1IFDA

Model-building studies of inovirus: genetic variations on a geometric theme
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOVIRUS
publication title Model-building studies of Inovirus: genetic variations on a geometric theme.
pubmed doi rcsb
source organism Enterobacteria phage fd
molecule tags Virus
total genus 22
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1992-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ifdA00
1FDMA 2CPSA 1HH0A 1NH4A 2MJZA 1HGVA 2CPBA 1IFDA 1IFIA 2C0XA 2C0WA 1HGZA 1IFJA
chains in the Genus database with same CATH superfamily
2N1TA 3MHVA 3MUDA 4QMAA 2Z5IA 4PV1C 1EZVE 3OA7A 1X0TA 3KXDA 3RGUA 2NPSD 3L72J 1JEKA 4EI2A 4GDOA 3O6QA 1EDJA 4IL6E 2YIUC 5DJUB 3CXHH 1VQ9P 3H1HE 2RH0A 2ZT9B 3CC2P 2C9LY 3H1IJ 3NFQA 5KLIC 1JY2O 2KZJA 1GL2D 1M7LA 1T3JA 2FYUG 1SQXK 3PLNA 5CCHD 1R8EA 5TISE 3HUSB 3B4SA 4U3FE 4H44C 3NMDA 1RF0A 4Y99C 1PGPA 5KKZB 2P1JA 3T97B 2MKVA 1OFCX 1ZP0C 1NU1E 2WSSH 5EFWB 1JCCA 3AEGC 4R4LA 5KLVJ 3TSIA 1OZHA 2J59M 1GU4A 1AV1A 3CWBG 2WSFH 1M1KQ 4HH2A 3WUUA 3HUSA 4C7NA 3QH9A 3CX5D 2YMKA 5AW3B 2WPRA 1SQBJ 2E43A 3T97A 1P84I 2J58A 4OWFA 4KJMA 2WITA 3OJAB 1LTAC 2IBZI 2D2CD 1NTKJ 3U1CA 1QL2A 4OGQB 1N7SC 3MD0A 1NVOA 1PP9J 5BU8B 4GT1A 1KILC 3LW5H 3M0AA 3MTUE 5AVTB 4LGDE 1BCCJ 3KDPB 3L36A 4WY4C 4WVZA 1URQC 3V4WA 1VF5C 1SQVD 3H1JD 4GOEA 1J1DC 1DD4A 5E79H 3GF7A 3HE5B 2KK7A 1NTZK 2KIKA 1EQ7A 3RK3B 2KZIA 3CWBE 1XTGB 2ITAA 3L74D 3P8CE 3V2PA 2WZ7A 3V5BA 4C7RA 1N7LA 2IFMA 2AXTE 1NJIQ 1YBKA 2QRXA 1CZQA 4KHXA 3HE5A 1Q2NA 2XV5A 3W68A 3RK2B 5GTIE 4PD4I 1J1EC 3V4QA 1FOSE 1SQXD 3AECC 3L73E 1Y9BA 2E5YA 1FZCB 1Q90D 1JY3P 2R3SA 3L72G 4WBAA 1SQPJ 1FJKA 3SFDC 1ZRTE 4DT0A 1LTSC 1ZW0A 3H1IG 2R5DA 1PFIA 4UB8H 3KPEA 2WSEJ 2Z4EA 2Q3EA 4H44D 1FZCA 2HYNA 3D6YA 2BEZF 1Q82Q 5AW8B 2E74C 2BCCD 2QM8A 3BASA 1RF1B 2M3EA 5KAIH 3CCVP 2WSFJ 5B66H 2G3AA 1L0NK 3AE7C 1OMIA 5KLVG 1FZGA 1W2EA 3AE9C 2Q6QA 4XA4A 3A0BH 5CCGC 2A45I 2LXBA 2NPSA 4K35A 2FY8A 5AW0B 4H13C 1JY3N 2OQQA 1UIXA 1HGVA 5GTHH 3L72E 5L8RJ 1KTMA 1KV4A 1SQBG 1SLQA 3L75D 1S9KE 5APXA 1HBWA 1GW3A 1GL2A 3FWNA 1NTZD 1NTKG 2YKOA 5CCHA 1D7MA 3HRNA 2A45G 3BCCD 2QG4A 3GW6A 4I1LA 3NTNA 1M56D 3IAOA 1PP9G 3SFEC 1A02F 1NU1J 1NO4A 1QVGO 1LWUC 4I7ZB 3V2NA 2QJPB 4GIFA 3GMAA 2FBWC 1A02J 3KZIE 1BCCG 4N78E 3PTZA 1URQD 1VF5D 1T3UA 2D2CB 5CJ0A 3RBXA 2YKPA 3HE4B 4WWIA 3VMZA 5KLVE 3PJSK 2Q7CA 1RE4C 2H89C 1BGYD 2P10A 2FYUK 1GZLA 1SFCC 1YI2P 3B5NC 5AVYB 1JMBA 1BE3E 3VP9A 4YPCA 3WMM0 2XZRA 4LC1A 2W83C 2A06D 2W8ZA 3L70D 3M0DC 3Q1MA 2H7HA 1SQBE 2NRGA 3AEEC 1VDFA 3HE4A 1KQSO 2KNCB 1NTKE 2IZ1A 3IFMA 3VTPC 1Y8AA 3CMEP 3TGUJ 4JYBA 1JOCA 3AE1C 1M1JB 2KLUA 1SQPG 1S1CX 1N86A 1BCCE 1N73C 3Q5RA 4PD4H 3JC22 1AQ5A 2OGUA 1WT6A 3CLQA 2QJYC 3IF4A 4JF7A 1SS1A 1EZVI 1L0ND 2L5GB 2Q1KA 3WU2H 1K05A 3VMXA 1FDMA 1IK7A 2OTLP 1JY2P 3ITKA 2KXPB 2I1JA 3AEFC 4IL6X 4C46A 3HD7C 3BRTB 3WUTA 3AEAC 2OYHC 1QLED 3H1LJ 1UIIA 1EXJA 4DJGA 1M1JA 5KLIB 3H32B 3S9OA 2O1JA 1U7MA 2IX7C 3L73J 2XKMA 3JCUE 1H89A 2P58A 1RE3C 4H44B 3L35A 2I1KA 2B9BA 4Y99B 2G8YA 1S4XA 2K1AA 3M9HA 4H13D 1LTJB 1IFIA 4JBZA 4B86A 1SQPE 2QIWA 1USEA 1IK9A 5APVA 3HTKB 1L4AC 4HYTB 3H32A 1KC8Q 2M5AB 2OYOA 1GU5A 1SQQD 2LXCB 1S5LX 4NPEA 1JY2N 1KB9I 2ZAEB 1NU1G 2FYUD 2R44A 1EDLA 3TF5A 1LTJA 4BXLA 2PAJA 2JP3A 2M3BA 2Q5UA 1M90Q 1RQVA 3H1KD 1H8AA 3HTKA 3L71D 1HWTC 3UIAA 1KYOI 5AW1B 1L0LJ 2M5AA 1KILB 1SFCD 2FYNC 2JO1A 4WY4B 2KB7P 1URQB 4BWNA 4JPZB 1VF5B 5KJ7C 2FFDC 3A2AA 1SQVJ 3P8CD 3C1LA 1ZV8A 2WPQA 5B5EE 3TK1A 3EFFK 2O3JA 3VMYA 1JTHB 1FE6A 2GA1A 2W27A 3M91A 1LT9C 4PJ0H 4D6TE 3KYQA 2ZXXA 1NKZB 3L74J 1LTTC 2Y0DA 2GM4A 4O9BA 1FDOA 3TGUG 1URQA 5E79E 3CD6P 4W7YA 1SQBK 3A0HE 1P84D 1JTHA 2PFXA 3V6IA 2OYIC 1BE3J 1J1EB 2QEXP 2IBZD 1NTKK 3H25A 3GLMA 1FDIA 3D71A 2WSCJ 1SQXJ 5KAFE 3CCJP 1HH0A 1KB9E 1S5LE 3RK3E 1SP4A 3MUDC 3HD7D 2R3CA 2YNYA 1JO5A 3H1LG 1MUUA 1OW8A 2O01N 4GKGA 3LIDA 3VOPA 1H0TB 2KSJA 2I8DA 5AW4B 2E42A 4EYYQ 1OVRA 3AE5C 3L73G 4K3AA 3CCEP 1VQ6P 1KYOE 2CPBA 1KFNA 2JEEA 3RL0C 3G3ZA 2O1KA 1NYHA 3BRVB 1EDIA 2K3RA 4UB6E 3AE6C 3TGUE 1YJNP 1NKNA 5TISH 2B88A 1Q7YQ 1RF0C 3SWKA 5BU5A 3BVHA 2JR8A 3O8ZA 1L4AD 2AEJA 2KSEA 1GTWA 2KOGA 1ZLLA 1YYCA 1YIJP 4H13B 3H1ID 2ZT9C 2CK3H 4PD4D 1VQKP 1YTZT 2V4HA 5KAIE 1PGQA 1NTMJ 5B66E 3H1LE 1SQPK 3L75J 4W80A 2DW3A 3SSUA 1NTZJ 5KKZC 3A0BE 2H8PD 2K9YA 1OXZA 4PV1D 2R32A 3BCCJ 3CCMP 1L0LG 1LWUB 2WMMA 2B89A 1VQOP 3L37A 1GK6A 1RHZB 2YXQB 3I5CA 2N9YB 1EXIA 1RH5B 5AVUB 4ZMDA 4U7JA 2W6AA 2Y0EA 1FBMA 3CCRP 1SQVG 2KUBA 5AVSB 2RN0A 1Q81Q 1KQGB 2ZJSE 5K5GB 2Y9YA 2KS1B 5H2FE 5APSA 1SFCB 1BGYJ 3A3YB 2MJZA 3M06A 2HLOA 2C9NY 1NTKD 1OX3A 3L74G 1LWUA 4HJGH 1ZXGA 1FZEA 1MV8A 4IFMA 4OGQC 1PP9D 3EWKA 4A7PA 3CX5E 3E1RA 2KLVA 3N7NA 2PP6A 1IFDA 3MGNA 2FXPA 1M57D 1J2JB 1IJDB 1HJ0A 1RE4A 2KS1A 3F5HA 1YHQP 1BE3G 2AXTH 1MZ9A 4WB4A 3CL3D 1SFCA 1HVVA 4AYCA 1SQXG 1L0LE 2VRSA 1QX8A 1PPJG 2V7QH 1NU1K 3RK3C 4NPDA 2K37A 2W90A 3R4YA 1RF1A 4D6TJ 3CPWO 2OTJP 3L4FA 1BDDA 1SQVE 4GODA 2QJYB 1VQ7P 3LW5J 1N7SD 1L0NJ 3OAKA 1DH3A 3R2PA 1P84H 4ZKUA 3HD7B 1KILD 1WMKA 1NAYA 2H88C 1S3JA 2HPCB 3L74E 4L76A 4WY4D 2BEQD 3RK2C 4OVNF 5M1BA 3CCSP 1K73Q 1KFMA 5AVXB 2N9BA 3AE2C 3AE8C 1X79B 2QM7A 3WUVA 1IFMA 1EDKA 1GW4A 3QWOC 5AVWB 3HD7A 2OTKE 1SQXE 3CXHI 3Q5PA 1Z56A 2XU6A 4ZKPA 2HPCA 3C9IA 1PPJE 3PH0A 2NPSC 3I55P 2ZYGA 2LR2A 1VPCA 1NTMG 3VN0A 4MN4C 2ZYDA 1L4AB 2IPPA 2E75C 1T2KC 3L75G 4CPGA 4YTPC 1NTZG 4M3LA 3KHUA 1MKMA 1SQQJ 3BCCG 4DZOA 1GDTA 1EZVD 2JJLA 1GL2C 1IFPA 3K5BA 5CHXA 2ZYAA 5CBNA 5APTA 5AW7B 5APYA 2QVAA 1S2EA 2WTYA 3H1HD 5CBOA 3H1KJ 4HKZH 1L4AA 2FYZA 4PV1B 3CCUP 3L71J 3ZDMA 4JYCA 2KNCA 1SVFA 1BGYG 3U59A 2AXCA 1FC2C 5APUA 2B87B 2YIUB 1LNQA 2K88A 2FFDB 1YJ9P 4U3FD 1BSHA 2AEMA 2E74D 1PV3A 1KORA 1NU1D 1KN7A 1LT9B 1S72P 4ZNCA 1GMJA 1NTME 1JB0J 1NH4A 1E79H 3TDKA 3BATA 3L75E 1VQPP 3MP7B 1HTLC 5CCGD 1OWAA 1NTZE 1W5CE 2WVRA 4W7ZA 1DIPA 2P67A 3BCCE 4H0LC 2JWDA 3CCQP 2M8RA 3CXHE 1KB9D 2B87A 2FFDA 2XNDH 2HODB 2E76C 2A45H 4D6TG 1R5SA 1LP1B 3U1AA 2OYIB 5APQA 3TNUB 1LT9A 3GHGC 4YXDC 3N4XA 2BASA 1L0NG 4L74A 5AVRB 3G4SP 1BGYE 1U57A 1KYOD 1OW6A 3SWYA 1L0LK 1RQUA 2PGDA 1FAVA 1G1JA 3ABVC 1X8YA 1LTGC 2L91A 2A06E 1N7SB 2HODA 4IFFA 1AJYA 1DD3A 2OYIA 2CPSA 3RL0g 2R5BA 4AQRD 1FU1A 1IZNB 3B5ND 1PGOA 2AEFA 3CWBD 1N8RQ 1LTIC 3F89A 2FXOA 1J1DB 1PIXA 1QVFO 2K9JB 3H1JJ 3JCUH 3G71P 2LKMA 2KYVA 1DEBA 1IC2A 3M9QA 1ZOYC 2E75D 3AE4C 3FX0A 1N7SA 4N6JA 1T2KD 2J5UA 3H1LD 5KLVK 3M9BA 1PZQA 4I6MC 4TLFA 1SQQG 1L0NE 1KILA 3CMAP 2QA4P 1QEXA 2GUSA 4TT3H 1FS0E 1HF9A 3L73D 1NAFA 4WY4A 3W67A 4I2LC 2IYPA 2K9JA 4C7NB 1LTBC 1ZN5A 3GG2A 2P2UA 3CI9A 1ZRTD 4EOTA 2WSEH 3H1KG 1CI6B 1LTJC 3L71G 2XDJA 2QJKC 4DOJA 2N1TC 3D70A 2WPVB 2RMZA 3EFGA 1USDA 1G1IA 2FKWB 1DX7A 3RBZA 1JNMA 3LIEA 2HFED 2IYOA 4IL6H 5B5EH 3CC7P 1CI6A 5AVVB 1RY3A 4L73A 1SQQE 4H0LD 2YXRB 2E74B 2O01H 3D6ZA 3USSA 2BCCJ 2FYUE 3CX5I 1L0LD 1VQ5P 2XNXA 3L72D 2E76D 4DCKA 3A5TA 1YQ3C 1NWQA 1H0TA 1NTMK 1OW7A 2Z5HA 1OVVA 4UB8E 5C39A 1JUNA 1S9KD 5DJTB 4OH8B 5AW5B 1JM0A 2KP8A 3H1KE 1HJBA 1AQTA 2IBZG 3L71E 2YKQA 1KZUB 3FGAD 2ZFCA 3NXSA 3A0HH 2QE7H 1LT1A 5AVZB 3G9RA 2Q3IA 3FWLA 3B71A 3HUSC 4N78D 1M8OB 1QGKB 5KAFH 1KB9H 1T8ZA 3VMAA 3P8MC 1S5LH 3P32A 3CC4P 2YMYA 2H43A 5CCGA 1LJ2A 1QL1A 5KLVD 1E5WA 2IZ0A 5GTHE 2OARA 1BE3D 5KJ7D 2WT7B 4RO0A 1BDCA 3H1JG 1KYOH 2JDIH 2YO3A 1K04A 5AVQB 1PPJD 2W6BA 3Q2YA 2JKVA 1SQBD 1VQ4P 4UB6H 3B5NB 1OIPA 4GOFA 1P84E 5KTBA 4RJTA 1H88A 2IBZE 3AEDC 1YITP 3JSVC 1VQLP 2NPSB 1FZBA 3L70J 2YO2A 2Y9ZA 2WT7A 1KQLA 1NGMB 1PGJA 2E75B 1BCCD 1YJWP 2WPSA 4HB1A 1VQNP 1X9VA 1BSNA 2C0WA 1TU3F 1EC5A 2W6JH 3B5NA 3B8EB 4KT0J 1GL2B 2N1TD 1PL5A 4ASWA 1JCDA 4EDFA 5GTIH 1N73B 1AFOA 4EIJA 3MZWB 1JMMA 3PRJA 3M0DA 2ZXEB 1FJPA 3E7KA 1VQMP 3H1JE 1YTZI 3H1HJ 3II6A 5AW2B 3FXEA 1MFZA 1ZR2A 3E1IA 1NTMD 2O01J 5AW6B 2IDBA 3RL0D 4IOIH 2OYHB 1G2CB 3Q5SA 2QSIA 4U3FJ 3CCLP 1NHLA 2WQYC 2UWJE 5H2FH 3H1IE 1OVUA 1N73A 4PD4E 4XFJA 2BCCG 4Y28J 3CXHD 3PP5A 1KD1Q 1FZCC 5CJ4A 1SQPD 3WU2E 5APWA 3Q3DA 4Z1MH 1CSBA 4R4MA 1KQFB 4BRYB 1VQ8P 1W2BO 1VL2A 3CX5H 4H0LB 1GK4A 3S4RA 2ZT9D 4YXWH 1SQQK 3AEBC 3P7KA 3EQ2A 2OYHA 1G2CA 1JY3O 5BVZA 2Q9IA 3PHLA 2E76B 3V2RA 1L2PA 2KI7B 3OW2O 1IFNA 4L75A 2ZVNB 3GHGB 1YQ4C 1RE3A 1RF1C 1NOHA 3A7OA 1FZAA 2HR3A 4NPFX 4BRYA 2FYUJ 2FXMA 3SWFA 2RKLA 5CCHC 1AVOA 2P7JA 5AW9B 1N2DC 1PP9E 2BCCE 2NZ2A 3H6PA 3I56P 3KZIH 3GHGA 4LLHA 3S1KA 3IR9A 4D6TD 2FYNB 1CW5A 3CWBJ 1K9MQ 3FXDA 5CMZA 1MFTA 1K8AQ 1R5LA 4OGQD 1ZMEC 2A06G 3L70G 2Y0CA 1AVYA 4I7ZC 1HGZA 2QJPC 1X22A 2WSCH 1Q86Q 2WWWA 3GF3A 1T6AA 3C8VA 1FOSF 2V7QJ 1KMIZ 1XTCC 2ZVOB 1WRGA 2D2CC 2SPZA 1FZFA 2POHA 4ASVA 1EZVG 5KJ7A 1IO4A 4RKUJ 1Y47A 1KILE 3RK3D 1HUCA 2C0XA 1U7JA 3TYYA 1IFJA 3G6EP 4PJ0E 3KQGA 3IN6A 3MIWA 3H1HG 2QJKB 1GD2E 1LGHB 2M0BA 5TJHA 2N1TB 4JQ0D 3VYIA 3AE3C 1ZR4A 2IFNA 1DEEG 2HG5D 3RK2D 2JWAA 4U3FG 3VP8A 4XE5B 3O6QB 4IFDK 2PRRA 3L70E 1SQVK 3TGUD 1LP1A 2E5TA 1AA0A 3TNUA 4AUWA 1M1JC 2GUVA 4RESB 3RL0B 4N3YB 3V2QA
chains in the Genus database with same CATH topology
2XNXA 1RE4A 2N1TA 1JOCA 1MZ9A 4WB4A 1M1JB 3MUDA 3CL3D 3A5TA 1SFCA 1NWQA 1HVVA 1N86A 1N73C 2Z5IA 1NTMK 2Z5HA 4AYCA 3OA7A 1JUNA 2VRSA 1AQ5A 2NPSD 1S9KD 5AW5B 4OH8B 1WT6A 1NU1K 3RK3C 2KP8A 3CLQA 1HJBA 4JF7A 2YKQA 2L5GB 1KZUB 1RF1A 3VMXA 1FDMA 2ZFCA 3NXSA 1JY2P 3L4FA 5AVZB 2I1JA 2Q3IA 4C46A 3HD7C 1N7SD 3OAKA 3BRTB 1DH3A 3R2PA 2C9LY 2OYHC 3NFQA 3HUSC 4N78D 1JY2O 1GL2D 1M7LA 1T3JA 1T8ZA 1SQXK 3P8MC 4ZKUA 5CCHD 3HD7B 3P32A 1KILD 1M1JA 3HUSB 3H32B 2HPCB 2YMYA 2H43A 4WY4D 2O1JA 5CCGA 3RK2C 3NMDA 2IX7C 1QL1A 1RF0A 2XKMA 4Y99C 1E5WA 2P1JA 1H89A 1KFMA 1RE3C 5AVXB 3L35A 2OARA 1JCCA 2I1KA 2N9BA 5KJ7D 4Y99B 2WT7B 1X79B 2QM7A 3M9HA 3TSIA 1LTJB 1IFMA 1IFIA 2J59M 2YO3A 1GU4A 5AVQB 2WSFH 1GW4A 2W6BA 4B86A 5AVWB 4HH2A 3HD7A 1IK9A 5APVA 3B5NB 3HTKB 5KTBA 3HUSA 1L4AC 1Z56A 4C7NA 2XU6A 4HYTB 4ZKPA 3H32A 2HPCA 3C9IA 2NPSC 1H88A 5AW3B 1VPCA 1GU5A 2WPRA 2E43A 3T97A 3VN0A 1JY2N 1L4AB 2IPPA 2J58A 1T2KC 2NPSB 2WITA 1FZBA 3OJAB 2YO2A 1LTAC 2WT7A 1KQLA 4M3LA 3U1CA 1QL2A 1N7SC 1LTJA 4DZOA 1GDTA 3MD0A 2WPSA 2PAJA 2JJLA 2M3BA 2Q5UA 1GL2C 5CHXA 5BU8B 1X9VA 5APTA 2C0WA 4GT1A 1KILC 3LW5H 5AW7B 3M0AA 3MTUE 5APYA 3B5NA 5AVTB 3B8EB 3HTKA 4LGDE 1H8AA 3KDPB 1HWTC 1GL2B 3L36A 3UIAA 5AW1B 4WY4C 2N1TD 1URQC 3V4WA 1KILB 2WTYA 1J1DC 1JCDA 1SFCD 3HE5B 1N73B 1AFOA 1L4AA 2FYZA 1NTZK 4WY4B 2KB7P 4EIJA 1JMMA 1URQB 3M0DA 4JYCA 2ZXEB 5KJ7C 1SVFA 3A2AA 2FFDC 1FJPA 1EQ7A 3RK3B 3P8CD 1ZV8A 2WPQA 1YTZI 3TK1A 3U59A 3II6A 5AW2B 1XTGB 1MFZA 5APUA 1ZR2A 3VMYA 1JTHB 3E1IA 2FFDB 2W27A 3M91A 1LT9C 3P8CE 5AW6B 3KYQA 3V2PA 2WZ7A 3V5BA 3RL0D 4C7RA 1N7LA 2IFMA 2OYHB 1NKZB 1G2CB 1LT9B 1NH4A 1NHLA 1LTTC 1CZQA 2GM4A 4KHXA 3BATA 3HE5A 4O9BA 1N73A 1HTLC 5CCGD 1URQA 2XV5A 1OWAA 3RK2B 3PP5A 4W7ZA 1FZCC 5CJ4A 2P67A 3V4QA 1J1EC 4W7YA 5APWA 1FOSE 1SQBK 2M8RA 1CSBA 1JTHA 1FZCB 2FFDA 1JY3P 2OYIC 4WBAA 1J1EB 1GK4A 2HODB 1NTKK 2A45H 1SQQK 1FJKA 3P7KA 3EQ2A 3U1AA 2OYHA 1HH0A 2OYIB 5APQA 3TNUB 1G2CA 1LT9A 1JY3O 1SP4A 5BVZA 2Q9IA 3GHGC 3HD7D 3N4XA 1LTSC 3V2RA 2BASA 2R3CA 2YNYA 1JO5A 1IFNA 2R5DA 5AVRB 1MUUA 1PFIA 3KPEA 3GHGB 3SWYA 1L0LK 4GKGA 3VOPA 3LIDA 2KSJA 2Z4EA 5AW4B 2E42A 1RE3A 1RF1C 1NOHA 1FAVA 3A7OA 1G1JA 1FZAA 1FZCA 2HYNA 2CPBA 1X8YA 5AW8B 2FXMA 3SWFA 1KFNA 1LTGC 2QM8A 3BASA 5CCHC 1N7SB 2HODA 2JEEA 1RF1B 3RL0C 3G3ZA 2P7JA 4IFFA 2O1KA 5AW9B 2OYIA 2CPSA 1L0NK 3BRVB 2R5BA 1FZGA 1W2EA 4AQRD 1FU1A 1N2DC 4XA4A 3B5ND 3H6PA 1NKNA 1LTIC 5CCGC 2A45I 2NPSA 1RF0C 3GHGA 5BU5A 4LLHA 1J1DB 3BVHA 3O8ZA 3IR9A 5AW0B 1L4AD 1CW5A 1JY3N 2LKMA 2KYVA 1DEBA 1GTWA 1HGVA 2KOGA 1ZLLA 1IC2A 5CMZA 1YYCA 3M9QA 1N7SA 4N6JA 1SLQA 1T2KD 5KLVK 3M9BA 1S9KE 5APXA 1HBWA 1YTZT 1GW3A 4I6MC 1GL2A 2YKOA 5CCHA 1KILA 1HGZA 2A45G 3HRNA 2GUSA 4I1LA 3NTNA 1SQPK 2WSCH 2WWWA 1NAFA 1A02F 4W80A 4WY4A 1NO4A 1FOSF 1LWUC 1XTCC 4I2LC 1WRGA 3V2NA 4GIFA 1A02J 4C7NB 2H8PD 1LTBC 1OXZA 2POHA 1ZN5A 1FZFA 2R32A 4N78E 2P2UA 1URQD 1LWUB 5KJ7A 3CI9A 1IO4A 3L37A 1T3UA 3RK3D 1GK6A 5CJ0A 4EOTA 3I5CA 2WSEH 2YKPA 1CI6B 1LTJC 1HUCA 2C0XA 2XDJA 3HE4B 5AVUB 3TYYA 1IFJA 4DOJA 2W6AA 3VMZA 2Q7CA 1RE4C 3KQGA 2N1TC 1FBMA 5AVSB 3MIWA 2FYUK 1GZLA 1SFCC 3EFGA 3B5NC 5AVYB 1GD2E 3VP9A 1LGHB 2N1TB 3WMM0 1G1IA 2FKWB 5APSA 3VYIA 1DX7A 2XZRA 1SFCB 1JNMA 1ZR4A 4LC1A 3A3YB 2IFNA 3LIEA 2MJZA 3M06A 2HLOA 3M0DC 2HG5D 2C9NY 2HFED 3RK2D 2H7HA 1LWUA 3VP8A 4XE5B 1FZEA 1MV8A 4IFMA 4IFDK 1CI6A 1VDFA 1SQVK 3HE4A 5AVVB 2KLVA 1RY3A 3N7NA 2PP6A 3TNUA 1IFDA 3IFMA 4AUWA 3MGNA 1M1JC 2GUVA 2O01H 4RESB 3RL0B 1J2JB 4N3YB 3VTPC 1IJDB 3V2QA 4JYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FDM A;  2CPS A;  1HH0 A;  1NH4 A;  2MJZ A;  1HGV A;  2CPB A;  1IFD A;  1IFI A;  2C0X A;  2C0W A;  1HGZ A;  1IFJ A; 
#chains in the Genus database with same CATH topology
 2N1T A;  3MHV A;  3MUD A;  4QMA A;  2Z5I A;  4PV1 C;  1EZV E;  3OA7 A;  1X0T A;  3KXD A;  3RGU A;  2NPS D;  3L72 J;  1JEK A;  4EI2 A;  4GDO A;  3O6Q A;  1EDJ A;  4IL6 E;  2YIU C;  5DJU B;  3CXH H;  1VQ9 P;  3H1H E;  2RH0 A;  2ZT9 B;  3CC2 P;  2C9L Y;  3H1I J;  3NFQ A;  5KLI C;  1JY2 O;  2KZJ A;  1GL2 D;  1M7L A;  1T3J A;  2FYU G;  1SQX K;  3PLN A;  5CCH D;  1R8E A;  5TIS E;  3HUS B;  3B4S A;  4U3F E;  4H44 C;  3NMD A;  1RF0 A;  4Y99 C;  1PGP A;  5KKZ B;  2P1J A;  3T97 B;  2MKV A;  1OFC X;  1ZP0 C;  1NU1 E;  2WSS H;  5EFW B;  1JCC A;  3AEG C;  4R4L A;  5KLV J;  3TSI A;  1OZH A;  2J59 M;  1GU4 A;  1AV1 A;  3CWB G;  2WSF H;  1M1K Q;  4HH2 A;  3WUU A;  3HUS A;  4C7N A;  3QH9 A;  3CX5 D;  2YMK A;  5AW3 B;  2WPR A;  1SQB J;  2E43 A;  3T97 A;  1P84 I;  2J58 A;  4OWF A;  4KJM A;  2WIT A;  3OJA B;  1LTA C;  2IBZ I;  2D2C D;  1NTK J;  3U1C A;  1QL2 A;  4OGQ B;  1N7S C;  3MD0 A;  1NVO A;  1PP9 J;  5BU8 B;  4GT1 A;  1KIL C;  3LW5 H;  3M0A A;  3MTU E;  5AVT B;  4LGD E;  1BCC J;  3KDP B;  3L36 A;  4WY4 C;  4WVZ A;  1URQ C;  3V4W A;  1VF5 C;  1SQV D;  3H1J D;  4GOE A;  1J1D C;  1DD4 A;  5E79 H;  3GF7 A;  3HE5 B;  2KK7 A;  1NTZ K;  2KIK A;  1EQ7 A;  3RK3 B;  2KZI A;  3CWB E;  1XTG B;  2ITA A;  3L74 D;  3P8C E;  3V2P A;  2WZ7 A;  3V5B A;  4C7R A;  1N7L A;  2IFM A;  2AXT E;  1NJI Q;  1YBK A;  2QRX A;  1CZQ A;  4KHX A;  3HE5 A;  1Q2N A;  2XV5 A;  3W68 A;  3RK2 B;  5GTI E;  4PD4 I;  1J1E C;  3V4Q A;  1FOS E;  1SQX D;  3AEC C;  3L73 E;  1Y9B A;  2E5Y A;  1FZC B;  1Q90 D;  1JY3 P;  2R3S A;  3L72 G;  4WBA A;  1SQP J;  1FJK A;  3SFD C;  1ZRT E;  4DT0 A;  1LTS C;  1ZW0 A;  3H1I G;  2R5D A;  1PFI A;  4UB8 H;  3KPE A;  2WSE J;  2Z4E A;  2Q3E A;  4H44 D;  1FZC A;  2HYN A;  3D6Y A;  2BEZ F;  1Q82 Q;  5AW8 B;  2E74 C;  2BCC D;  2QM8 A;  3BAS A;  1RF1 B;  2M3E A;  5KAI H;  3CCV P;  2WSF J;  5B66 H;  2G3A A;  1L0N K;  3AE7 C;  1OMI A;  5KLV G;  1FZG A;  1W2E A;  3AE9 C;  2Q6Q A;  4XA4 A;  3A0B H;  5CCG C;  2A45 I;  2LXB A;  2NPS A;  4K35 A;  2FY8 A;  5AW0 B;  4H13 C;  1JY3 N;  2OQQ A;  1UIX A;  1HGV A;  5GTH H;  3L72 E;  5L8R J;  1KTM A;  1KV4 A;  1SQB G;  1SLQ A;  3L75 D;  1S9K E;  5APX A;  1HBW A;  1GW3 A;  1GL2 A;  3FWN A;  1NTZ D;  1NTK G;  2YKO A;  5CCH A;  1D7M A;  3HRN A;  2A45 G;  3BCC D;  2QG4 A;  3GW6 A;  4I1L A;  3NTN A;  1M56 D;  3IAO A;  1PP9 G;  3SFE C;  1A02 F;  1NU1 J;  1NO4 A;  1QVG O;  1LWU C;  4I7Z B;  3V2N A;  2QJP B;  4GIF A;  3GMA A;  2FBW C;  1A02 J;  3KZI E;  1BCC G;  4N78 E;  3PTZ A;  1URQ D;  1VF5 D;  1T3U A;  2D2C B;  5CJ0 A;  3RBX A;  2YKP A;  3HE4 B;  4WWI A;  3VMZ A;  5KLV E;  3PJS K;  2Q7C A;  1RE4 C;  2H89 C;  1BGY D;  2P10 A;  2FYU K;  1GZL A;  1SFC C;  1YI2 P;  3B5N C;  5AVY B;  1JMB A;  1BE3 E;  3VP9 A;  4YPC A;  3WMM 0;  2XZR A;  4LC1 A;  2W83 C;  2A06 D;  2W8Z A;  3L70 D;  3M0D C;  3Q1M A;  2H7H A;  1SQB E;  2NRG A;  3AEE C;  1VDF A;  3HE4 A;  1KQS O;  2KNC B;  1NTK E;  2IZ1 A;  3IFM A;  3VTP C;  1Y8A A;  3CME P;  3TGU J;  4JYB A;  1JOC A;  3AE1 C;  1M1J B;  2KLU A;  1SQP G;  1S1C X;  1N86 A;  1BCC E;  1N73 C;  3Q5R A;  4PD4 H;  3JC2 2;  1AQ5 A;  2OGU A;  1WT6 A;  3CLQ A;  2QJY C;  3IF4 A;  4JF7 A;  1SS1 A;  1EZV I;  1L0N D;  2L5G B;  2Q1K A;  3WU2 H;  1K05 A;  3VMX A;  1FDM A;  1IK7 A;  2OTL P;  1JY2 P;  3ITK A;  2KXP B;  2I1J A;  3AEF C;  4IL6 X;  4C46 A;  3HD7 C;  3BRT B;  3WUT A;  3AEA C;  2OYH C;  1QLE D;  3H1L J;  1UII A;  1EXJ A;  4DJG A;  1M1J A;  5KLI B;  3H32 B;  3S9O A;  2O1J A;  1U7M A;  2IX7 C;  3L73 J;  2XKM A;  3JCU E;  1H89 A;  2P58 A;  1RE3 C;  4H44 B;  3L35 A;  2I1K A;  2B9B A;  4Y99 B;  2G8Y A;  1S4X A;  2K1A A;  3M9H A;  4H13 D;  1LTJ B;  1IFI A;  4JBZ A;  4B86 A;  1SQP E;  2QIW A;  1USE A;  1IK9 A;  5APV A;  3HTK B;  1L4A C;  4HYT B;  3H32 A;  1KC8 Q;  2M5A B;  2OYO A;  1GU5 A;  1SQQ D;  2LXC B;  1S5L X;  4NPE A;  1JY2 N;  1KB9 I;  2ZAE B;  1NU1 G;  2FYU D;  2R44 A;  1EDL A;  3TF5 A;  1LTJ A;  4BXL A;  2PAJ A;  2JP3 A;  2M3B A;  2Q5U A;  1M90 Q;  1RQV A;  3H1K D;  1H8A A;  3HTK A;  3L71 D;  1HWT C;  3UIA A;  1KYO I;  5AW1 B;  1L0L J;  2M5A A;  1KIL B;  1SFC D;  2FYN C;  2JO1 A;  4WY4 B;  2KB7 P;  1URQ B;  4BWN A;  4JPZ B;  1VF5 B;  5KJ7 C;  2FFD C;  3A2A A;  1SQV J;  3P8C D;  3C1L A;  1ZV8 A;  2WPQ A;  5B5E E;  3TK1 A;  3EFF K;  2O3J A;  3VMY A;  1JTH B;  1FE6 A;  2GA1 A;  2W27 A;  3M91 A;  1LT9 C;  4PJ0 H;  4D6T E;  3KYQ A;  2ZXX A;  1NKZ B;  3L74 J;  1LTT C;  2Y0D A;  2GM4 A;  4O9B A;  1FDO A;  3TGU G;  1URQ A;  5E79 E;  3CD6 P;  4W7Y A;  1SQB K;  3A0H E;  1P84 D;  1JTH A;  2PFX A;  3V6I A;  2OYI C;  1BE3 J;  1J1E B;  2QEX P;  2IBZ D;  1NTK K;  3H25 A;  3GLM A;  1FDI A;  3D71 A;  2WSC J;  1SQX J;  5KAF E;  3CCJ P;  1HH0 A;  1KB9 E;  1S5L E;  3RK3 E;  1SP4 A;  3MUD C;  3HD7 D;  2R3C A;  2YNY A;  1JO5 A;  3H1L G;  1MUU A;  1OW8 A;  2O01 N;  4GKG A;  3LID A;  3VOP A;  1H0T B;  2KSJ A;  2I8D A;  5AW4 B;  2E42 A;  4EYY Q;  1OVR A;  3AE5 C;  3L73 G;  4K3A A;  3CCE P;  1VQ6 P;  1KYO E;  2CPB A;  1KFN A;  2JEE A;  3RL0 C;  3G3Z A;  2O1K A;  1NYH A;  3BRV B;  1EDI A;  2K3R A;  4UB6 E;  3AE6 C;  3TGU E;  1YJN P;  1NKN A;  5TIS H;  2B88 A;  1Q7Y Q;  1RF0 C;  3SWK A;  5BU5 A;  3BVH A;  2JR8 A;  3O8Z A;  1L4A D;  2AEJ A;  2KSE A;  1GTW A;  2KOG A;  1ZLL A;  1YYC A;  1YIJ P;  4H13 B;  3H1I D;  2ZT9 C;  2CK3 H;  4PD4 D;  1VQK P;  1YTZ T;  2V4H A;  5KAI E;  1PGQ A;  1NTM J;  5B66 E;  3H1L E;  1SQP K;  3L75 J;  4W80 A;  2DW3 A;  3SSU A;  1NTZ J;  5KKZ C;  3A0B E;  2H8P D;  2K9Y A;  1OXZ A;  4PV1 D;  2R32 A;  3BCC J;  3CCM P;  1L0L G;  1LWU B;  2WMM A;  2B89 A;  1VQO P;  3L37 A;  1GK6 A;  1RHZ B;  2YXQ B;  3I5C A;  2N9Y B;  1EXI A;  1RH5 B;  5AVU B;  4ZMD A;  4U7J A;  2W6A A;  2Y0E A;  1FBM A;  3CCR P;  1SQV G;  2KUB A;  5AVS B;  2RN0 A;  1Q81 Q;  1KQG B;  2ZJS E;  5K5G B;  2Y9Y A;  2KS1 B;  5H2F E;  5APS A;  1SFC B;  1BGY J;  3A3Y B;  2MJZ A;  3M06 A;  2HLO A;  2C9N Y;  1NTK D;  1OX3 A;  3L74 G;  1LWU A;  4HJG H;  1ZXG A;  1FZE A;  1MV8 A;  4IFM A;  4OGQ C;  1PP9 D;  3EWK A;  4A7P A;  3CX5 E;  3E1R A;  2KLV A;  3N7N A;  2PP6 A;  1IFD A;  3MGN A;  2FXP A;  1M57 D;  1J2J B;  1IJD B;  1HJ0 A;  1RE4 A;  2KS1 A;  3F5H A;  1YHQ P;  1BE3 G;  2AXT H;  1MZ9 A;  4WB4 A;  3CL3 D;  1SFC A;  1HVV A;  4AYC A;  1SQX G;  1L0L E;  2VRS A;  1QX8 A;  1PPJ G;  2V7Q H;  1NU1 K;  3RK3 C;  4NPD A;  2K37 A;  2W90 A;  3R4Y A;  1RF1 A;  4D6T J;  3CPW O;  2OTJ P;  3L4F A;  1BDD A;  1SQV E;  4GOD A;  2QJY B;  1VQ7 P;  3LW5 J;  1N7S D;  1L0N J;  3OAK A;  1DH3 A;  3R2P A;  1P84 H;  4ZKU A;  3HD7 B;  1KIL D;  1WMK A;  1NAY A;  2H88 C;  1S3J A;  2HPC B;  3L74 E;  4L76 A;  4WY4 D;  2BEQ D;  3RK2 C;  4OVN F;  5M1B A;  3CCS P;  1K73 Q;  1KFM A;  5AVX B;  2N9B A;  3AE2 C;  3AE8 C;  1X79 B;  2QM7 A;  3WUV A;  1IFM A;  1EDK A;  1GW4 A;  3QWO C;  5AVW B;  3HD7 A;  2OTK E;  1SQX E;  3CXH I;  3Q5P A;  1Z56 A;  2XU6 A;  4ZKP A;  2HPC A;  3C9I A;  1PPJ E;  3PH0 A;  2NPS C;  3I55 P;  2ZYG A;  2LR2 A;  1VPC A;  1NTM G;  3VN0 A;  4MN4 C;  2ZYD A;  1L4A B;  2IPP A;  2E75 C;  1T2K C;  3L75 G;  4CPG A;  4YTP C;  1NTZ G;  4M3L A;  3KHU A;  1MKM A;  1SQQ J;  3BCC G;  4DZO A;  1GDT A;  1EZV D;  2JJL A;  1GL2 C;  1IFP A;  3K5B A;  5CHX A;  2ZYA A;  5CBN A;  5APT A;  5AW7 B;  5APY A;  2QVA A;  1S2E A;  2WTY A;  3H1H D;  5CBO A;  3H1K J;  4HKZ H;  1L4A A;  2FYZ A;  4PV1 B;  3CCU P;  3L71 J;  3ZDM A;  4JYC A;  2KNC A;  1SVF A;  1BGY G;  3U59 A;  2AXC A;  1FC2 C;  5APU A;  2B87 B;  2YIU B;  1LNQ A;  2K88 A;  2FFD B;  1YJ9 P;  4U3F D;  1BSH A;  2AEM A;  2E74 D;  1PV3 A;  1KOR A;  1NU1 D;  1KN7 A;  1LT9 B;  1S72 P;  4ZNC A;  1GMJ A;  1NTM E;  1JB0 J;  1NH4 A;  1E79 H;  3TDK A;  3BAT A;  3L75 E;  1VQP P;  3MP7 B;  1HTL C;  5CCG D;  1OWA A;  1NTZ E;  1W5C E;  2WVR A;  4W7Z A;  1DIP A;  2P67 A;  3BCC E;  4H0L C;  2JWD A;  3CCQ P;  2M8R A;  3CXH E;  1KB9 D;  2B87 A;  2FFD A;  2XND H;  2HOD B;  2E76 C;  2A45 H;  4D6T G;  1R5S A;  1LP1 B;  3U1A A;  2OYI B;  5APQ A;  3TNU B;  1LT9 A;  3GHG C;  4YXD C;  3N4X A;  2BAS A;  1L0N G;  4L74 A;  5AVR B;  3G4S P;  1BGY E;  1U57 A;  1KYO D;  1OW6 A;  3SWY A;  1L0L K;  1RQU A;  2PGD A;  1FAV A;  1G1J A;  3ABV C;  1X8Y A;  1LTG C;  2L91 A;  2A06 E;  1N7S B;  2HOD A;  4IFF A;  1AJY A;  1DD3 A;  2OYI A;  2CPS A;  3RL0 g;  2R5B A;  4AQR D;  1FU1 A;  1IZN B;  3B5N D;  1PGO A;  2AEF A;  3CWB D;  1N8R Q;  1LTI C;  3F89 A;  2FXO A;  1J1D B;  1PIX A;  1QVF O;  2K9J B;  3H1J J;  3JCU H;  3G71 P;  2LKM A;  2KYV A;  1DEB A;  1IC2 A;  3M9Q A;  1ZOY C;  2E75 D;  3AE4 C;  3FX0 A;  1N7S A;  4N6J A;  1T2K D;  2J5U A;  3H1L D;  5KLV K;  3M9B A;  1PZQ A;  4I6M C;  4TLF A;  1SQQ G;  1L0N E;  1KIL A;  3CMA P;  2QA4 P;  1QEX A;  2GUS A;  4TT3 H;  1FS0 E;  1HF9 A;  3L73 D;  1NAF A;  4WY4 A;  3W67 A;  4I2L C;  2IYP A;  2K9J A;  4C7N B;  1LTB C;  1ZN5 A;  3GG2 A;  2P2U A;  3CI9 A;  1ZRT D;  4EOT A;  2WSE H;  3H1K G;  1CI6 B;  1LTJ C;  3L71 G;  2XDJ A;  2QJK C;  4DOJ A;  2N1T C;  3D70 A;  2WPV B;  2RMZ A;  3EFG A;  1USD A;  1G1I A;  2FKW B;  1DX7 A;  3RBZ A;  1JNM A;  3LIE A;  2HFE D;  2IYO A;  4IL6 H;  5B5E H;  3CC7 P;  1CI6 A;  5AVV B;  1RY3 A;  4L73 A;  1SQQ E;  4H0L D;  2YXR B;  2E74 B;  2O01 H;  3D6Z A;  3USS A;  2BCC J;  2FYU E;  3CX5 I;  1L0L D;  1VQ5 P;  2XNX A;  3L72 D;  2E76 D;  4DCK A;  3A5T A;  1YQ3 C;  1NWQ A;  1H0T A;  1NTM K;  1OW7 A;  2Z5H A;  1OVV A;  4UB8 E;  5C39 A;  1JUN A;  1S9K D;  5DJT B;  4OH8 B;  5AW5 B;  1JM0 A;  2KP8 A;  3H1K E;  1HJB A;  1AQT A;  2IBZ G;  3L71 E;  2YKQ A;  1KZU B;  3FGA D;  2ZFC A;  3NXS A;  3A0H H;  2QE7 H;  1LT1 A;  5AVZ B;  3G9R A;  2Q3I A;  3FWL A;  3B71 A;  3HUS C;  4N78 D;  1M8O B;  1QGK B;  5KAF H;  1KB9 H;  1T8Z A;  3VMA A;  3P8M C;  1S5L H;  3P32 A;  3CC4 P;  2YMY A;  2H43 A;  5CCG A;  1LJ2 A;  1QL1 A;  5KLV D;  1E5W A;  2IZ0 A;  5GTH E;  2OAR A;  1BE3 D;  5KJ7 D;  2WT7 B;  4RO0 A;  1BDC A;  3H1J G;  1KYO H;  2JDI H;  2YO3 A;  1K04 A;  5AVQ B;  1PPJ D;  2W6B A;  3Q2Y A;  2JKV A;  1SQB D;  1VQ4 P;  4UB6 H;  3B5N B;  1OIP A;  4GOF A;  1P84 E;  5KTB A;  4RJT A;  1H88 A;  2IBZ E;  3AED C;  1YIT P;  3JSV C;  1VQL P;  2NPS B;  1FZB A;  3L70 J;  2YO2 A;  2Y9Z A;  2WT7 A;  1KQL A;  1NGM B;  1PGJ A;  2E75 B;  1BCC D;  1YJW P;  2WPS A;  4HB1 A;  1VQN P;  1X9V A;  1BSN A;  2C0W A;  1TU3 F;  1EC5 A;  2W6J H;  3B5N A;  3B8E B;  4KT0 J;  1GL2 B;  2N1T D;  1PL5 A;  4ASW A;  1JCD A;  4EDF A;  5GTI H;  1N73 B;  1AFO A;  4EIJ A;  3MZW B;  1JMM A;  3PRJ A;  3M0D A;  2ZXE B;  1FJP A;  3E7K A;  1VQM P;  3H1J E;  1YTZ I;  3H1H J;  3II6 A;  5AW2 B;  3FXE A;  1MFZ A;  1ZR2 A;  3E1I A;  1NTM D;  2O01 J;  5AW6 B;  2IDB A;  3RL0 D;  4IOI H;  2OYH B;  1G2C B;  3Q5S A;  2QSI A;  4U3F J;  3CCL P;  1NHL A;  2WQY C;  2UWJ E;  5H2F H;  3H1I E;  1OVU A;  1N73 A;  4PD4 E;  4XFJ A;  2BCC G;  4Y28 J;  3CXH D;  3PP5 A;  1KD1 Q;  1FZC C;  5CJ4 A;  1SQP D;  3WU2 E;  5APW A;  3Q3D A;  4Z1M H;  1CSB A;  4R4M A;  1KQF B;  4BRY B;  1VQ8 P;  1W2B O;  1VL2 A;  3CX5 H;  4H0L B;  1GK4 A;  3S4R A;  2ZT9 D;  4YXW H;  1SQQ K;  3AEB C;  3P7K A;  3EQ2 A;  2OYH A;  1G2C A;  1JY3 O;  5BVZ A;  2Q9I A;  3PHL A;  2E76 B;  3V2R A;  1L2P A;  2KI7 B;  3OW2 O;  1IFN A;  4L75 A;  2ZVN B;  3GHG B;  1YQ4 C;  1RE3 A;  1RF1 C;  1NOH A;  3A7O A;  1FZA A;  2HR3 A;  4NPF X;  4BRY A;  2FYU J;  2FXM A;  3SWF A;  2RKL A;  5CCH C;  1AVO A;  2P7J A;  5AW9 B;  1N2D C;  1PP9 E;  2BCC E;  2NZ2 A;  3H6P A;  3I56 P;  3KZI H;  3GHG A;  4LLH A;  3S1K A;  3IR9 A;  4D6T D;  2FYN B;  1CW5 A;  3CWB J;  1K9M Q;  3FXD A;  5CMZ A;  1MFT A;  1K8A Q;  1R5L A;  4OGQ D;  1ZME C;  2A06 G;  3L70 G;  2Y0C A;  1AVY A;  4I7Z C;  1HGZ A;  2QJP C;  1X22 A;  2WSC H;  1Q86 Q;  2WWW A;  3GF3 A;  1T6A A;  3C8V A;  1FOS F;  2V7Q J;  1KMI Z;  1XTC C;  2ZVO B;  1WRG A;  2D2C C;  2SPZ A;  1FZF A;  2POH A;  4ASV A;  1EZV G;  5KJ7 A;  1IO4 A;  4RKU J;  1Y47 A;  1KIL E;  3RK3 D;  1HUC A;  2C0X A;  1U7J A;  3TYY A;  1IFJ A;  3G6E P;  4PJ0 E;  3KQG A;  3IN6 A;  3MIW A;  3H1H G;  2QJK B;  1GD2 E;  1LGH B;  2M0B A;  5TJH A;  2N1T B;  4JQ0 D;  3VYI A;  3AE3 C;  1ZR4 A;  2IFN A;  1DEE G;  2HG5 D;  3RK2 D;  2JWA A;  4U3F G;  3VP8 A;  4XE5 B;  3O6Q B;  4IFD K;  2PRR A;  3L70 E;  1SQV K;  3TGU D;  1LP1 A;  2E5T A;  1AA0 A;  3TNU A;  4AUW A;  1M1J C;  2GUV A;  4RES B;  3RL0 B;  4N3Y B;  3V2Q A; 
#chains in the Genus database with same CATH homology
 2XNX A;  1RE4 A;  2N1T A;  1JOC A;  1MZ9 A;  4WB4 A;  1M1J B;  3MUD A;  3CL3 D;  3A5T A;  1SFC A;  1NWQ A;  1HVV A;  1N86 A;  1N73 C;  2Z5I A;  1NTM K;  2Z5H A;  4AYC A;  3OA7 A;  1JUN A;  2VRS A;  1AQ5 A;  2NPS D;  1S9K D;  5AW5 B;  4OH8 B;  1WT6 A;  1NU1 K;  3RK3 C;  2KP8 A;  3CLQ A;  1HJB A;  4JF7 A;  2YKQ A;  2L5G B;  1KZU B;  1RF1 A;  3VMX A;  1FDM A;  2ZFC A;  3NXS A;  1JY2 P;  3L4F A;  5AVZ B;  2I1J A;  2Q3I A;  4C46 A;  3HD7 C;  1N7S D;  3OAK A;  3BRT B;  1DH3 A;  3R2P A;  2C9L Y;  2OYH C;  3NFQ A;  3HUS C;  4N78 D;  1JY2 O;  1GL2 D;  1M7L A;  1T3J A;  1T8Z A;  1SQX K;  3P8M C;  4ZKU A;  5CCH D;  3HD7 B;  3P32 A;  1KIL D;  1M1J A;  3HUS B;  3H32 B;  2HPC B;  2YMY A;  2H43 A;  4WY4 D;  2O1J A;  5CCG A;  3RK2 C;  3NMD A;  2IX7 C;  1QL1 A;  1RF0 A;  2XKM A;  4Y99 C;  1E5W A;  2P1J A;  1H89 A;  1KFM A;  1RE3 C;  5AVX B;  3L35 A;  2OAR A;  1JCC A;  2I1K A;  2N9B A;  5KJ7 D;  4Y99 B;  2WT7 B;  1X79 B;  2QM7 A;  3M9H A;  3TSI A;  1LTJ B;  1IFM A;  1IFI A;  2J59 M;  2YO3 A;  1GU4 A;  5AVQ B;  2WSF H;  1GW4 A;  2W6B A;  4B86 A;  5AVW B;  4HH2 A;  3HD7 A;  1IK9 A;  5APV A;  3B5N B;  3HTK B;  5KTB A;  3HUS A;  1L4A C;  1Z56 A;  4C7N A;  2XU6 A;  4HYT B;  4ZKP A;  3H32 A;  2HPC A;  3C9I A;  2NPS C;  1H88 A;  5AW3 B;  1VPC A;  1GU5 A;  2WPR A;  2E43 A;  3T97 A;  3VN0 A;  1JY2 N;  1L4A B;  2IPP A;  2J58 A;  1T2K C;  2NPS B;  2WIT A;  1FZB A;  3OJA B;  2YO2 A;  1LTA C;  2WT7 A;  1KQL A;  4M3L A;  3U1C A;  1QL2 A;  1N7S C;  1LTJ A;  4DZO A;  1GDT A;  3MD0 A;  2WPS A;  2PAJ A;  2JJL A;  2M3B A;  2Q5U A;  1GL2 C;  5CHX A;  5BU8 B;  1X9V A;  5APT A;  2C0W A;  4GT1 A;  1KIL C;  3LW5 H;  5AW7 B;  3M0A A;  3MTU E;  5APY A;  3B5N A;  5AVT B;  3B8E B;  3HTK A;  4LGD E;  1H8A A;  3KDP B;  1HWT C;  1GL2 B;  3L36 A;  3UIA A;  5AW1 B;  4WY4 C;  2N1T D;  1URQ C;  3V4W A;  1KIL B;  2WTY A;  1J1D C;  1JCD A;  1SFC D;  3HE5 B;  1N73 B;  1AFO A;  1L4A A;  2FYZ A;  1NTZ K;  4WY4 B;  2KB7 P;  4EIJ A;  1JMM A;  1URQ B;  3M0D A;  4JYC A;  2ZXE B;  5KJ7 C;  1SVF A;  3A2A A;  2FFD C;  1FJP A;  1EQ7 A;  3RK3 B;  3P8C D;  1ZV8 A;  2WPQ A;  1YTZ I;  3TK1 A;  3U59 A;  3II6 A;  5AW2 B;  1XTG B;  1MFZ A;  5APU A;  1ZR2 A;  3VMY A;  1JTH B;  3E1I A;  2FFD B;  2W27 A;  3M91 A;  1LT9 C;  3P8C E;  5AW6 B;  3KYQ A;  3V2P A;  2WZ7 A;  3V5B A;  3RL0 D;  4C7R A;  1N7L A;  2IFM A;  2OYH B;  1NKZ B;  1G2C B;  1LT9 B;  1NH4 A;  1NHL A;  1LTT C;  1CZQ A;  2GM4 A;  4KHX A;  3BAT A;  3HE5 A;  4O9B A;  1N73 A;  1HTL C;  5CCG D;  1URQ A;  2XV5 A;  1OWA A;  3RK2 B;  3PP5 A;  4W7Z A;  1FZC C;  5CJ4 A;  2P67 A;  3V4Q A;  1J1E C;  4W7Y A;  5APW A;  1FOS E;  1SQB K;  2M8R A;  1CSB A;  1JTH A;  1FZC B;  2FFD A;  1JY3 P;  2OYI C;  4WBA A;  1J1E B;  1GK4 A;  2HOD B;  1NTK K;  2A45 H;  1SQQ K;  1FJK A;  3P7K A;  3EQ2 A;  3U1A A;  2OYH A;  1HH0 A;  2OYI B;  5APQ A;  3TNU B;  1G2C A;  1LT9 A;  1JY3 O;  1SP4 A;  5BVZ A;  2Q9I A;  3GHG C;  3HD7 D;  3N4X A;  1LTS C;  3V2R A;  2BAS A;  2R3C A;  2YNY A;  1JO5 A;  1IFN A;  2R5D A;  5AVR B;  1MUU A;  1PFI A;  3KPE A;  3GHG B;  3SWY A;  1L0L K;  4GKG A;  3VOP A;  3LID A;  2KSJ A;  2Z4E A;  5AW4 B;  2E42 A;  1RE3 A;  1RF1 C;  1NOH A;  1FAV A;  3A7O A;  1G1J A;  1FZA A;  1FZC A;  2HYN A;  2CPB A;  1X8Y A;  5AW8 B;  2FXM A;  3SWF A;  1KFN A;  1LTG C;  2QM8 A;  3BAS A;  5CCH C;  1N7S B;  2HOD A;  2JEE A;  1RF1 B;  3RL0 C;  3G3Z A;  2P7J A;  4IFF A;  2O1K A;  5AW9 B;  2OYI A;  2CPS A;  1L0N K;  3BRV B;  2R5B A;  1FZG A;  1W2E A;  4AQR D;  1FU1 A;  1N2D C;  4XA4 A;  3B5N D;  3H6P A;  1NKN A;  1LTI C;  5CCG C;  2A45 I;  2NPS A;  1RF0 C;  3GHG A;  5BU5 A;  4LLH A;  1J1D B;  3BVH A;  3O8Z A;  3IR9 A;  5AW0 B;  1L4A D;  1CW5 A;  1JY3 N;  2LKM A;  2KYV A;  1DEB A;  1GTW A;  1HGV A;  2KOG A;  1ZLL A;  1IC2 A;  5CMZ A;  1YYC A;  3M9Q A;  1N7S A;  4N6J A;  1SLQ A;  1T2K D;  5KLV K;  3M9B A;  1S9K E;  5APX A;  1HBW A;  1YTZ T;  1GW3 A;  4I6M C;  1GL2 A;  2YKO A;  5CCH A;  1KIL A;  1HGZ A;  2A45 G;  3HRN A;  2GUS A;  4I1L A;  3NTN A;  1SQP K;  2WSC H;  2WWW A;  1NAF A;  1A02 F;  4W80 A;  4WY4 A;  1NO4 A;  1FOS F;  1LWU C;  1XTC C;  4I2L C;  1WRG A;  3V2N A;  4GIF A;  1A02 J;  4C7N B;  2H8P D;  1LTB C;  1OXZ A;  2POH A;  1ZN5 A;  1FZF A;  2R32 A;  4N78 E;  2P2U A;  1URQ D;  1LWU B;  5KJ7 A;  3CI9 A;  1IO4 A;  3L37 A;  1T3U A;  3RK3 D;  1GK6 A;  5CJ0 A;  4EOT A;  3I5C A;  2WSE H;  2YKP A;  1CI6 B;  1LTJ C;  1HUC A;  2C0X A;  2XDJ A;  3HE4 B;  5AVU B;  3TYY A;  1IFJ A;  4DOJ A;  2W6A A;  3VMZ A;  2Q7C A;  1RE4 C;  3KQG A;  2N1T C;  1FBM A;  5AVS B;  3MIW A;  2FYU K;  1GZL A;  1SFC C;  3EFG A;  3B5N C;  5AVY B;  1GD2 E;  3VP9 A;  1LGH B;  2N1T B;  3WMM 0;  1G1I A;  2FKW B;  5APS A;  3VYI A;  1DX7 A;  2XZR A;  1SFC B;  1JNM A;  1ZR4 A;  4LC1 A;  3A3Y B;  2IFN A;  3LIE A;  2MJZ A;  3M06 A;  2HLO A;  3M0D C;  2HG5 D;  2C9N Y;  2HFE D;  3RK2 D;  2H7H A;  1LWU A;  3VP8 A;  4XE5 B;  1FZE A;  1MV8 A;  4IFM A;  4IFD K;  1CI6 A;  1VDF A;  1SQV K;  3HE4 A;  5AVV B;  2KLV A;  1RY3 A;  3N7N A;  2PP6 A;  3TNU A;  1IFD A;  3IFM A;  4AUW A;  3MGN A;  1M1J C;  2GUV A;  2O01 H;  4RES B;  3RL0 B;  1J2J B;  4N3Y B;  3VTP C;  1IJD B;  3V2Q A;  4JYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...