW A;  1HMS A;  1SY3 A;  5D4A A;  1URE A;  1NP1 A;  2LKK A;  4WFV A;  1KXO A;  3CR6 A;  1Z24 A;  2QO6 A;  3BX8 A;  3D96 A;  2AT6 X;  1U17 A;  2OFR X;  3CWK A;  3VG5 A;  5H8T A;  3CQN A;  4AZO A;  4I9S A;  1VYF A;  4OS0 A;  1JJJ A;  1O8V A;  2L5P A;  2DM5 A;  1KT4 A;  4XMC A;  2A2U A;  1LIF A;  2AMM X;  4D6B A;  3ELZ A;  3WJD A;  2FS7 A;  4UU3 A;  1HMT A;  2XST A;  4ORW A;  3NP1 A;  1PBO A;  2WEW A;  3WJE A;  3WJB A;  4GKC A;  1AB0 A;  2JOZ A;  3APX A;  4I3C A;  4M6S A;  3KFH A;  1BJ7 A;  1YP7 A;  2RCQ A;  1DZJ A;  1S7D A;  1DZK A;  4YBU A;  4YCE A;  1FTP A;  3UEX A;  5L8O A;  4NLI A;  2GC9 A;  2OVD A;  1QWD A;  2ASN X;  1HMR A;  1ADL A;  1FE3 A;  2A3F X;  2BLG A;  5HZQ A;  5EDB A;  1ZNG A;  4LZU A;  4YDA A;  3FR4 A;  1BM5 A;  3D97 A;  2OFM X;  4A60 A;  3STK A;  1T0V A;  1ALB A;  3QKG A;  4HPC A;  3FMZ A;  3S26 A;  5B29 A;  2QM9 A;  3FEN A;  1MX7 A;  2E4J A;  1FDQ A;  2W2A A;  4HPD A;  5BVS A;  1A2D A;  3SAO A;  1OEK A;  2XKL A;  2MM3 A;  5LJG A;  1RLB E;  4PSQ A;  4IAW A;  2R56 A;  3JS1 A;  1DZP A;  3U0D A;  1EPB A;  1LF7 A;  5HTE A;  4ODD A;  1LIB A;  3ELX A;  3BX7 A;  4AZR A;  4IMO A;  5BVQ A;  5FEN A;  1IKE A;  4ZR2 A;  4QGV A;  4YFQ A;  3I17 A;  3EBW A;  1GT1 A;  2L68 A;  1TXL A;  4NNT A;  3PEC A;  3EM0 A;  1ZRY A;  1N0S A;  3NX2 A;  5KIC A;  1IIU A;  4QYP A;  4NYQ A;  2FRS A;  4ES7 A;  2QOS C;  1B4M A;  5EEE A;  2NNE A;  5JR8 A;  3IFB A;  4I9R A;  1KQW A;  1FEN A;  1YWD A;  1E5P A;  4ZCB A;  3PP6 A;  1IW2 A;  1UZ2 X;  1A57 A;  1HBQ A;  3B2K A;  4AZQ A;  1TOU A;  1EUO A;  5EZ2 A;  2FWV A;  2CBR A;  2LBA A;  3O2Y A;  4UU2 A;  3STM X;  3U9P C;  1CBS A;  1HQP A;  3FW4 A;  2Q39 A;  3WBG A;  1T8V A;  3I0A A;  3VG2 A;  1SXW A;  1BSO A;  5HTD A;  1YUP A;  1BRP A;  1CBI A;  4YCH A;  3FEP A;  5L8I A;  4ZH9 A;  1EXS A;  1BRQ A;  2WR6 A;  1DF3 A;  4NNS A;  2HMB A;  3NPO A;  5D8J A;  2WEX A;  2FS6 A;  3DSZ A;  3G7X A;  1LFO A;  5IO6 A;  4TLJ A;  4BVM A;  5LKF A;  1LID A;  5D45 A;  2MJI A;  4GE1 A;  4TKH A;  1HBP A;  4YH0 A;  2R74 A;  3C78 X;  1TW4 A;  4TQ2 A;  4ZHF A;  4MVL A;  3FA7 A;  4ORS A;  1KZX A;  4XMF A;  1OEE A;  3FLL A;  4GNW A;  3CBC A;  1I04 A;  5F58 A;  3IA8 A;  5LJH A;  1GT5 A;  3KFF A;  3ZUI A;  1LNM A;  4OS8 A;  5HZ9 A;  2JU7 A;  3P6D A;  2CM4 A;  3STN A;  1GM6 A;  1I4U A;  2PY1 A;  1A3Y A;  1TVQ A;  2CBS A;  3F9D A;  2QO4 A;  3BSZ E;  4GET A;  5D47 A;  4BQU A;  3HK1 A;  5HA0 A;  5HZ5 A;  1L6M A;  1ZNE A;  3APV A;  5LKE A;  2ACP X;  2ANS A;  1OBQ A;  1XKI A;  1H91 A;  3FEL A;  2WQA E;  2LFO A;  4QYN A;  2JU8 A;  3DTQ A;  2F73 A;  3FIQ A;  3K3L A;  4IB8 A;  3VG4 A;  4AZN A;  1XCA A;  4TKJ A;  3NQ9 A;  3TF6 A;  2Q2M A;  5B27 A;  2NND A;  4ALB A;  1X8O A;  3EMM A;  5HCD C;  2FTB A;  1S44 A;  1D3S A;  3NQ3 A;  3VG7 A;  4ORU A;  1B0O A;  2NNQ A;  1SY1 A;  3AKN A;  4I3B A;  3UEV A;  1E06 A;  3CQR A;  1T68 X;  1YWB A;  3UEU A;  4XMH A;  1X8U A;  2W2F A;  3NAD A;  2HLV A;  2LBV A;  1EQD A;  3GAQ A;  4AW8 A;  2WSJ A;  4ZH6 A;  1KZW A;  5LJD A;  1QG5 A;  1VYG A;  1GKA B;  4BOE A;  4IMN A;  3BDR A;  3FA9 A;  2P8G A;  2FLJ A;  5C0N A;  2L9C A;  4YMY A;  5LJC A;  5HCC C;  2EU7 X;  4I3D A;  4Y0S A;  1DC9 A;  4XME A;  3KFG A;  5CE4 A;  5HZ8 A;  4RUN A;  1ICN A;  1ZNH A;  3BU9 A;  4IB9 A;  1MDC A;  1O1V A;  3BU1 A;  3VG6 A;  2RD7 C;  3PH5 A;  1SXU A;  4N7C A;  4AYH A;  5EPQ A;  1O1U A;  2W2B A;  1GKA A;  2OVA A;  1AVG I;  3B2I A;  2MO5 A;  3C77 X; 
#chains in the Genus database with same CATH topology
 3F8A A;  1E02 A;  4EFG A;  5FQ8 E;  2C1S A;  2AH7 X;  4ZHD A;  1I78 A;  2A0A A;  4Y0R A;  1KOI A;  1VWK B;  2JN3 A;  1CBR A;  4DCB A;  1SY2 A;  1MUP A;  3EBK A;  3FW5 A;  5F6Z A;  2X55 A;  4CPH A;  1EIO A;  1WBI A;  3T1D A;  4O4U A;  1LUQ A;  3WXQ A;  1KT3 A;  1OEJ A;  2WWP A;  3VPJ E;  5EED A;  3P6G A;  5FFH A;  1MEP A;  1LKE A;  4BGF A;  1DF8 A;  1KL4 A;  1KQX A;  3RDU A;  4YFR A;  1KT5 A;  3AKM A;  3ZW0 B;  4QZU A;  3T6F A;  1GX3 A;  1SY0 A;  4FBO A;  4GK9 A;  4CPI A;  2Z4H A;  2BT9 A;  5CHK A;  1VWD B;  3SLO A;  3UEW A;  3P6F A;  1STP A;  1B8E A;  1D2U A;  2O62 A;  4GRJ A;  4YGH A;  5H9N A;  3SZH A;  4YVB A;  1LIE A;  3P6C A;  4NW4 A;  3CMP A;  5DPQ A;  2R73 A;  2IZC B;  1AVE A;  2L67 A;  1OPA A;  2WUT A;  2RQ0 A;  2OF8 A;  1I06 A;  4EEJ A;  1SRE A;  3FA6 A;  2OF9 A;  1JMX A;  1NQM A;  4ARH A;  3FDC A;  1X8P A;  2KTD A;  3P6H A;  4Y0P A;  5L8N A;  3JSQ A;  2K23 A;  3ZW0 A;  1SWS A;  2Y3E A;  3RDQ A;  2GTF X;  2Q2P A;  1BSQ A;  1U18 A;  3H3I A;  2LB6 A;  3MVF A;  3ZWE A;  1CBQ A;  1KT6 A;  2OL8 O;  2RTJ A;  1SWU A;  4TNN A;  4IB6 A;  2GH7 A;  2OFB A;  2IZB A;  3O22 A;  1SWL A;  4O4S A;  3L4R A;  4YH0 A;  3RDX A;  1VWO B;  5BVT A;  3KFI A;  3PPT A;  4DNE A;  4KII A;  1VWH B;  5HAE A;  4QRL A;  3BLG A;  4DQ3 A;  5B5F A;  4ZGF A;  1GX8 A;  4HPA A;  4NYR A;  4HFO A;  1GXA A;  1P6P A;  2IZE B;  1KGL A;  4EDE A;  1YIV A;  3OJY C;  3BRN A;  2OZQ A;  2A8G A;  1QFV A;  4JNJ A;  4ZHH A;  1DFV A;  2A2G A;  1ML7 A;  5FQ6 E;  4A8Z A;  3P6E A;  4TKB A;  3TGC A;  1R0U A;  4NV8 A;  5LJK A;  2OVE A;  1AQB A;  2RTC B;  2G7B A;  1X8Q A;  1RBP A;  1X8N A;  3OE3 A;  3APW A;  5K68 A;  4NLJ A;  1N9Y A;  3FYF A;  2IZA A;  4QZT A;  1TOW A;  1SWJ A;  2AT0 X;  4RUU A;  1JV4 A;  5F1E A;  4BX5 B;  1K24 A;  4XMD A;  1SWR A;  1IFC A;  1SLG B;  3KZA A;  5B2A O;  3HPE A;  2X46 A;  3Q6L A;  5F6B A;  5FAZ A;  3HWG A;  1FEL A;  1ICM A;  2Q4N A;  5HWZ A;  1S2P A;  3NR3 A;  3RY2 A;  3BY0 A;  1SWK A;  2ZSC A;  4ZFX A;  1RXH A;  4WHI A;  2QO5 A;  3T6L A;  5BYP A;  3PK2 A;  1IFB A;  2GTL M;  2RTI B;  3QQ2 A;  4YGZ A;  3WJF A;  1MVG A;  3B2H A;  4CDE A;  1NQN A;  2Q9S A;  1GGL A;  2POA A;  4LKP A;  4ZJ0 A;  1EW3 A;  5IO5 A;  5IXG A;  3F6Z B;  3PED A;  2UZ2 A;  1G85 A;  4L3R A;  1RSU B;  1ZNK A;  5H9L A;  4QAE A;  1OBU A;  2K62 A;  4GH7 A;  4MVK A;  2C1Q A;  2AT5 X;  2G78 A;  1ERX A;  4GJS A;  3ZUO A;  3RE6 A;  4B55 A;  2G79 A;  3D95 A;  3FR5 A;  4GDA A;  1VWF B;  1QY2 A;  2I5Z O;  2IFB A;  3OBL A;  4YFP A;  2CM9 A;  3U03 A;  5H9A A;  1VPR A;  2FR2 A;  2GTL N;  3BS2 A;  4M7M A;  3P02 A;  5F7G A;  2FHN X;  3MX7 A;  4MEE A;  4ZHC A;  1DV9 A;  2RTN B;  1CJ5 A;  4CV7 A;  4I60 A;  4A1H A;  1PM1 X;  4A1Y A;  3VHI A;  1JBH A;  1EAL A;  4GUZ A;  1GT3 A;  2BSZ A;  4ORY A;  4QGX A;  5EDC A;  3ZI8 A;  3ZQ3 A;  2FT9 A;  1Y53 X;  4ORX A;  2AKQ A;  2CAM A;  3NBX X;  3RY1 A;  1EPA A;  1JYJ A;  2JMB A;  1X89 A;  4COT A;  1EII A;  4QGW A;  4U8U M;  4Y0Q A;  2CZU A;  3RKG A;  1QY1 A;  4KCA A;  4KC7 A;  1OBP A;  1YWA A;  1MX8 A;  5IRU A;  3B2J A;  3RE5 A;  5HZ6 A;  1DZM A;  5HBS A;  3RSW A;  4GNY A;  3FEK A;  4LKT A;  4ALO A;  3X00 A;  4I95 A;  1GT4 A;  1G74 A;  1SWT A;  3TGB A;  3PQS A;  2MHD A;  3WVM A;  4IAX A;  1G5W A;  1QY0 A;  2ALL X;  2AT8 X;  5KID A;  1KT7 A;  1Y9L A;  2QOM A;  1W4T A;  4O3Z A;  3VU1 A;  2RCT A;  3RZY A;  1QQS A;  4GD9 A;  4OS3 A;  2RTP B;  4ORR A;  3HWE A;  1G7N A;  1ZND A;  4K19 A;  3EYC A;  3WJC A;  3TZS A;  4INN A;  5D48 A;  5LJE A;  4U8U N;  2HZQ A;  1I05 A;  3RDM A;  2X56 A;  3KQ0 A;  2IZL B;  4AZP A;  4Z2O A;  5AQ6 A;  4CPE A;  1BEB A;  2OY8 A;  3VG3 A;  4IB7 A;  1RAV A;  2NP1 A;  4YKM A;  2ACO A;  2OL7 A;  4QQ1 A;  2IZJ A;  4YKO A;  5HCE C;  1SWQ A;  2RTA A;  4CPF A;  4DQ4 A;  1YWC A;  1SLE B;  1JQP A;  2YG2 A;  4OMX A;  1LIC A;  1N43 A;  2A5B A;  2FKG A;  4I6S A;  3SLT A;  4N7D A;  3EC5 A;  1KL3 A;  4Y5D A;  2N93 A;  1IJ8 A;  3FA8 A;  2A13 A;  2X8F A;  1X71 A;  3EW1 A;  1U0X A;  1KFF A;  4O9S A;  1PMP A;  1LCW A;  1OPB A;  1UYN X;  2JU3 A;  4D6A A;  4IBA A;  5HA1 A;  2YMS A;  1ERB A;  1NP4 A;  1SXY A;  3O19 A;  4PJ2 A;  2FKJ A;  4MVI A;  1JJX A;  3SOT A;  1CRB A;  4TJZ A;  2RA6 A;  4HPB A;  4XMG A;  2CZT A;  5KHP A;  3FR2 A;  4KH8 A;  2AT3 X;  1FJ1 E;  1FEM A;  1SWP A;  3NX1 A;  1YP6 A;  2WQ9 A;  1SWG A;  4WBK A;  1B56 A;  1HN2 A;  2X34 A;  1SXX A;  1BSY A;  1STS B;  1GX9 A;  2AL0 X;  2KT4 B;  4R0B A;  3ZW2 A;  4WFU A;  3B2L A;  1PEE A;  2HZR A;  4Z2P A;  2X45 A;  2LA7 A;  3HWD A;  1JZU A;  1LPJ A;  2BC3 A;  1JIW I;  3UAQ A;  4LZV A;  4YDB A;  1NGL A;  5K06 A;  4NP1 A;  4Z28 A;  1VWA B;  2DJF A;  2HNX A;  2IZH B;  2RTK A;  3HWF A;  5AJB A;  3MBT A;  4EXZ A;  4GDZ A;  1A18 A;  2GJ5 A;  4YBP A;  2VDF A;  3TGA A;  3APU A;  1EI5 A;  1SA8 A;  1SWC A;  2KTS A;  3HTY A;  5B3M O;  3FID A;  3ZW1 B;  5IO7 A;  1IKJ A;  3C76 X;  3MG5 A;  1BBP A;  2HYS A;  5DG4 A;  3VGW A;  1VWE B;  4O3Y A;  1JYD A;  2Y32 A;  1SRJ A;  4YGG A;  5LJB A;  3CBS A;  4JHQ A;  1ACD A;  2C4I A;  1BLR A;  1ZNL A;  5H9K A;  4BX7 B;  1LCZ A;  3RBY A;  3PH6 A;  4GGR A;  2OVS A;  4OEL A;  2FR3 A;  4Y59 A;  1E00 A;  1QFT A;  1SMP I;  2RTH B;  4CK4 A;  5L3Y A;  1QAB E;  3WJG A;  1LCV A;  1NDJ A;  1HMS A;  4OMW A;  1SY3 A;  2IZF B;  5D4A A;  4Z27 A;  1URE A;  1NP1 A;  2LKK A;  2WPU A;  1SWE A;  2RTE B;  4WFV A;  1KXO A;  2X32 A;  3CR6 A;  1Z24 A;  2QO6 A;  2VFB A;  5F2B A;  3BX8 A;  3D96 A;  4O4O A;  2AT6 X;  1U17 A;  2OFR X;  3CWK A;  3VG5 A;  3ZW1 A;  5H8T A;  3CQN A;  4AZO A;  4I9S A;  1VYF A;  2OY1 O;  4OS0 A;  1JJJ A;  1O8V A;  2L5P A;  1HY2 A;  2DM5 A;  2RTQ B;  2HKD A;  1KT4 A;  4XMC A;  2A2U A;  3SZJ A;  3Q34 A;  1LIF A;  2AMM X;  4MIS A;  3ELZ A;  4BX7 A;  4D6B A;  3WJD A;  2FS7 A;  4UU3 A;  2FHL A;  2GTL O;  1HMT A;  2XST A;  3LV4 A;  4ORW A;  1VWG B;  2RTB B;  3NP1 A;  1PBO A;  2OYB O;  1HXZ A;  2WEW A;  1SRF A;  3WJE A;  3WYQ A;  3WJB A;  1VWL B;  4GKC A;  3T2X A;  1AB0 A;  2F09 A;  2MF6 A;  2KD2 A;  4U9C A;  1BWY A;  4OKA A;  3WZP A;  2JOZ A;  1RXK A;  3APX A;  4I3C A;  4M6S A;  3P24 A;  3KFH A;  1BJ7 A;  3LHN A;  4BX5 A;  2F01 A;  1STR B;  1YP7 A;  1RXJ A;  3S60 A;  2RCQ A;  3RDS A;  3AEH A;  1DZJ A;  2RTD B;  1S7D A;  4ID2 A;  1DZK A;  1RST B;  1SLF B;  4YBU A;  4YCE A;  2OFA A;  4BBO A;  1FTP A;  3UEX A;  5L8O A;  4NLI A;  2GC9 A;  2OVD A;  1QWD A;  2ASN X;  3T2W A;  4LQZ A;  1HMR A;  1UYO X;  1ADL A;  1FE3 A;  1N7Y A;  1VWJ B;  2A3F X;  2BLG A;  5HZQ A;  5EDB A;  2DJG A;  1OSP O;  1ZNG A;  2A5C A;  4LZU A;  4YDA A;  2BS6 A;  2G8C O;  3CKG A;  3FR4 A;  2OY5 O;  1BM5 A;  1HXL A;  4EKV A;  3D97 A;  4HWM A;  1JJU A;  1SLD B;  4FBR A;  5AEO A;  2OFM X;  4U3Q A;  5CYB A;  1E2T A;  3VHH A;  4JGL A;  4A60 A;  1SWN A;  3STK A;  1LDO A;  1W5R A;  4BJ8 A;  1T0V A;  1ALB A;  3QKG A;  4HPC A;  1WUB A;  3FMZ A;  2RTO B;  2QM9 A;  4L1N A;  3S26 A;  2FGS A;  3FEN A;  1MX7 A;  2E4J A;  5B29 A;  1FDQ A;  4ZHG A;  2PI3 O;  2W2A A;  4HPD A;  5BVS A;  2ZAI A;  1A2D A;  3SAO A;  1OEK A;  5B10 O;  2XKL A;  2MM3 A;  1SWF A;  5LJG A;  1RLB E;  4PSQ A;  4C5P A;  4IAW A;  2IZI A;  2R56 A;  3JS1 A;  1DZP A;  4CDC A;  3U0D A;  1EPB A;  1LF7 A;  1VWP B;  3HOL A;  4ODD A;  5B11 O;  5HTE A;  1LIB A;  4O3W A;  1PBY A;  4CPH B;  4IRW A;  3ELX A;  3BX7 A;  3E3C A;  4AZR A;  1LDQ A;  4IMO A;  5BVQ A;  5FEN A;  4NV7 A;  1IKE A;  4ZR2 A;  3ZZV A;  4YFQ A;  4QGV A;  3I17 A;  4FBV A;  5CSE A;  3EBW A;  1GT1 A;  2L68 A;  1TXL A;  4NNT A;  3PEC A;  3EM0 A;  1ZRY A;  1N0S A;  3SZI A;  3NX2 A;  4GZV A;  1SWD A;  3JQO A;  5KIC A;  3EW2 A;  2X8T A;  1MM9 A;  4FQB B;  1IIU A;  4QYP A;  1VWN B;  4NYQ A;  3AUM O;  3VE2 A;  2FRS A;  4ES7 A;  3WZN A;  2QOS C;  1B4M A;  5EEE A;  2NNE A;  5JR8 A;  3IFB A;  1SRG A;  2AF5 A;  4I9R A;  2RTG B;  3RWX A;  1KQW A;  1FEN A;  1YWD A;  3HOE A;  1E5P A;  4ZCB A;  3PP6 A;  1IW2 A;  1UZ2 X;  2ZAG A;  4GU8 A;  4O49 A;  4Z2V A;  1A57 A;  1HBQ A;  2RTF B;  3B2K A;  1TOU A;  1EUO A;  5EZ2 A;  4AZQ A;  2FWV A;  3PQU A;  2CBR A;  2LBA A;  3O2Y A;  4UU2 A;  3S5V A;  3STM X;  2RTL A;  3U9P C;  1CBS A;  1HQP A;  3FW4 A;  1VWQ B;  2Q39 A;  3WBG A;  1VWM B;  1T8V A;  1LEL A;  1VWC B;  1SWB A;  3I0A A;  1SXW A;  3VG2 A;  1BSO A;  5HTD A;  1YUP A;  1BRP A;  1CBI A;  4YCH A;  3FEP A;  5L8I A;  4ZH9 A;  2RTM A;  1EXS A;  1BRQ A;  4MVE A;  2WR6 A;  1DF3 A;  3WOV A;  4NNS A;  2Y3F A;  4CDD A;  4MIR A;  2HMB A;  1N4J A;  3NPO A;  3D9W A;  2M4L A;  5D8J A;  2WEX A;  2FS6 A;  3DSZ A;  3G7X A;  1LFO A;  1SRI A;  1MK5 A;  5IO6 A;  2I5V O;  4TLJ A;  1JMZ A;  3WZQ A;  1HQQ A;  1AVD A;  4BVM A;  5LKF A;  4JO6 A;  1LID A;  5D45 A;  1Y55 X;  2MJI A;  5JD2 A;  4KC8 A;  5B5G A;  1W6F A;  4GE1 A;  1HBP A;  4TKH A;  2R74 A;  3C78 X;  2AVI A;  3CKF A;  1TW4 A;  4O3X B;  4TQ2 A;  4MVL A;  3FA7 A;  4ZHF A;  2RTR B;  4ORS A;  4FGI B;  1KZX A;  3WYP A;  4XMF A;  1OEE A;  3FLL A;  1PTS A;  3VHM A;  1Y0G A;  4GNW A;  3CBC A;  1I04 A;  1Y52 X;  3LTW A;  5F58 A;  3IA8 A;  5IRA A;  5LJH A;  1VWB B;  1GT5 A;  3KFF A;  3ZUI A;  3VE1 A;  5K67 A;  1LNM A;  5AJC A;  4OS8 A;  5HZ9 A;  2IZG B;  2JU7 A;  2IZK A;  3P6D A;  2CM4 A;  1KL5 A;  1GM6 A;  1I4U A;  2PY1 A;  3KVN A;  4GGZ A;  3N91 A;  3STN A;  1A3Y A;  2RN4 A;  3MM0 A;  1TVQ A;  1SWH A;  1AEL A;  2CBS A;  3F9D A;  2QO4 A;  3BSZ E;  4GET A;  4GJV A;  5D47 A;  4BQU A;  3HK1 A;  5HA0 A;  2MWH A;  1L6M A;  1ZNE A;  3APV A;  5HZ5 A;  5LKE A;  2ACP X;  2ANS A;  1OBQ A;  1XKI A;  1H91 A;  3FEL A;  2WQA E;  2LFO A;  4QYN A;  2JU8 A;  3DTQ A;  2F73 A;  1SWO A;  3FIQ A;  3K3L A;  4IB8 A;  1VWI B;  3VG4 A;  4AZN A;  4BCS A;  1XCA A;  4TKJ A;  2VFC A;  3NQ9 A;  2G5L A;  2BHV A;  3TF6 A;  2Q2M A;  1NBX A;  5B27 A;  2NND A;  4ALB A;  1X8O A;  3EMM A;  5HCD C;  2FTB A;  1S44 A;  1D3S A;  3NQ3 A;  4AZM A;  3VG7 A;  1MOY A;  4ORU A;  2JGS A;  1B0O A;  3OD9 A;  3RDO A;  2NNQ A;  1SY1 A;  3SLJ A;  3PDF A;  3AKN A;  4I3B A;  3UEV A;  1E06 A;  4ML7 B;  3CQR A;  1T68 X;  1YWB A;  4GGT A;  3UEU A;  4U8U O;  4XMH A;  4BX6 B;  1X8U A;  2W2F A;  4KT5 A;  2X8S A;  3NAD A;  1SRH A;  2HLV A;  2QCB A;  2LBV A;  1EQD A;  3GAQ A;  4ON1 A;  4Z6J A;  4AW8 A;  2WSJ A;  3D4R A;  4ZH6 A;  1KZW A;  1VWR B;  5LJD A;  2Z4I A;  1QG5 A;  2KW1 A;  4U46 A;  1VYG A;  1GKA B;  2BS5 A;  4BOE A;  4CDF A;  4IMN A;  3NQK A;  2OY7 A;  2UYW A;  3BDR A;  5FQ7 E;  4O4X A;  3GE2 A;  3V8U A;  3FA9 A;  2P8G A;  2FLJ A;  5C0N A;  2JW1 A;  1VYO A;  2L9C A;  4YMY A;  5LJC A;  1SWA A;  2X4M A;  5HCC C;  2EU7 X;  4I3D A;  3WZO A;  4Y0S A;  1DC9 A;  1NC9 A;  4XME A;  3KFG A;  4BX6 A;  4IAB A;  1K3B A;  5CE4 A;  5HZ8 A;  2IZD B;  4RUN A;  1ICN A;  1ZNH A;  3BU9 A;  4IB9 A;  4CSB A;  1MDC A;  1O1V A;  3BU1 A;  3VG6 A;  1I9H A;  2RD7 C;  1Y9T A;  2OL6 O;  1SXU A;  3PH5 A;  4N7C A;  4QNI A;  4AYH A;  4ZGU A;  5IRW A;  2QMI A;  1O1U A;  5EPQ A;  4OEM A;  2W2B A;  1N9M A;  1GKA A;  2OVA A;  3S5X A;  1AVG I;  3B2I A;  4EQA C;  2MO5 A;  3C77 X; 
#chains in the Genus database with same CATH homology
 3F8A A;  1E02 A;  4EFG A;  5FQ8 E;  2AH7 X;  4ZHD A;  2A0A A;  4Y0R A;  1KOI A;  2JN3 A;  1CBR A;  1SY2 A;  1MUP A;  3EBK A;  3FW5 A;  5F6Z A;  1EIO A;  3T1D A;  4O4U A;  3WXQ A;  1KT3 A;  1OEJ A;  2WWP A;  3VPJ E;  5EED A;  3P6G A;  5FFH A;  1LKE A;  1KQX A;  4YFR A;  1KT5 A;  3AKM A;  3ZW0 B;  4QZU A;  1SY0 A;  4FBO A;  4GK9 A;  2Z4H A;  2BT9 A;  3UEW A;  3P6F A;  2O62 A;  1B8E A;  1D2U A;  4GRJ A;  4YGH A;  5H9N A;  1LIE A;  3P6C A;  4NW4 A;  3CMP A;  5DPQ A;  2R73 A;  2L67 A;  1OPA A;  2WUT A;  2RQ0 A;  1I06 A;  4EEJ A;  3FA6 A;  4ARH A;  1X8P A;  2KTD A;  3P6H A;  4Y0P A;  5L8N A;  3JSQ A;  2K23 A;  3ZW0 A;  4ZGU A;  1BWY A;  2GTF X;  2Q2P A;  1BSQ A;  1U18 A;  3H3I A;  2LB6 A;  3MVF A;  3ZWE A;  1CBQ A;  1KT6 A;  4TNN A;  4IB6 A;  3TGB A;  4O4S A;  3O22 A;  3L4R A;  5BVT A;  3KFI A;  3PPT A;  4KII A;  5HAE A;  4QRL A;  3BLG A;  4DQ3 A;  4ZGF A;  1GX8 A;  4HPA A;  4NYR A;  4HFO A;  1GXA A;  1P6P A;  1KGL A;  4EDE A;  1YIV A;  3OJY C;  3BRN A;  2OZQ A;  1QFV A;  4ZHH A;  1DFV A;  2A2G A;  1ML7 A;  5FQ6 E;  4A8Z A;  3P6E A;  4TKB A;  3TGC A;  1R0U A;  5LJK A;  2OVE A;  1AQB A;  2G7B A;  1X8Q A;  1RBP A;  1X8N A;  3OE3 A;  3APW A;  4NLJ A;  3FYF A;  4QZT A;  5F1E A;  1TOW A;  4RUU A;  2AT0 X;  1JV4 A;  4XMD A;  1IFC A;  5AEO A;  3KZA A;  5F6B A;  2X46 A;  3Q6L A;  5FAZ A;  3HWG A;  1FEL A;  1ICM A;  2Q4N A;  5HWZ A;  1S2P A;  3NR3 A;  3BY0 A;  4ZFX A;  4WHI A;  2QO5 A;  5BYP A;  1IFB A;  2GTL M;  4YGZ A;  3WJF A;  1MVG A;  3B2H A;  2Q9S A;  1GGL A;  2POA A;  4LKP A;  4ZJ0 A;  1EW3 A;  5IO5 A;  3F6Z B;  3PED A;  1G85 A;  4L3R A;  1ZNK A;  5H9L A;  4QAE A;  1OBU A;  2K62 A;  4GH7 A;  4MVK A;  2AT5 X;  2G78 A;  1ERX A;  3ZUO A;  2G79 A;  3D95 A;  3FR5 A;  2IFB A;  1QY2 A;  3OBL A;  4YFP A;  2CM9 A;  3U03 A;  5H9A A;  1VPR A;  2FR2 A;  2GTL N;  3BS2 A;  4M7M A;  3P02 A;  5F7G A;  3MX7 A;  4ZHC A;  1DV9 A;  1CJ5 A;  4CV7 A;  4A1H A;  1PM1 X;  4A1Y A;  1JBH A;  1EAL A;  1GT3 A;  4ORY A;  5EDC A;  4QGX A;  3ZQ3 A;  3ZI8 A;  2FT9 A;  4ORX A;  2AKQ A;  3NBX X;  4COT A;  1EPA A;  1JYJ A;  2JMB A;  1X89 A;  1EII A;  4QGW A;  4U8U M;  4Y0Q A;  2CZU A;  3RKG A;  1QY1 A;  4KCA A;  4KC7 A;  1OBP A;  1YWA A;  1MX8 A;  3B2J A;  1DZM A;  5HBS A;  3RSW A;  4GNY A;  3FEK A;  4LKT A;  4ALO A;  4I95 A;  1GT4 A;  1G74 A;  3PQS A;  2MHD A;  3WVM A;  4IAX A;  1G5W A;  1QY0 A;  2ALL X;  2AT8 X;  5KID A;  1KT7 A;  1Y9L A;  4O3Z A;  3VU1 A;  2RCT A;  3RZY A;  1QQS A;  4OS3 A;  3WJC A;  4ORR A;  3HWE A;  1G7N A;  1ZND A;  4K19 A;  3EYC A;  3TZS A;  4INN A;  5D48 A;  5LJE A;  4U8U N;  2HZQ A;  1I05 A;  3KQ0 A;  4AZP A;  5AQ6 A;  1BEB A;  3VG3 A;  4IB7 A;  2NP1 A;  4YKM A;  2ACO A;  5HCE C;  4QQ1 A;  5HZ6 A;  4YKO A;  4DQ4 A;  4ZHG A;  1YWC A;  2YG2 A;  4OMX A;  4AZM A;  1LIC A;  4I6S A;  4N7D A;  2N93 A;  3FA8 A;  2A13 A;  2X8F A;  1X71 A;  1U0X A;  4O9S A;  1PMP A;  1OPB A;  2JU3 A;  4D6A A;  4IBA A;  5HA1 A;  2YMS A;  1ERB A;  1NP4 A;  1SXY A;  3O19 A;  4PJ2 A;  1JJX A;  4MVI A;  3SOT A;  1CRB A;  4TJZ A;  2RA6 A;  4HPB A;  4XMG A;  2CZT A;  5KHP A;  3FR2 A;  4KH8 A;  2AT3 X;  1FEM A;  3NX1 A;  1YP6 A;  2WQ9 A;  4WBK A;  1B56 A;  1HN2 A;  1SXX A;  1BSY A;  1GX9 A;  2AL0 X;  2KT4 B;  4R0B A;  3ZW2 A;  4WFU A;  3B2L A;  1PEE A;  2HZR A;  2X45 A;  2LA7 A;  3HWD A;  1JZU A;  1LPJ A;  1JIW I;  3UAQ A;  4LZV A;  4YDB A;  1NGL A;  5K06 A;  4NP1 A;  4EXZ A;  2HNX A;  5AJB A;  3HWF A;  3MBT A;  4GDZ A;  1A18 A;  2GJ5 A;  4YBP A;  3TGA A;  3APU A;  1EI5 A;  1SA8 A;  3HTY A;  2KTS A;  3ZW1 B;  5IO7 A;  1AEL A;  1IKJ A;  3C76 X;  1BBP A;  2HYS A;  5DG4 A;  4O3Y A;  1JYD A;  4YGG A;  5LJB A;  3CBS A;  1ACD A;  1BLR A;  1ZNL A;  5H9K A;  3RBY A;  3PH6 A;  2OVS A;  2FR3 A;  1E00 A;  1QFT A;  1SMP I;  4CK4 A;  1QAB E;  3WJG A;  4OMW A;  1HMS A;  1SY3 A;  5D4A A;  1URE A;  1NP1 A;  2LKK A;  4WFV A;  1KXO A;  3CR6 A;  1Z24 A;  2QO6 A;  3BX8 A;  3D96 A;  4O4O A;  2AT6 X;  1U17 A;  2OFR X;  3CWK A;  3VG5 A;  3ZW1 A;  5H8T A;  3CQN A;  4AZO A;  4I9S A;  1VYF A;  4OS0 A;  1JJJ A;  1O8V A;  2L5P A;  2DM5 A;  1KT4 A;  4XMC A;  2A2U A;  1LIF A;  2AMM X;  4MIS A;  3ELZ A;  4D6B A;  3WJD A;  2FS7 A;  4UU3 A;  2GTL O;  1HMT A;  2XST A;  3LV4 A;  4ORW A;  3NP1 A;  1PBO A;  2WEW A;  3WJE A;  3WJB A;  4GKC A;  1AB0 A;  2F09 A;  2KD2 A;  4U9C A;  2JOZ A;  3APX A;  4I3C A;  4M6S A;  3P24 A;  3KFH A;  1BJ7 A;  3LHN A;  1YP7 A;  3S60 A;  2RCQ A;  1DZJ A;  1S7D A;  4ID2 A;  1DZK A;  4YBU A;  4YCE A;  1FTP A;  3UEX A;  5L8O A;  4NLI A;  2GC9 A;  2OVD A;  1QWD A;  2ASN X;  4LQZ A;  1HMR A;  1ADL A;  1FE3 A;  2A3F X;  2BLG A;  5HZQ A;  5EDB A;  1ZNG A;  4LZU A;  4YDA A;  2BS6 A;  3FR4 A;  1BM5 A;  3D97 A;  4HWM A;  4FBR A;  2OFM X;  4U3Q A;  5CYB A;  4JGL A;  4A60 A;  3STK A;  1T0V A;  1ALB A;  3QKG A;  4HPC A;  3FMZ A;  4L1N A;  3S26 A;  2QM9 A;  5B29 A;  3FEN A;  1MX7 A;  2E4J A;  1FDQ A;  2W2A A;  4HPD A;  5BVS A;  2ZAI A;  1A2D A;  3SAO A;  1OEK A;  2XKL A;  2MM3 A;  5LJG A;  1RLB E;  4PSQ A;  4IAW A;  2R56 A;  3JS1 A;  1DZP A;  3U0D A;  1EPB A;  1LF7 A;  3HOL A;  5HTE A;  4ODD A;  1LIB A;  4O3W A;  3ELX A;  3BX7 A;  3E3C A;  4AZR A;  4IMO A;  5BVQ A;  5FEN A;  1IKE A;  4ZR2 A;  3ZZV A;  4YFQ A;  4QGV A;  3I17 A;  4FBV A;  3EBW A;  1GT1 A;  2L68 A;  1TXL A;  4NNT A;  3PEC A;  3EM0 A;  1ZRY A;  1N0S A;  3NX2 A;  4GZV A;  3JQO A;  5KIC A;  2X8T A;  4FQB B;  1IIU A;  4QYP A;  3VE2 A;  4NYQ A;  2FRS A;  4ES7 A;  2QOS C;  1B4M A;  5EEE A;  2NNE A;  5JR8 A;  3IFB A;  4I9R A;  3RWX A;  1KQW A;  1FEN A;  1YWD A;  3HOE A;  1E5P A;  4ZCB A;  3PP6 A;  1IW2 A;  1UZ2 X;  2ZAG A;  4GU8 A;  4O49 A;  1A57 A;  1HBQ A;  3B2K A;  4AZQ A;  1TOU A;  1EUO A;  5EZ2 A;  2FWV A;  3PQU A;  2CBR A;  2LBA A;  3O2Y A;  4UU2 A;  3S5V A;  3STM X;  3U9P C;  1CBS A;  1HQP A;  3FW4 A;  2Q39 A;  3WBG A;  1T8V A;  3I0A A;  3VG2 A;  1SXW A;  1BSO A;  5HTD A;  1YUP A;  1BRP A;  1CBI A;  4YCH A;  3FEP A;  5L8I A;  4ZH9 A;  1EXS A;  1BRQ A;  4MVE A;  2WR6 A;  1DF3 A;  3WOV A;  4NNS A;  4MIR A;  2HMB A;  3NPO A;  2M4L A;  5D8J A;  2WEX A;  2FS6 A;  3DSZ A;  3G7X A;  1LFO A;  5IO6 A;  4TLJ A;  4BVM A;  5LKF A;  1LID A;  5D45 A;  2MJI A;  4KC8 A;  4GE1 A;  4TKH A;  1HBP A;  4YH0 A;  2R74 A;  3C78 X;  4O3X B;  1TW4 A;  4TQ2 A;  4ZHF A;  4MVL A;  3FA7 A;  4ORS A;  4FGI B;  1KZX A;  4XMF A;  1OEE A;  3FLL A;  4GNW A;  3CBC A;  1I04 A;  5F58 A;  3IA8 A;  5LJH A;  1GT5 A;  3KFF A;  3ZUI A;  3VE1 A;  1LNM A;  5AJC A;  4OS8 A;  5HZ9 A;  2JU7 A;  3P6D A;  2CM4 A;  3STN A;  1GM6 A;  1I4U A;  2PY1 A;  3N91 A;  1A3Y A;  2RN4 A;  1TVQ A;  2CBS A;  3F9D A;  2QO4 A;  3BSZ E;  4GET A;  5D47 A;  4BQU A;  3HK1 A;  5HA0 A;  2MWH A;  1L6M A;  1ZNE A;  3APV A;  5HZ5 A;  5LKE A;  2ACP X;  2ANS A;  1OBQ A;  1XKI A;  1H91 A;  3FEL A;  2WQA E;  2LFO A;  4QYN A;  2JU8 A;  3DTQ A;  2F73 A;  3FIQ A;  3K3L A;  4IB8 A;  3VG4 A;  4AZN A;  1XCA A;  4TKJ A;  3NQ9 A;  2BHV A;  3TF6 A;  2Q2M A;  5B27 A;  2NND A;  4ALB A;  1X8O A;  3EMM A;  5HCD C;  2FTB A;  1S44 A;  1D3S A;  3NQ3 A;  3VG7 A;  4ORU A;  1B0O A;  3OD9 A;  2NNQ A;  1SY1 A;  3AKN A;  4I3B A;  3UEV A;  1E06 A;  4ML7 B;  3CQR A;  1T68 X;  1YWB A;  3UEU A;  4U8U O;  4XMH A;  1X8U A;  2W2F A;  4KT5 A;  2X8S A;  3NAD A;  2HLV A;  2LBV A;  1EQD A;  3GAQ A;  4ON1 A;  4AW8 A;  2WSJ A;  3D4R A;  4ZH6 A;  1KZW A;  5LJD A;  2Z4I A;  1QG5 A;  2KW1 A;  1VYG A;  1GKA B;  2BS5 A;  4BOE A;  4IMN A;  3NQK A;  3BDR A;  5FQ7 E;  4O4X A;  3GE2 A;  3V8U A;  3FA9 A;  2P8G A;  2FLJ A;  5C0N A;  2JW1 A;  2L9C A;  4YMY A;  5LJC A;  5HCC C;  2EU7 X;  4I3D A;  4Y0S A;  1DC9 A;  4XME A;  3KFG A;  4IAB A;  5CE4 A;  5HZ8 A;  4RUN A;  1ICN A;  1ZNH A;  3BU9 A;  4IB9 A;  4CSB A;  1MDC A;  1O1V A;  3BU1 A;  3VG6 A;  2RD7 C;  1Y9T A;  3PH5 A;  1SXU A;  4N7C A;  4QNI A;  4AYH A;  2QMI A;  1O1U A;  5EPQ A;  2W2B A;  1GKA A;  2OVA A;  3S5X A;  1AVG I;  3B2I A;  4EQA C;  2MO5 A;  3C77 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...