1IFHL

A detailed analysis of the free and bound conformation of an antibody: x-ray structures of anti-peptide fab 17(slash)9 and three different fab-peptide complexes
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
217
structure length
217
Chain Sequence
DIVMTQSPSSLTVTAGEKVTMSCTSSQSLFNSGKQKNYLTWYQQKPGQPPKVLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSNPLTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 17/9 FAB (LIGHT CHAIN)
publication title Detailed analysis of the free and bound conformations of an antibody. X-ray structures of Fab 17/9 and three different Fab-peptide complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 51
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1993-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ifhL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ifhL01
1YN6B 1OB1A 4NO2B 1QVOA 5CD5C 1YY8B 4LLVB 5ETUB 4WUUA 3G08B 3UTZB 5DJXB 4R9HA 1ZLSL 4X6EA 1DBKH 1Y0LA 3MYZA 4Y88A 1EDQA 1RUKH 2X4OA 3DVIA 5I30L 3QG6B 1UZ8B 5EIIB 2GCYA 4X4XB 4XC3L 3LZFL 3LIZL 4PJXE 3PWJA 3V8OA 5DXWA 3VXNB 1P4BH 4P2OC 3WHE0 4FZ8H 2LABA 2OXHA 2HJKA 3O4LA 1AP2B 2CSPA 1BM3H 5I0ZA 3PGCB 3HNVH 2FSEB 1IEAB 3VFTA 4HDIA 4XC1H 3FRUA 3T8XA 4JGMA 1VEPA 4HH9A 1KIRA 1ZOXA 1C08B 4PS4L 4YFDB 3MCKB 1ZHBA 1YPZA 1PVHA 3U4EB 1WFUA 1ITBB 2KPNA 3KPNB 4OQ1A 4D0CB 3K4DA 3VGHA 4BSJA 1FZJA 1M1SA 1Q1JH 5GIRB 4WV1A 3HE6D 3OB8A 3BP7A 4TVPE 1UM5H 4PJDB 3OJ2C 4MS8D 1FNEA 4KPHL 1TZHA 4L3EE 4GAJH 2MCPL 3MRDB 8CGTA 1C8PA 3F7VA 4XMKH 4UTAH 3G6JA 1VKXB 2N1KA 4DN3L 4LLUA 2MMXA 2PTUA 4LEOA 2BFVL 5EUOF 5HD8C 4GS7B 5FUZL 3VFVA 4M5YH 1QBAA 1KJVA 3VGGA 1QEWA 3L3JA 5CEXA 4MLSA 1T2JA 2YPLE 5FYJE 2X1QA 1GHFH 5HPMB 4IMLB 1RAMA 1AGDA 3SE4C 3VG0H 1WBZA 3M8OH 2FYYB 4C58B 4NQXA 4F9LA 2BNRD 4KAQH 2ADGA 2IALA 4XP1H 3JV6B 5DTFB 5EUOE 4K7FB 1W0VA 4YFLF 3UTSD 3WFDL 1I1FA 4Y2DA 4OFYA 4F7TA 3SY0A 5K9OB 3CDGB 2Z93A 3SJVA 1J05A 1WC7B 3RBGA 3KYKH 3FCTB 4GKSA 4PJ7B 3HE6B 3CLFH 2AS5M 1JNNH 4I3SL 3MX0A 4W4NA 4ZUVA 4X6FA 4Y4HB 2BVOB 3P77B 4BUHA 5IHLB 5GRYA 4OGXH 2QLVB 3BN9D 4HG4J 3EO9L 4KY1L 1I9IL 3QEQA 5TJWK 2V9TA 1CU4H 1BFSA 3T3MF 2DLFL 3TJHD 3RWEB 1A6TA 4IHOB 4LSTH 5FYKD 4YDVA 4ODUB 4S2SA 3QH3B 3TA3A 2GAZB 3V4VH 2BCKA 2WUCL 4AZ8A 1HQ4B 1S3KL 3QXDA 4JDTL 3DXAD 4NQSA 4M8VA 4XP5H 4YHLL 2IFFL 2Z92A 3L1OL 5GS1A 2XA8H 3D1MC 4G5ZH 3T3ME 5IB1B 3RGVA 5I15L 4QHUA 1R5WB 4PJGF 3VGEA 1L9NA 5JOFB 2BNRB 2BRQA 3FO9A 3K0WA 3MUHL 4JM2D 4YC2B 3UTSB 2W9EH 3ZYZA 3RZCA 3ARGA 5IKCA 5F1IA 1BZ7A 4F9LC 1CFSB 2X4RB 1YQ2A 4TQEH 3O6FD 2BJMH 4NO5B 3C87A 1TZIB 2Q6WB 1HHKB 1TJIL 2CQVA 5BOZG 3QPQC 1QQDB 2WBKA 5C2UB 4J3OC 1MFEH 2PUQT 4GXUM 4ODXA 1CXKA 1JF1B 2FDBP 1ZT7A 4PJIA 4GAGL 4OLWL 1OARH 1T7ZA 2KL6A 4JLRB 4JFOB 3U1SH 3GMOA 1DQJB 1RZ7H 4J2XA 1MHHB 2X89A 2EXYD 4KKLC 4ZOEA 2VDLH 3ZDXF 4OTXH 2J88H 3L5XH 2FJHB 3KNBB 1FGNL 3HI1A 5FEBA 1NCAH 3LV3A 2FEDC 3LDBC 4XHJC 4Z7QF 3WBDA 1UWEH 5EC2B 3PF2A 1UKTA 4UU9A 5EH1A 1I7TB 4CN1A 3B9AA 1CBVH 3DXAB 5GSVA 4WJ5A 4NCC2 3QRFM 5E2TH 3ARBA 5DK2A 3SDDA 3ARTA 1BIIA 2Y07H 1U9KA 4LSDA 5MHSE 4AM0A 2AAVA 3ZDXE 1XF5B 1ZT4B 4XAWH 3HNTH 3F7YA 4XNZB 4EUPA 1GGUA 4JM2B 1WITA 2HYMA 3ROOA 3KPRD 4Z7QE 4E0RB 4JN1H 1BFVH 1NSNH 1A1MA 4GLRH 2HLAA 2OTUA 3WNMA 1K4DA 3EYSL 1LO5B 3BH8A 5EG6C 5JW3L 4R7DA 1FGVH 1JN6B 2D31B 2XZQH 3O6FB 4OUOA 3RZCC 2OTWA 5FYKL 3ARGC 1G0DA 4TSBL 2ZCLL 1YN7B 1A9EA 3RU8H 4L1DA 3RA7H 1J5OL 1X5GA 4I77L 4IRSC 1IL1B 1W72H 4OAWA 2GSIB 3T0EE 1A21A 4MQSB 4YH6A 1S7WB 3QUZA 1DANT 4RIRB 3PP3H 4RX4D 2H2PC 1SJHB 1KV3A 3JV4A 2B1AH 4IS6A 3B4NA 1ZLVK 4CRPA 4RGND 3AU1A 4ONFH 1CE6B 5D7JC 4UDUA 1ZA3B 2MKWA 3SKJH 5HJ3A 2GHWB 4A2LA 3BPNC 5T3XD 1Q0XH 1DJSA 1YMHA 4RGMC 5CBEB 3RWJB 4ZUUA 3V6OE 2AEWA 2BY3A 5DR5H 4D3CL 3HKFA 3ULUE 1CTOA 3KPRB 1G6RL 1M4KA 5DC0A 1FVDB 4KQ4L 2WUBH 5FO9A 3W39A 2A9MH 4Y1AA 2UZIH 5CKAA 2YA2A 4EI6A 3QUMA 3TVMA 2XG4A 1T7WA 3V4PH 1F6AB 1CL7I 3TO4A 1PX3A 5KS9E 3G6AB 4NM8H 3RVTC 2OMBA 5IMLB 1KPVB 1JGEA 4Y2OA 1QBLH 4ZO6A 5C6TL 1M6OB 3OKOB 4Q9BA 3ARDD 3ARZA 3NH7H 4WFFE 4A6YB 3QXAA 3I50L 2F74A 3AM8C 4K55A 4U1NB 2NY6C 4Y7MA 1ULVA 4RGNB 5DLMH 1CR9H 3VFMB 1P7QA 1O5DT 3HZVB 4BQ9A 5GJSH 2AJSH 3MJ7B 5JW5B 5HHNA 3VWJD 2B5IB 3ARYA 3E0GA 1HHHB 5FA4B 1XGTA 3B2UC 3RNKB 4JFHE 3O9WC 4FQQA 4TUJA 5EU7C 1T83C 3S36H 4RWYL 2Z91B 4PRIE 3H9HB 2E7LA 2XTJE 5HYJB 4S1RH 5I1KL 3K2MC 3MTRA 3IJHB 1CXEA 1AHWA 3RTQD 3S35L 3X3GL 1LEKB 3SKNB 2V2XA 4XTRC 3QWRA 3D69A 5DHXB 3SGDI 4EN3A 1V3KA 5EBWA 4WTZA 4M9OA 1KTRL 5I76B 3MV7E 3IDYB 1OAZL 2NY1D 2CKBH 4XX1G 1EEYB 4ERSL 3MRGB 4F7MA 4YHPA 1MRFL 4PRHA 1WBXA 3EO1B 3R1GH 3TO4C 5GHWL 3GO1H 1I3RA 2P43B 3PUCA 4WFGE 1RIVL 4FQIL 4F7PA 4HX1A 1A02N 2GSGB 1SM3H 1HI6A 5D72H 3OJVC 3TWCL 4KHXL 1NGWB 1UT9A 5INDA 5CP7A 5EZLA 3STBA 5FUOL 5SWSE 5CEZE 4KVCH 1A7RH 3BO8B 4Y8DC 5L88L 4M8QB 5F7NC 1E28A 1OD7A 4UIKH 4D9RE 2VLRD 2I27N 2PETA 3SPVB 1MH5A 3HLAB 3BE1L 4M62H 3P11H 4HIEB 4N0RA 5CBAB 4WDIA 4BJLA 5HDOA 3SDYL 2QQKL 4M7JH 1QNZL 4F7EA 1NMBH 2Z4QA 2P7TB 2YPVL 3OBAA 4XAKD 3VFWB 2BSED 4H88H 1LK2A 4KK8D 3OR7B 1FO0B 3DVFA 3EJYC 4I0PC 5ADPH 4M6NH 2WWKO 4DAGL 2NY1B 3UTPD 5I8KH 5JW4Q 1O0VA 3BKCH 1RZIB 1I8KB 2DLHA 3IFLL 4ZFOA 1RK0A 1S7SB 5I1JL 1KB5H 3BQUA 1NMAL 5ITFB 3ZHDA 4ZYKA 1AGCA 4BFIB 5FCSH 2B2XH 2NR6D 1U91A 1OF2A 4G6FD 1J0IA 5DD5L 1VESA 3C5ZB 4PB9L 5KVEL 1AIFB 1WBYA 4XWOD 1MSPA 2ZUVA 1PEZA 4AQOA 2BVPA 2Q8AL 1I3GL 1KUMA 2IMNA 2K3TA 4Q7DA 1QRKA 5IEHA 2P42B 1WF5A 2H45A 3W2DL 1VGKB 4ZOBA 1GZQB 5EO0B 2VLRB 1T04A 1YUHA 5D4QA 2V2TB 1G7JB 4KZDL 3QA3A 1CDBA 4M7ZB 4Q74A 4FXLA 2O5XL 3VXQA 3PQYA 5BRZE 4CW1B 5JUEH 4NQTA 3I02B 4ZUWA 1MUJB 2VXUL 2M8XA 5B8CB 4LFHD 1LNUA 3HC3H 2X1WL 4HJGA 2NY2D 1XCQB 1A3QA 4MJ2A 4TSAH 4XCYA 2R56L 2QADC 1CICA 2NX5A 3FQUB 3HS0B 4JHAL 3KXFA 1KENH 1Y18B 3U9UB 3E1F1 4YXLH 4C57C 4FFVD 1OLZA 4S0TD 1UXWB 2G5BA 5FA3B 1FL3B 2QL1A 4ELKA 5CHNB 1JPSL 5SWZA 3B9KA 1RVFH 4X99B 2WBJD 2E27L 4AIZA 3GSVB 2WP3T 4G6FB 3ULSB 4K8RC 3LPGA 5DMJB 5IQ9B 2LTQC 3DETD 4K94L 4GAYB 1WQVT 5F8RC 4CNIA 2X4UA 3DUHA 4MWFB 4PJ8A 4C59B 3EYUL 4X0KA 3D39E 4YX2H 1NEZB 3V52L 5MEND 1GCFA 2G9HB 3TBYB 4HLJA 1E6JL 4H26A 2FECL 4PJBA 4HLZH 4KU1A 1ZLWH 4NQCE 4Y5XB 4I2XB 1ZLUH 4NDMA 1U3HA 4GG6F 4NZRH 1C5CL 3CIQA 2HRPH 3G5ZA 3JVGC 3QCUH 5D7LA 1A9BA 2PF6A 4PJCA 3K2UL 4XBPB 1BJ8A 3HI6L 1ZHNB 3FN0H 4NQDD 5J13B 5I1HL 4U6XB 1J1OL 1JPFB 4G7YH 4G8EA 3D85A 3RL1B 4PJAB 4S1DD 4JO4H 2NY2B 2WWMC 4XI5D 4GG6E 3VJ6A 3X13A 3GGWA 1NEZG 2P8LB 1CG9A 1XCTB 5D5MA 5A2IH 4FP8L 4M4RA 3VXPB 5M95B 4WUUD 43C9B 4HIXL 4KI1A 4LLWA 1QLFA 2QV2A 3ZT6A 1EGJH 1JWUA 3MRHB 5FYJH 3P0YL 3KPMB 4M6ML 2WBJB 1BFOA 4MA3A 4UV7H 3B83A 3DV4A 2W0FA 3ZDZF 1T1WB 2VABA 5B4MD 2ESVB 5E24E 2YRLA 3O4LD 3V4UL 5C0EA 1RULH 1X6NA 2LAAA 1KJ2A 5MENB 1FP5A 2GKIA 4LFHG 2HFEA 2AJXL 5E6YA 3I2CH 2GITA 4LVHC 2WAHA 1E4JA 2G60H 5F3HA 2CIKB 5IIEB 1U8LB 5DUPL 4GUPB 4X6DF 1B4JH 2VLLA 2O5ZH 4LNRA 5CMAB 2ILLA 3O3AB 2AJUH 4NFBA 3T0AA 2UUDK 1U3HC 3BRFA 3DVGB 5EOQH 3VFRB 3QDHA 5H35A 1MCKA 4EI5A 4PD4K 5ALCH 4NQDB 2IEPA 1SVZA 2YR3A 1T7VA 1FIEA 4YEEA 1F4WL 1C7SA 2X4PA 5DVOA 4HIIA 3L7EB 5EU6E 4X4MA 4NP4H 4MJ5B 1NGYB 2CK2A 1TQCC 4JN2A 1ZHKB 5EWIH 5E8NB 2DKMA 3VXMA 1X5ZA 2VXTL 3HPLB 1KSRA 3NABH 4X6DE 4ZSOE 4PPTA 3WLBB 3GMRB 4LGPB 4AH2A 3V5KB 1QVOB 5BS0A 4WUUB 5KVFH 4X6EB 1OSPL 1NGQL 1Y0LB 2HAZA 1FDLL 2X4OB 4NC0B 5IR1A 1KTDA 1EHNA 4LHUG 5C0ND 4W6WB 2GCYB 3O6MH 2WMPA 4G43A 4PJ5A 5MI0B 2DQEH 3UYRL 3PWJB 4XPAL 2HJKB 3O4LB 5EOCJ 3VFTB 5F7FA 4HDIB 3FRUB 3T8XB 4HUWB 4QLRA 2QSVA 2XI9A 3WFBL 4Y2DD 4HH9B 3MFGB 4FS0A 3D2UA 2HKHH 1IBGH 1ZHBB 1LWRA 4GMSL 3TFKC 4P2RE 2VXVL 4PJ9C 3NIDF 1FZJB 5B3JF 5LCVL 4WV1B 2X44D 3LB6C 3BP7B 1PG7W 1U8IA 4RMRA 3S37X 3CX2A 3DLQR 5KZCD 1KJMA 3NFPA 3TZVC 1FNEB 4WUKL 4YHZL 2YHGA 1TZHB 5IT2L 4H20H 3UP1A 3QEQD 1ACYH 1OSZA 5K9QI 3JV5A 3QB7C 3G6JB 1IZJA 3NIFF 2OJEA 3RVWD 4LLUB 4LEOB 1V7MH 2JJTC 2YS4A 2DMKA 4PLKD 3TA3D 2KZ1B 5B3JE 1D3CA 4WHYG 3A0OA 4ZS7L 5FM5O 3ZDYF 1UADC 1WAAF 5FO8A 3C8DA 1QEWB 3L3JB 3HFML 5CEXB 4G6KL 3TBWA 4PJDF 3QDMA 2DOCA 5F1KC 2J4WL 3T0VA 5E4EB 4F15C 5KANG 1FQ9C 2ZUYA 3RGVD 1WBZB 4J1UB 4PGEA 2GYSA 3SDAA 5CJ5A 1LE5A 2FO1A 4MA7L 2ADGB 5H94A 4QGYA 4YK4B 2GJZA 1I1FB 5SV3A 4Y2DB 5E8PA 5AZEL 2ED9A 4F7TB 1A3RH 1BBDL 1A6UH 4TNVF 3ZDYE 3O3EB 1WAAE 3OAYK 3SY0B 2Z93B 3FO0H 4E42B 3RPIA 1J05B 3BKML 3C60A 4WW2A 1JHLL 3C6LA 3IFNH 4GKSB 1HKFA 4PJDE 1X5XA 1EBAA 4OZGB 3EO0B 3GIVB 5IJKC 4AY0A 4JKKA 4BFBD 3QNXA 4X6FB 1FYHB 5FFLA 5KZCB 2D7PA 1JRHH 2QHRH 3OV6A 3DBXA 3MRLA 5BZDA 3N9GL 2R23A 1N64H 1RJLA 4FRWA 3GM8A 3RNQA 1XGRA 3QEQB 1KN4L 4OIAA 1UZ6F 2X89D 5E2JA 5ESAA 3B3IA 1A6TB 4CVXA 1OAUL 4YDVB 1E4XH 5AYUL 4AG4H 4S2SB 3TA3B 1EMTL 2K1MA 2EDHA 1KELL 3VW3H 2OL3H 1RHHA 3EFFA 3VDBA 3QXDB 3W9DA 4NQSB 1H3UA 2Q76A 3QNZB 1DQTA 3X12A 5JR1L 2ZOKA 3ARBD 3QHTC 3SDDD 2VIRB 2Z92B 3DARA 1CK0H 3ALXA 5CP3A 5GS1B 3WXVH 3FHAA 4GQPH 1O7VA 1UZ6E 1SMOA 5DVMA 3GI9H 3RGVB 3ES6A 1NL0H 2CK0L 5TE4L 5DO2C 5MERA 1N5YH 3FO9B 1P4IH 3IXAA 2BC4A 1NGZA 2JJWA 2HLFC 4GRWB 1I9EA 1BZ7B 4YBLB 4RAUA 5DUBA 4PJ7E 3OGOE 5C3LD 1WV7T 1JGUH 1OTUC 1DCLA 3MBEC 1CD0A 5D2LA 4LSPH 5TFSH 2I9LB 3O2DL 2ARJB 2CUHA 3SOBH 3QHFH 4ZNEA 4WW2C 3C6LC 4ODXB 1OTSC 3V0AC 1N0XL 4XP9L 1ZT7B 4PJIB 2HFFA 1E4WH 4EKXA 2J12B 3QUZD 2JIXA 5F9JA 1MNUL 3GMOB 4K3JL 4KRLB 4M43H 4G6JH 5GISL 4MQXC 4TN9A 1VFBB 5MEQB 1S7RB 1U92B 3HI1B 4GQ9L 4XRCB 5T1KA 4OZFB 3LV3B 4W70A 4BA8A 5C3TA 1A14H 5CJQH 4UU9B 3F62A 2FB4H 3CFIC 5GSVB 3SO3C 5IHBA 4WJ5B 1A5FL 4HCRL 3BXNA 5C8JA 3ARBB 3SDDB 1BIIB 3WHXA 4PBVC 1KXQE 1NLBH 4IJ3C 1R3IH 1TJHL 2BNRE 4U3CA 3UTSE 2AJVL 4AM0B 2YD7A 2NLJA 4LCUA 1AXIB 1U8QA 3WIHL 4LPTA 3F7YB 3QZWB 3ROOB 4KROD 4JFEA 3HZMA 5ITBH 1A1MB 2HLAB 1EJOH 4JR9L 2OTUB 4Y1AD 5DRWA 3WEXB 1K4DB 2DM3A 3BH8B 4LPWA 4R7DB 3TVMD 1LDSA 4M1DH 2E6QA 1UM4L 1FCGA 5LXGH 1MCJA 5KVDH 4JZJC 2HG5A 4LPUA 4ZDHB 4U3HA 4NZDA 1T2XA 1A64A 4MSWA 4U1HA 4OAWB 4JKLA 4QRQA 5F7DA 1HIML 5ILTH 1CLCA 5TE7H 3V0WL 1JZ8A 3QUZB 1BJ1H 5FYKE 1SQ2N 3U9PL 3JV4B 3R0MA 3FB7A 4LLMA 4JM2F 1T03L 5A2FA 4IS6B 3J7HA 4V1DA 4RGOH 4TNWF 4GKZA 1P69B 2PW2A 4EUPG 1P7QD 3DXAE 3AU1B 3LD8C 1F3DH 1TVBB 2R0WH 3H3BC 2N4IA 1X44A 1KLUA 3O4OB 3OKDA 2R0KH 4ODVH 4UDUB 3ZMRA 2MQ0A 2UY6A 1OVZA 3CDYA 4L4JA 5DA4A 2Z8SA 2YSSA 1A6VL 5IK3A 4PRPA 1YMHB 4WWID 1NCDL 3DYPA 2NY3C 4ZUUB 4PRBA 1KIQA 3RHWF 2MOVA 5EPMB 4KROB 5FHAL 1ZTXH 3AGVA 4ONHA 3QWRD 4EN3D 3TPKA 5TF1L 2OK0H 2C3HA 4Y1AB 3U0WH 1YEHH 4EI6B 1R0AL 3QUMB 4PTTA 2E9BA 3TVMB 3B8YA 3IAGC 3MROA 5ID1B 1R3KB 2XWJA 3ILPA 1ZANH 2RIKA 2IJ0C 3MREB 4NRZA 1X3DA 3MLYL 3WIIL 5JIKA 5DHVA 4PRHD 1JGEB 2CDFB 5JIIA 2YZ1A 2B1HH 4R4BA 4GT7A 1BJMA 1MJUL 1LO0L 1YNLH 5I0DA 3BZDA 1X9QA 4HJJL 1WVZA 2JB5H 1DL7H 3EFDH 4Q97A 5F1NB 3VGAC 3VXOB 2IPTL 1P7QB 1P7KA 3WV0A 4PG2A 1RV6X 2Y72A 4N0FB 1C7TA 1VEOA 4LEXL 1EUTA 2R1XA 4WO4C 3ILQC 3UEZA 1XGTB 2EYSA 4TUJB 5JMOC 1VFUA 2NTFA 1UCTA 1AR1D 1MFDH 1DVFA 3PWPA 3KPRE 4P9HL 2F5AL 4U49A 1HCVA 4J3UA 1AHWB 4OCYH 1S9VA 2O5YH 4NNXA 1KTKE 4JKPH 4KJWD 3MV9A 4KK5C 1NCBH 2JE8A 5FK9B 3C09B 5CINH 3THMH 3D69B 4NWTH 4EN3B 2YC1A 3CK0H 5EBWB 3BZFB 3OKKA 4JJ5A 1IC1A 4P59L 2VDOH 3MV11 4OCMC 2NY7L 1JHTA 4NOBA 3HPJA 5C07A 1OAKL 5EA0H 4K8RD 5DSCA 5FGSA 3STZB 5GRZA 4F7MB 1ZVYA 3BQUD 3PGDA 4YHPB 5I17A 1JHKH 2LU3A 1CGVA 3LN5A 4PRHB 4GJTB 3QUXA 5DRXB 5K33A 4EIGB 1WBXB 3GBML 1N26A 4CADA 1SEQH 5LWYH 4TUKL 4RGNE 5JA8B 3L9RA 5I16A 4GSDL 1AE6H 2I5YL 4HX1B 5C0BA 3RIAK 5KSBA 2V5SA 2GFBA 1HI6B 2CLVA 4XX1E 2W59A 3MLSH 4Y4KA 5HHOD 2OR8A 2Y06H 1OT2A 4ZD3H 1SBSL 3RJQB 1J1PH 2QQLL 5INDB 5CP7B 5EZLB 4NBZB 2VL5B 4LPXA 3WFEL 3FMGL 1CIUA 4WTZG 3H9YA 1E28B 3VXRD 2VKWA 4GAFB 5T3XE 2PTVA 2OZ4L 1MH5B 4FQXA 1PEWA 4QXUL 1IC4L 3PQYD 5E9DA 4WDIB 2RB8A 3CLEH 3H9SA 5J11B 3NACL 5K93A 4F7EB 5F7MC 1H5BA 2Z4QB 4MGXA 1LGVA 5HHPB 5BMFH 2LFGA 4R90H 5CZVL 1LK2B 1CICD 1I8MA 2NX5D 4RNRA 5CIPH 2OCFD 4UT7H 2VDKL 2IG2L 3QHZH 4JQVA 5T33H 5D71H 5KSAD 5DI8A 5E2UH 4EOWH 1RK0B 5DQDL 2WIIB 4XZUA 3G6DH 1XGYH 3BQUB 2LTQB 1GOGA 3I9GL 5SWZD 1QFOA 1AGCB 2W92A 3B9KD 1JZ7A 3RFZC 4OF8A 5DMKB 3T09A 1U91B 3U0PA 2Y36H 3G5XB 4FG6C 4JRXA 3QUXC 4MD0A 3SGEH 4PJ8D 1WBYB 1DBMH 5HHOB 2CLZA 1QHPA 3FO1B 2BVPB 3BYTA 3Q6FA 1IM9A 3S37H 3HMWH 5HSFA 1U3HD 4UV4L 4X7CC 4HPOL 1OQOA 5IEHB 1BHGA 3GIZL 3QCTH 4LSRH 4DGYH 5D7LD 1DR9A 4ELMF 4O02L 3VXRB 3VFUA 1T04B 3T1FA 3DUUA 3QA3B 1LO2H 4LIQL 2DM7A 1H3XA 4P23D 3VXQB 3PQYB 3MYJA 5KG9A 1MY5A 1WIPA 4ZUWB 5K9JH 3D85D 4P5KB 2D3VA 4JKWA 4XVSL 4KK9D 5MEPA 4XCYB 4Y16A 4V2BA 4XPBH 5IJVB 1IT9H 1CICB 1U58A 2NX5B 1U8JA 2F58H 4K71B 4PJHA 3HTLX 2DQDH 4MCYB 5GGVY 1FG9C 4Z7NE 5KSAB 1QBML 2DTMH 5T1MA 4FQJH 4ELKB 5SWZB 1TFHA 3B9KB 1CDUA 4Z7WB 4AIZB 4JZNB 3OPZL 1OWRM 2P8PA 3MPCA 4G9DA 1ZLSH 1ZXQA 4CNIB 2X4UB 4PJ8B 3FQTA 4X0KB 4QYOA 1ZLWK 5E94A 2ZWLT 1GXEA 2ED8A 3K7UA 1ZLUK 4XC3H 4FZEL 2ERJB 4H26B 5F88A 3LKSA 3LZFH 4PJBB 3LIZH 3O0RL 5IB4A 1FYTA 2VLRE 1I7RA 1H3PL 4J6RL 4LCCA 3M1BA 4Z7VA 4NCDA 3GUTB 1S7QA 3H3KA 3FB8B 3MA9H 1T7YA 2QR0A 5D7LB 1MFBH 1I1CA 2W9DL 4OCLC 4PJCB 1XZ0A 1PBYA 4PS4H 4NN7C 4NKOA 4M03A 4EI5D 4JM4L 5LGJA 1RZJL 4LRIA 1AKJB 5HHVL 3RL2A 1WT5A 2N7AA 4P23B 4YFEA 1LILA 1ZMYA 4HBQA 3SDCA 1K5NA 4XAKE 4G8EB 5K59E 3VXMD 2IAMD 3FQXA 5IEKA 3X13B 3UTPE 1MREL 4ZTOL 4KPHH 5D5MB 1CG9B 4L29A 1TTFA 2MCPH 5BS0D 2ZUUA 3MLWL 4ONGL 4L8DB 5DJ6A 5LKNA 1T66C 4XBGA 4FFZL 5EU5A 4DN3H 3A6BH 4LLWB 5HYIA 2QQNL 4HUVA 1QLFB 1AC0A 4PRDB 5L7XL 3DV6A 4J8RA 1BFOB 1FLTX 5FUZH 1MAKA 4PJ5D 2X09A 1RJCA 1OAXL 2VABB 3NAAH 4PJAF 4DEPB 4UQ2A 5C0EB 2B0SL 2YN5A 4X6BA 4I2XE 4WI5A 3ZYOA 2HFEB 4ODBD 3PDOA 1JTPA 3OKYA 5I1GL 5F3HB 3U46A 1VB9A 2X6MA 2VLLB 3I75A 1EHLL 5J56B 3PV7A 4LKXB 1XEDA 3WFDH 5FYLL 1I9JL 5D96C 2JCCF 4LCCC 5D93C 1NMCC 4M48H 5H35B 4EI5B 4DOHB 1S7UA 5KN5A 1T0PB 4PJAE 3GDBA 1CWVA 2X4PB 2H1PH 4HIIB 4QHKJ 1X5IA 4LRIC 3WNPA 4I3SH 5IMOA 4JN2B 4PY7A 3VXMB 3DX9A 2IAMB 3FB6A 4PJFF 4NO3A 1HQRA 1VENA 2E6PA 4AH2B 3EO9H 5FCUL 4KY1H 4KTEL 1I9IH 2GUOB 3MLRL 5BS0B 1UCBH 1JWSB 4OM0L 1IM3A 1DLHA 2DLFH 4ZUSA 1CLZL 2YBRB 3AREA 2ESVE 5DMIL 1KTDB 3FFCB 3QDMD 4NC1C 2WUCH 4G43B 5L2KD 1HKLL 3QUKB 5MENE 1NAMA 1S3KH 4X7FC 4JDTH 3QULB 3SDAD 3BAEL 4ZPTB 1CI5A 3NIGF 3LRGA 3U2SA 5DHYA 1J8KA 5EUKB 3L1OH 3WS3A 3VD7A 5IFAH 1TENA 1DLFL 2AK1L 2XN9A 4OFVA 3U30B 1P84K 5DYOA 3HMXL 5I15H 4JFYA 4YZFF 3VWKD 2XY1A 4QRUA 2XZCL 1XGPA 3JSSA 5D1XC 3C60D 1X5AA 1H8NA 3MRMA 4QKXB 4NQDE 1PW3A 4RQQA 1U8IB 3WN5A 4M1GL 3GRWL 2XT1B 1KJMB 3NFPB 4MQXD 1DQML 3BKJH 5IB5A 1TJIH 4ZFFA 1UKQA 1OSZB 1JE6A 1N5AA 3T2NH 5I71B 3T3PF 2OJEB 4POZC 4XNMA 4WUUE 5F96L 2G2RA 1P4BL 3MOBL 4GAGH 5I19L 1K8IB 4HAFA 4OLWH 3FTGA 4IM8A 2IANA 3HNVL 3TN0A 1ROWA 2LVCA 4XC1L 1IGFL 1KIUA 3RVUD 3SDXA 2ATKA 4MDIA 5FO8B 5BV7B 4AQ1B 3E3QC 5C0FA 5F6HJ 4MB5A 1P4LB 1FGNH 3TBWB 1NFIA 3O4LE 5AAMA 5AD0A 1ZS8A 3QDMB 4XCFH 5L2KB 1J10A 3T3PE 3SDAB 1RPQA 1LE5B 3QYCA 3I3BA 3CUPA 3KJ6H 4I13B 5H94B 1YPZE 4KWUA 2GJZB 1C5DB 1S5IL 3LHPL 5E8PB 1LEIA 1EFXA 3VWKB 4TYUA 3LKQA 2C7UA 1KG0A 3C60B 2FNBA 3FO2A 5JPMA 4LASH 1B4RA 3SHSA 5I9QC 3HG1D 4E41A 1LMKA 3QNXB 5F7YC 3EYSH 4HKZA 4M5YL 5JW3H 2IPKA 3DBXB 3MRLB 3G6JE 5FYKH 1XR8A 4JKMA 3WN5C 2JIXD 4TSBH 5I18L 2ZCLH 3RNQB 2VMFA 1XGRB 2HVJA 1J9CT 1J5OH 3N1PC 4I77H 4UDTA 5HPOA 5ESAB 3N1GC 3QUYC 4CVXB 4XT1C 1YMMA 1KNOA 3MRCB 3QPXL 3VA6A 1IEBA 3ESUF 4XP1L 2DRUA 4N0YL 3MSPA 3GSUA 3NFNA 5EDXA 1AXTL 1RHHB 3EFFB 4JGUA 2YKLL 4OZGF 4RMVA 3EHBD 4CJ1A 2Q76B 3TN0C 2ZOKB 2R4SL 1HYSC 1M7XA 2VZ1A 1FNGA 2CR3A 3KYKL 3ZKXC 1PJ9A 3QISA 5IB3A 2ENYA 2JF1A 3ZSSA 4YHYC 5F9OL 5MERB 3LRHA 1NGZB 4JFED 4X9BA 3QXUA 2M2DA 2YN3A 3QO0A 4RAUB 3IS1X 2WZPD 4OZGE 5DJAA 1X5LA 3JTSA 3BP6B 3B5TA 3BN3B 5CGYD 3KS0J 2DLTA 4AENA 4KQ4H 2NZIA 3HG1B 3V4VL 3IFPA 2AABL 5HGAA 3QEQE 1B3JA 1Q9WA 1EVTC 2HFFB 3ULVL 4XP5L 1A7PL 3WJJC 2JIXB 4F8TA 5F9JB 2HVKA 2UVFA 1HHJB 1RUQL 5CLWA 2CRMA 1I75A 1K3IA 5J1AA 5IG7A 4Z5RA 5C6TH 2QEJA 3UJTH 3ILQD 3TP4A 4YQXL 1CQYA 3I50H 2C3XA 3MCLL 4QT5A 2J8UB 4L1HA 4K23H 1EIBA 2P5ED 3BXNB 4UQ3A 5C8JB 3A6CH 4TQEL 1D6EB 1DP0A 4UNTA 2CDGA 3GJFA 4O5LL 4PJIF 4Q6IA 3HRPA 4KK5D 1EJ6A 4Z6AT 4PRPD 1FZMA 4FQHA 4LGRB 5JO5A 4GRWE 3RJDA 2W1NA 1CDYA 2X42A 1MWAL 2F8OA 3MOAL 1U8QB 5KVGL 4RWYH 1OLLA 2AK4A 2EZ0C 4JFEB 4L9LA 3DX8A 1ZGLA 1XF4A 3BGFB 5I1KH 1A3LH 3K8LA 5DRWB 4OSUH 4KKAD 5AZ2L 3X3GH 4ZAKA 2C1PA 4GLRI 2BXZA 2J88L 3EYFA 1QR4A 4JVWA 2D4DA 4PJIE 2Q7YA 3NOIA 4HXBL 2HG5B 5IVXA 1S7TB 3CSYA 4MSWB 4U1HB 1OAZH 1U95A 1RUMH 1QBBA 2ICEA 4QRQB 5F7DB 1MCRA 3KYNB 3UDWA 1YNKL 4LLMB 3BOVA 3VG9B 2R69L 3SKMA 4N5EC 5GHWH 4GKZB 2PW2B 2VDPL 4LOUC 3O2VL 3IKCA 4O2FA 4J23A 4X7SL 1UG9A 1RIVH 4FQIH 2J6EH 2CUMA 1KLUB 2DYPA 3L5IA 4JN1L 3TWCH 5FM5M 2X4TB 4XMLL 4KHXH 4IOFC 2P5EB 2PKDA 5FUOH 1JK8A 1I8LA 2BOBA 3S97C 4J3VA 2YSSB 1RZJC 1CCZA 5GS2D 1MEXL 1E6OL 4UTBL 1DVFD 3RU8L 4PRPB 3PWPD 5HYSA 3RZWA 1A1NA 4PTUA 3WL9A 1NLDL 4FTVA 1W72L 1EVUA 2OX5A 3BE1H 5E4IA 2QJDA 3MV9D 4HEPG 3S96A 2QQKH 1JBJA 1MCBA 4JPVH 4PTTB 1DEEB 5E03A 2WLYA 1QNZH 3L3KA 1CD9B 1MQKL 5J06A 3MROB 1AO7A 4HUKB 1F8TL 3ILPB 2ARWA 5DQ9A 1OGTA 5C07D 3G5VA 2DM2A 4NRZB 4BSVA 5I75C 4XVUC 3QUXD 3VE0A 4DAGH 4YHIB 3MUGA 3IFLH 4QOKA 3F6LA 4R4BB 4HUMB 4OBSA 5I1JH 5EO1A 5C0BD 1NMAH 5IW1A 4Y4KD 7FABL 1NCWL 3OMZA 5EU7E 3UDWC 4I3GA 4F33A 2ORBH 2VN7A 1NKOA 1FLRL 1DFBL 1INQB 3HN3A 3PDDA 4PB9H 2R1XB 1T4KA 4AMKL 2B4CL 2OQJA 5D1QA 5ESVA 2P4AB 2EYSB 4KGLA 4FQXD 3P9MA 5JMRA 3V6ZA 1F58L 5E9DD 1DVFB 2AJZA 3PWPB 4NM8L 1CD1A 2X5PA 5C0RL 1S9VB 4NNXB 2APBA 5F3BA 4Y1AE 4YUEL 1QBLL 3MRKA 1WTLA 3CDFA 3MV9B 2X1XR 4FFWD 2ADFL 3AUVA 4IRJA 3FT4A 2CJUH 2VWEE 3NH7L 2VSCA 2OI9B 1ZVHA 2YC1B 4GOSA 2A77L 1H8SA 4EBQL 1I1AA 3OKKB 2VXUH 4JJ5B 5FHBL 1J0KA 2FX7H 3WXWL 1JHTB 2EDTA 1FL5A 2A83A 3HPJB 2R56H 4NGHL 5E6ID 1I9RL 5DSCB 2AXFA 3PGDB 1S7VA 1CE1L 1MCOH 3H0TA 3IDIA 4JHAH 2OR7A 3DNKA 3IDNA 4FXKB 1OM3L 1FSKC 4JRXD 5AUMA 3L9RB 5I16B 5DRZA 3S36L 5KSBB 2GFBB 2Z8RA 1JPSH 2PXYD 4Y4KB 3QWOB 5GSRB 2E27H 1S8DA 4G6AC 2YXMA 3ZE0F 1IM9D 3WNKA 4K94H 4QGTA 3U7AA 4QRRA 32C2A 1ZA6B 2OP4L 3EYUH 1KXTB 1WTGT 5AWNL 3V52H 2PO6B 5F8QC 4WY7L 1E6JH 5EBMA 4FQXB 4M6OL 2R9HC 5IW6A 2BVYA 2HTLD 1X5YA 5ECJE 5CGTA 5D1QC 1C5CH 3P4OA 2KKQA 2DAVA 5K9QG 5GGTH 4MXQD 5SX5K 3ZE0E 1FJ1B 1H5BB 3K2UH 2HT2C 2H3NA 3HI6H 4HXAL 4OJFL 4Y16D 3WO4C 5I1HH 4LRNL 5CJOL 1J1OH 1XR9B 1QO3A 5I8EA 4RNRB 4KJPD 3U0TA 3HUJA 1WWAX 4PRHE 3T65A 4HUNB 1V3LA 5DI8B 5E6IB 3LSOA 1I1AC 4G42A 3CH1A 4TOYH 4FP8H 2CR6A 2ZUTA 3U0PB 4HIXH 1H0DA 4X7TA 1DUYA 4JRXB 2PCPA 4MD0B 3I3DA 8FABA 3MRFB 5BW7A 2PXYB 4JQXC 3FQRB 3P0YH 2CLZB 1MLBA 5FO7A 3RUGA 3Q6FB 1IM9B 2XV6B 4YLQT 3PWUA 1BD2D 1FYTD 5C0AA 1NMBL 3BEWB 3U48A 3V4UH 4F2MA 1II4E 2AJXH 4QNPF 3T1FB 3VFUB 1Q9KB 3DUUB 1IGML 5D7SH 1PD6A 4KK6C 3B5HA 5DUPH 2EDYA 3DMMA 3MYJB 4R4NC 3SDCD 3OL2A 3VI3E 5KG9B 4X5LA 1KB5L 1J11A 2ZOLA 3OHXA 1U8OA 3BW9B 2B2XL 4Y16B 4LIQE 3KPOA 3WLWD 1F4WH 3W11D 1U58B 1U8JB 2P24A 5ERWB 1UWXH 1KIPA 4PJHB 4QNPE 1MOEA 1AI1L 2W0KA 4AEFA 4PR5A 4U1IB 4WU7A 5AYQA 2VXTH 1OPGH 2E7MA 4OT1L 2IBZX 5T1MB 2OSLA 2DF3A 4MA1B 4RDQG 5HI4C 4BELD 1DUZB 1ND0A 4W4OA 2UWEF 4HPYL 5L8JB 2P8PB 3AB0C 4G9DB 5HHOE 2AGJL 1NGQH 1T89A 1FDLH 3AY4A 2AEQL 4QYOB 1IJ9A 1YNTB 5E99L 1I3VA 5F88B 3DI2B 3LKSB 5IB4B 3GMQA 1BD2B 2JLLA 3UYRH 3VXRE 1I7RB 3HC3L 4XPAH 5DVNA 4LCCB 5BW7C 1JPTL 3M1BB 5J3HD 4Z7VB 2QR0B 4KRPB 4X80L 2X41A 3O6LH 5T3ZL 4I5BB 3PQYE 3WFBH 4X83A 4P5TC 1XZ0B 2VXSL 2AXJA 4NKOB 3PHOA 3B43A 3MRNA 3RL2B 4Z7WF 3LQZA 4GMSH 3IRPX 4QXGL 2VXVH 5E5MA 3SDCB 3ULVC 2V5RA 4KUCD 1T5WA 1K5NB 4POZD 1OW0A 5LCVH 2R15A 4U0QB 1CGWA 1RVFL 1P6FA 2NX5E 3DMMC 3O11A 1INEL 3FQXB 4RA3A 5FECA 5IEKB 3E6FA 5BO1H 4PJBF 3QT2A 4FABH 4WUKH 4I4WA 4YHZH 4L29B 5IT2H 3WDJA 2HT4D 5EU4B 5DJ6B 5SWZE 2Z31A 2DMCA 1ONQA 4KI5D 4XBGB 3BJLA 4Z7WE 2NXYB 4X5XB 4JDZA 5TH2A 5DDHA 5DMGC 4PJCF 4HUVB 5TGBA 3WE6B 2EDJA 2WP3O 3N1FC 3ARED 3DV6B 2GI7A 2HRPL 4J8RB 3C9NA 3QCUL 5I74C 5GZOD 2DM4A 3MJ9L 4TVPL 4AJ0A 4UQ2B 4PJBE 3HFMH 3FN0L 3OKEB 3R8BB 1AY1H 1GGBL 4G6KH 1UB6B 2J4WH 3PDOB 1G0XA 1BOGA 5D7LE 5D5MF 1X7QB 1WK0A 2FEEI 4JHZA 3U46B 3WIFB 3AY4C 3PWNB 4PJCE 1C16A 1GGIL 4MA7H 2A73B 4FQ1L 5A1AA 3QQ3A 1AGBB 1T0NA 1EBPA 4NNPL 4PY8J 4NO0A 4L8SA 3UYPA 1BBDH 4P49A 1ORSA 3M17A 1S7UB 1I3UA 4QHMA 4GO6B 3BKMH 2AJYL 3K80A 4YHOL 5HGDA 1JHLH 4TNVK 2H26B 1G7PA 1NCUA 2BMKA 3QQ4A 1INDL 5CSZA 5D5ME 4YFLI 1TITA 3DX9B 4L4TD 1CLYH 4DVRL 3FB6B 1OW0C 3Q1SH 4U2ZA 1HQRB 3MNWB 3N9GH 4ETQA 1K8DA 2IQAA 3SO5A 5JLZA 1KN4H 4HKJA 2FHCA 3FB5B 4X6CA 1IM3B 1IEHA 3EBAA 3QP3A 4JO2H 1OAUH 4ZUSB 5AYUH 4J3WA 3AREB 2V5MA 4X98A 4JFXA 1EMTH 3RX7A 1LE9A 3RWIA 1KELH 1FZKA 3OKNA 1NAMB 2ZUQB 1IAIL 1MFAL 1PFCA 1DQLL 1KN2H 1B9ZA 5TQ2L 4ZUTB 5ALCL 5DHYB 3GSNA 3WYRA 3WS3B 4C83A 2OLDA 3JWOL 1A6WL 3N50A 5DYOB 3T0BA 2Y5EA 4JFYB 4QRUB 3DYMA 1XGPB 4ZQKB 4EZMA 2CK0H 5TE4H 4DOHE 1X6LA 3SCMB 3WJLA 2E5EA 3HE7A 2IWGA 4E41D 3WN5B 4X4ME 3ESVF 1IGCL 2HN7A 2EKSA 1CQKA 3KVQA 3VXME 1SY6L 1P2CA 4L8SC 1D9KC 5DFVD 5IB5B 4ZFFB 3O2DH 3FQWB 3S7GA 5IBLC 1NBYA 1N5AB 1H9VA 1JFQL 1TDQA 3ZTJG 4L4TB 5J12B 5BS0E 2AQ1A 4XP9H 4XNMB 4GMTL 1YMMD 2G2RB 3EYOB 2D0FA 4YDJA 3FTGB 1I7ZA 1MNUH 4K3JH 3L3OA 5DEGA 3SDXB 2CKBA 2ATKB 3WUWG 2B4CC 3TBTA 4R8WL 4HWZA 4Y5YC 2E9WA 1YEGL 4Q2ZB 1QKZL 4ORGA 4PJ5E 1HOCA 5C0FB 5DJZB 2VZUA 4GQ9H 1HHIA 1NFIB 5AD0B 3VD3A 1ZS8B 5D2NC 3TF7C 2EC9U 4HWBL 4MAYA 3O3UN 4ZPVA 4M6AA 1A5FH 2DQGH 4HCRH 3E2HC 3CUPB 3TPUA 4CVWA 4KXZH 2Q8BL 1B0GA 1LEIB 3CFEA 5C08D 2AJVH 2EDEA 4IMKA 2EDOA 3LKQB 2C7UB 3UC0L 4UNVA 1KG0B 3MZGB 3WIHH 4MQTB 1EUUA 3BDYL 1V7ML 5JPMB 2E9JA 3RVXD 4E41B 4JR9H 1A22B 1XIWC 4HKZB 1FPTL 2FBOJ 4P2QA 2D7QA 5IROC 4TVSa 1IGJA 3HE7C 1UM4H 2C3WA 1XR8B 3CFCL 2BVQA 3MUZ1 1AGEA 1M7DB 4HK0A 4L5FL 4N5ED 4I8DA 5HDBF 4LOUD 2HVJB 1UENA 2YWYA 4OZFH 1HN1A 1JRHI 2IGFL 3QIUA 3IU3A 4XPGH 2VZ3A 3RPKA 5FKPA 5GGRB 2FATL 3U7WL 1YMMB 1OGAA 3T77A 4O2EB 1HIMH 3P40A 1IGTA 3V0WH 5ABDE 1QRND 3ARFA 5FYJU 1IEBB 5GGUA 3U9PH 1J18A 3GSUB 4JG0L 1E4XI 1T03H 4FHBD 3QDME 3OB0H 5L2KE 4OLVL 3MGAA 1EEZA 3K8KA 2EDLA 1FNGB 5HDBE 4TNWK 1J87A 3VFPA 5IB3B 1D5IL 5L8KB 3GSQA 2EE6A 5IW3A 1I85A 1WZLA 3UCRA 2QHRL 4V2CB 4ZG1A 1CFQB 1A6VH 1KYOJ 1ZHLA 2J2ZA 2AK4D 2VAAA 3IDMA 5E00A 4PGCA 5I8OL 5JIHA 4U4BA 3QO0B 5C08B 5EZIL 4NBYB 1ZAGA 5DJAB 1IILE 4PP1C 4ZAKD 4Q58C 2I07A 3PXHA 3C5SA 4AENB 4LAQL 4IMKC 3IFPB 4LQFH 5TF1H 3WKMH 1PZ5A 3FL7A 1R0AH 2DMBA 4WHTA 3ZKMD 5IGXL 2CXKA 3BHBA 4ZXBC 4JDVA 5EFIA 5C0JA 1JZ2A 2HVKB 4JANA 5F71A 1ZLVH 4KC3B 3PJSB 2R0LL 3QFJA 4N0UA 3MLYH 2VZTA 5EORL 3WIIH 1E4KC 5DC9B 2P49B 3AMLA 5IG7B 1CDIA 3SBWA 3GI9L 4Z5RB 2DDQL 1FVCB 4H1LH 3QIUC 1QRNB 3ULUL 1N6QL 1MJUH 1LO0H 4GBXC 2DYPD 3GMMB 4HJJH 4HUXA 1IAIM 4QT5B 4MCZA 2R2HB 3P9WB 3AMKA 3ARFC 2IPTH 4PRIB 2CDGB 3GJFB 4O51A 4Q6IB 5E7BA 4HULB 5KW9H 3H42L 1XH3A 4LEXH 3VRLF 5E7FA 1I7UA 2L7UA 4FQHB 5JO5B 5J6HA 5E08L 3LCYA 4CU6A 4KUZL 3NPSC 2BY2A 4X9HA 2AK4B 3HZYB 5L0QC 4L9LB 1F02I 4JFPA 1UWGL 5EOCL 1ZGLB 4FQPA 4LBEB 1K4CA 4JEGB 1BQHA 4P9HH 2F5AH 5JXEA 1L0QA 2X4QA 3ZYIA 3HG1E 2FO4B 4ZAKB 4HAGA 4P46C 5TDPB 2C1PB 3T0DA 1AO7D 1FIGL 2J8UF 3HI5L 3EYFB 1FFPA 2Q7YB 3FT3A 5IVXB 3VRLE 4NPYA 3OF6D 1DE4A 5CJQL 3CSYB 4NJAL 3TNMA 3QIBC 5M94B 4P59H 3H7BB 2ICEB 1KLGA 4L3EA 1QSFA 2NY7H 5DK0A 4NRYA 4QOKD 1OAKH 1VHPA 4OQTL 1UKSA 4PBWD 2XQYK 1R3IL 3MXVL 4PG9A 5DURD 3SKMB 3TNNA 3GBMH 3CMGA 5SWSB 3Q0HA 1BVLA 3IKCB 5EO9A 4O2FB 4TUKH 5BVPL 3K46A 1MCNA 4GSDH 3RY6A 3SBWC 5L9DH 4OZHF 5AG8A 2Y4SA 3WDIA 1D5MA 2MFNA 2PW1B 3FAWA 5I73B 1SBSH 4UAOB 2QQLH 2ZG1A 2AI0L 4R97C 2Q86B 2BOBB 4M7LT 4I1NB 1EGJA 2ZP0T 3FMGH 1KULA 3TYFA 3FZUC 1UJTA 4JFEE 3KJ4B 2ZG3A 4I9WD 4IDLA 3MLUL 4WEBL 3MNZA 2OZ4H 5EUOA 1JNHA 4G8GD 4OI8A 4QXUH 5ILTL 3LVEA 5TE7L 4IRJD 3SKOA 1IC4H 3OX8A 5DD3L 2QQQA 3S96B 3RWFA 4EDXB 4CU8A 3TIEB 2P48B 3NACH 3L3KB 5ICZB 4K2UL 1AO7B 2KUTA 2C3VA 4RGOL 1RMFL 5CEZL 5DQ9B 1OGTB 3G5VB 5C70A 4B41A 5C09A 5CAYB 3P9LA 4QHNB 5D1ZB 1N3NB 1PLGL 3MOQA 3ZO0A 4PRNB 3VE0B 3Q3GA 2VDKH 2IG2H 3MUGB 4PJEA 1FRGL 3I6GA 3KLHC 3CVHL 4B53A 5DQDH 3V7MA 1S9KC 5IW1B 5HYSG 3I9GH 5FUCE 3MXWL 2R2EA 3QQ9C 2CDEB 5DURB 4KKBC 5IWLA 4NNYB 1AH1A 3KPPB 3V6BR 3GJEB 1XAUA 2P5EE 3BUYA 5F9WB 4HJ0C 4FMFA 4DCQA 5L2JA 1G7HA 4CMHB 3RWHB 4R4ND 2EEDA 3U0WL 4OCXL 1YEHL 3IAPA 4QTHA 4PRPE 5HI5D 3H3PL 3P9MB 3RY6C 5ICXA 3V6ZB 1NCCL 4UV4H 4HPOH 1SJEA 1CDHA 4ZS6D 4OB5L 3GIZH 1ZANL 2FGZA 2AJZB 4O02H 1CD1B 4S0SD 5F3BB 1YEKL 5ISZA 3MRKB 4LIQH 2Q3AA 4G8GB 2C1OA 2FD6L 4IRJB 3EJZD 4Y89A 4NZJA 1WUNT 3O45A 4OF3A 1UB5A 5KSVA 1BVKB 1EERB 2ITDA 2JB5L 4RCAA 1UH2A 2DBJA 4XPHH 3SQOL 3JWDL 2YD5A 3KLAA 3FT2A 5DS8A 1TCRB 4UILL 4AIOA 1S7VB 4MVBD 1KB9J 4PJGA 3IDIB 3IDNB 4BKLA 4DK6A 3FFDB 1QBMH 4J12A 3IJSA 4F37F 1NC4A 3ZT7A 4BZ1H 5B39A 1FV1A 1CFTA 2C26A 5F6IB 2V7NA 1S8DB 4RA0C 4R7NA 3OPZH 4KHTL 1MHEA 1B6UA 2EEAA 1LVEA 1CZ8L 1MAML 5C0AD 5LGKA 1U8NA 4YXHL 2DQIH 5FDWA 1D5XA 4L3CB 2JB6A 5E6ZA 5IWLC 3EUUA 4NWTL 4R26L 2DI7A 4FZEH 4B50A 5D6CA 3O0RH 1ZKAA 3PWPE 4HGWA 5IW6B 1H3PH 2D2OA 4J6RH 1RZGA 3P4OB 2MKLC 3TLRA 4L8BA 3MV9E 4M61A 1F3JA 4NFCA 4OCSL 4PGBA 5T5NF 1JHKL 5KSBF 3OXSA 3NGBB 1RZFL 1AJ7L 2EC8A 4JM4H 2H3NB 1RZJH 3BZ4A 4G80A 5HHVH 5HBBA 4HIHB 5JQHC 5C07E 1QO3B 5DMGD 2V9QA 1QYGL 3U6RA 2E6JA 3HB3C 3KYAA 3U0TB 3HUJB 5EZJA 3D0VA 5GGVL 1GOFA 4LU5L 1CLOL 2WANA 4QTIH 1N2RA 1MREH 3QI9A 4UB0L 4ZTOH 5C9JB 3CH1B 1MCHA 4IOSD 5EC1A 2E8YA 5C0BE 2ZCHL 4DKFH 5KSBE 2D7OA 3MLWH 4ONGH 5F70A 1U8HA 1H0DB 2DQHH 4X7TB 1DUYB 4XNQA 3VA2C 3B2VL 4JFDA 4BK4A 2QQNH 1OD9A 1T2QL 1MLBB 2H2SC 5FO7B 3RUGB 2OJZH 3BT2L 1MFCL 3PL6D 3WNLA 3PWUB 3SGEI 2PTTA 1OAXH 4P4KA 5C0AB 1YC7A 3C08L 5D7IF 1ZWIA 2OL3A 4OKDA 4F2MB 3MRBA 5E9DE 1OAQH 2UYLA 4I3RL 3GMLA 2HFGH 5I1GH 4HS3A 4KDVA 3MV8A 1NANH 2J8HA 4PFEA 5E2UL 1EHLH 3RGHA 3CFDA 4R2GC 5HY9B 3V6OA 1BP3B 2CMRL 3OHXB 1R6VA 1U8OB 3VRIA 1I9JH 1CT8A 5I1DA 1G1YA 2NY0C 2Y6SD 3W9EA 4B0MM 3QFDB 3T2QA 1UWXK 3ZKQD 3EGSA 2P24B 1KIPB 2DWEA 1DBML 4RSVA 5F7EL 4PR5B 1UH4A 2Z31D 2VYRE 4RDQF 4WU7B 4NRXA 3F6IA 1G6VK 2OSLB 4MZ3A 4NN5C 4U7MA 5FV2A 4JRXE 5FCUH 1QSEA 5GS0L 3MLRH 4UBDD 2FZ3B 4OM0H 1PZUB 3MBXL 3EOBA 3T0EC 1CLZH 1I4FA 5DMIH 3DX7A 5EIVA 1S7XA 2EXWC 5K9JL 3PL6B 1HKLH 3GMQB 1PX4A 3RWCA 1BOYA 1A7NL 3BAEH 2BZDA 1G1CA 1VEMA 2GJ6A 2BY1A 2BVUA 4NZTL 3RWGB 4QRPA 3RKDD 2J5LC 5CZXD 2BDNL 4NO0D 1DLFH 2AK1H 2NY4C 3V6FA 3CVIL 3HMXH 4A2MA 3MRNB 1TPXC 2XZCH 3LQZB 4U1MA 5HVGB 2A0LC 1QHOA 5E5MB 3BSZL 1T5WB 3CFKA 1A6PA 5ELIA 4PGDA 4U6HA 1J8HA 3FAXA 3O11B 4PJHE 4M1GH 3GRWH 5GGSB 1SBBA 3E6FB 3V6OC 4OLZL 1DQMH 4I4WB 3SE4A 3G9VA 3ULUC 1HINL 1U93A 3WFZA 5H37H 2FJGA 2Z31B 1ONQB 3P4MB 1JZ4A 1BF2A 4JDZB 5TH2B 5DDHB 3RBSA 3B9VA 5F96H 3MOBH 5DGQA 5TGBB 5I19H 2D03L 3MA9L 1MFBL 3C9NB 3CZJA 1IGFH 3FQNA 5JORB 3QEHA 2SEBA 1HWHB 2NXZC 4I18C 1ADQA 3L5HA 3QG7L 5E8EA 1F97A 1BD2E 4OGAD 1FYTE 2W07A 4U1KA 3S4SA 4Z7VE 3GKWL 3L6FA 1RI8A 3PHSA 4U6YA 5TDOA 5CEYA 3BZEB 1KFAH 3CXDL 2CIIA 4YDLC 4PV9B 1PG7L 1QFWL 3E6HA 1C16B 3QQ3B 1QLEH 4OKVA 1T0NB 4B7IA 3C8HA 4HMDA 1F2QA 4UIMA 1J0JA 1S5IH 3LHPH 4NO0B 1NUNB 4D9LL 1UEMA 5D7KD 2YUVA 1HCFX 3M17B 4HC1L 2WNGA 5E5UB 5HGDB 3A6BL 4ACPA 1G7PB 3L3DA 1PKQA 4HH8A 2BMKB 4K07A 1EAPA 2XTJC 3QQ4B 5JZ7C 4WWKC 2RQ8A 2VNCA 2Y5TA 3NAAL 4YIQA 5HHXL 4MNHA 4WVRA 4ETQB 4ZFGL 4HK3J 5I18H 1K8DB 2AV1A 2IQAB 3J8F7 5JLZB 1HSAA 4XNXL 4X6CB 3EOAA 4NBXB 4M93C 3QPXH 4DW2L 3N1QC 4X98B 2WW8A 4H5SA 4JFXB 2QKIA 1LE9B 4Z77A 4N0YH 1FZKB 4MAYD 2C9AA 1G7QA 1AXTH 1G0YR 4NCC1 2YKLH 4M48L 4NKDA 2XZAH 4N0CD 3VD4A 2R4SH 3BPCA 4IIQA 1W0WB 3GSNB 2OBGA 5FOBA 3OAYH 2H1PL 4PP1D 1BEYH 4C83B 1AFVL 3BPLB 2E3VA 4K3DH 2YPKA 5F9OH 5HDQL 2XZZA 3UO1L 5IHUL 4YPGB 1UJ3A 1A2YA 1DBJL 5E1AA 2A6JB 4JFQA 5C0IA 1DSFL 1UCBL 1CFNA 4P2QD 1FL6A 3NTCL 5TE6L 1FVEB 1B2WL 4NIKB 1MCCA 5TDNB 3FRPA 4LLAA 1KCSL 1IGYA 3G5YA 5ESQA 5JW4M 2AABH 5I6XB 5ENWB 2RR3A 2MHAA 1OGAD 3ULVH 4KI5E 1A7PH 3GM0A 4J4PA 1EO8L 5GJTL 5F7UA 2X40A 3L3OB 5JXAL 5DEGB 1RUQH 4U1LA 2CKBB 4PUBL 5IFAL 2CH8A 3TBTB 4MXVE 1JGVL 2Y7QA 4ORGB 1VFAA 1HOCB 3NN8A 3TT1L 3MRPB 4YQXH 1HHIB 5D8JL 2FJFA 4MAYB 5C71A 3MCLH 1XGUA 1JTOA 4ZPVB 3EDFA 3JWNC 3EYQC 4YXKL 4IRSA 5BXFA 4APQA 2X1PA 2HT3D 2PYEA 2ITCA 4O5LH 1JMZA 2FX9L 4KV5E 3BKJL 1B0GB 3HRZA 1OTTC 2PYFB 2ZUSA 4NQCA 3VMPA 3CFEB 3GMPB 3LOWA 4KKCC 1KPRA 5EBLA 4IIQC 3VDAA 3T2NL 4OGZA 4WENB 3SDXF 3F12A 3BGMA 1MWAH 3UYOD 1MCSA 1AQKL 3MOAH 5KVGH 4ZFZA 1F11A 3JWDC 3L5WA 1M05A 3DROB 2XRAL 3GSRA 1JCKA 4DVBA 1UJ3C 2EIZA 3L3HA 4P2QB 5AZ2H 4U0RC 1QZ1A 5D7JA 1TQBB 4L4TE 2BVQB 4HK0B 5DK3A 2BSRA 1BECA 3BPOC 1VFOA 2R1WA 4HXBH 1JYVA 1PY4A 3QFJD 3IU3B 4XCFL 3P73A 5LQBL 3ET9F 4CUCA 5FKPB 1Z2KA 1FZOA 1ERNA 1G9MH 3SDXE 1OGAB 3T77B 1NGXA 3Q6GL 1IGTB 4QHLA 1PYWB 5GGUB 3KJ6L 1YNKH 5L6YH 3PP4L 3OB0K 4LLYB 2GT9A 2R69H 5DVLA 1DQQB 1VPOL 4J4PC 1EEZB 2VDPH 3O2VH 5I1LA 2JK5B 5HI3C 4X7SH 3KPLA 3O8XC 4Q6YA 4D0DB 1BQSA 1TIUA 4LASL 1FCCA 4XMLH 1GGCH 1SJVA 1QFWM 2C5DC 1ZHLB 3IDMB 3P0GB 5E00B 4LSQL 1MEXH 1E6OH 4UTBH 2H6PA 4APQC 5JXED 4WNQA 4LLQA 1NLDH 4E41E 4L3AA 3D6GA 5CJBA 3AM8A 3WFCL 2KDGA 2VL4A 3C5SB 3CC5A 3LN4A 5DZNA 2JTDA 4LSSL 4O2CB 1PZ5B 2APWA 4WHTB 2NZ9C 1X5KA 1MQKH 5EU6A 1QSFD 1L7TL 1F8TH 3BHBB 4JDVB 5EFIB 3U36B 4CKVX 5C0JB 5FXCH 1YMME 4JANB 4R0LA 4WI3A 3ULUF 2F53D 1GSMA 5IB2A 3QFJB 4N0UB 3O9WA 1T83A 4MAUL 4HJ0D 2ENSA 3KPSA 4ZSOA 5HHMD 3V0VA 3OR6A 3K81A 3Q5OA 2IQ9L 1YECL 1RU9L 5KS9F 1Z6JT 7FABH 1Q9OB 1NCWH 4MCZB 2IBGA 5IV2A 3I6LD 4Y5VC 1OL0A 1FLRH 3AFLA 1DFBH 2VQ1B 2XPGB 4TPRH 1X4XA 3DYOA 1BAFH 3VXSA 1I7UB 2R1YA 2B4CH 4AMKH 3FONB 5ID0A 4NSKA 3N1MC 4MX7A 5J6HB 5C08E 3KDMA 4DWHA 3HCVA 4ZO9A 2JJUA 1RUAL 4JFPB 1F58H 3REVA 1K4CB 2EH8H 4M9PA 5J7CC 3CMOL 5C0RH 1JTTA 4YUEH 4MLIA 1A1OA 3UJTL 2R4RL 1UXSA 1FFPB 2ADFH 1YDPA 4QEGA 5C09D 3FT3B 4NPYB 3GBNL 5FDYA 4JAMA 2A77H 4EBQH 5IHZA 5FHBH 3WXWH 1N59A 4U1GC 3MLTA 5CCKH 4K23L 1QSFB 3IXTA 4FA8A 1X4ZA 3MO1A 3V5DA 3A6CL 2P45B 3MRRA 4MDJA 4NGHH 1I9RH 2F53B 3RVVD 1JWMA 1QRNE 1CE1H 5ETUA 3TCLB 3G08A 4GRLD 5HHMB 3UTZA 1OT1A 5DJXA 1CVRA 4R0LC 3T0XA 1BVLB 1OM3H 2ZKHH 2FCBA 5EO9B 2AKRA 1T3FA 1HZHL 4P3CL 3G04A 4XXDA 2A6KB 4HLZG 1BQHG 5EIIA 4UUJA 3KHOA 5DZOA 1A3LL 1AXSB 4JRWA 5IVXF 4OSUL 1F45A 4DTGH 2V17H 1Z0MA 4I0PA 4RFNC 2FSEA 1IEAA 5IP4A 2OP4H 3TYFB 2AK4E 5AWNH 3N0PB 3OAZK 1C08A 4WY7H 3I6KA 4A6YL 1RZKL 3VFNA 4M6OH 5ISZD 1RUML 1CGYA 4HS8H 4YBQC 3SKOB 3OX8B 4NKIL 2HMIC 1WAAA 1TNNA 4FMKA 5IBUB 3RWFB 4LSVL 3NZ8A 4WGWB 5IVXE 2R2BA 1HNGA 3OXRA 5FYKU 2VQTA 2E7BA 1WEJL 1EFQA 2C3VB 4OFPA 4WCYL 4HXAH 4O58L 4OJFH 1FH5L 3ARDB 5C09B 4LRNH 5CJOH 2H41A 2J6EL 5IF0B 3OAUL 5F89A 3QJHA 3B9EA 4HD9A 4Y0GA 5T3XL 4PJEB 1MCWW 4JO3L 1YQVL 1RZ8B 1NC4D 1MIMH 2IADA 4LCYB 3BRGC 5KAQF 2B7DT 3VWJB 4GRLB 3UZQA 3EOTL 1T0MA 4WFHD 3O3BB 4M5ZL 4DUVA 3BUYB 4W81A 5IBUG 5L2JB 1D5BA 3T2PA 4CN6A 5HPMA 4IMLA 4HWUA 5ACZA 4JPVL 1IAOA 2FYYA 2Y25A 3RTQB 1U8MA 3LQAL 4UMGA 1JYXA 1SJEB 1RJZB 3JV6A 4HZLA 4K7FA 4UT9H 4LK4A 4KJQC 3MRIB 2VO5A 5K9OA 1IGMH 5ISZB 4RFOL 1WC7A 4DK3A 1TTUA 2C1OB 4NN6B 1AO7E 3O45B 3ALPA 1FNHA 2NNAA 4PLJC 5KSVB 5JNYA 5J0BA 4ZTPL 2Q1EA 4Y4HA 2BVOA 3P77A 5B38A 1BX2A 2E7HA 1J0HA 2ORBL 3KLAB 3FT2B 3QO1B 3WSQL 3DECA 3QI9D 5DS8B 4QOKE 4JG1L 4PJGB 4QRTA 1AI1H 3RWEA 4BKLB 3JVGA 3BIKA 2EXWD 4JFDD 4ODUA 4OT1H 5CKGA 1NC4B 2GAZA 5B39B 5ANMA 1FV1B 1P5VA 1CFTB 3BIAX 4TUOB 1ES0A 1HQ4A 2V7NB 4U1JB 4HPYH 5DFWH 1MHEB 2ZSWA 1FO0L 2AGJH 4P4KD 4GW4A 4GS7C 4LF3B 1U8NB 2VERN 1EXUA 5FDWB 1D5XB 1N7ML 2CJUL 2AEQH 1KBGL 1V3MA 3STLA 2DKUA 3SE3C 2IMMA 1REIA 2LVEA 5E99H 2CGRL 5D6CB 1DTUA 2FX7L 4HGWB 4I9WE 5JOFA 1RZGB 3MV8D 1ETZB 1JPTH 1FC2D 5CD5D 2CPCA 2FECI 4L8BB 4G8GE 4X80H 4M61B 1F3JB 4CL7A 5T3ZH 2W65B 3OXSB 1MCOL 1SYSA 2VXSH 1FE8L 4GKNA 3MLZL 3BZ4B 4G80B 4NO5A 2IH1A 1TZIA 5B39G 1HHKA 4QXGH 2Q6WA 1RQ5A 1B88A 3PV6A 3BH9A 4LP4A 4P2OD 1X5JA 4JFFA 5EZJB 3D0VB 1INEH 3PNWA 3HE6C 4LVOB 2APFA 4OD3L 5C0GA 1N2RB 3QI9B 4JFOA 2VKXA 1W0YT 4Y4HC 2F8XC 4NHCH 2VISA 4DZ8A 1QSED 1MHHA 1TCMA 3TC9A 2MPAL 1L7IL 4MS8C 3QEUB 4XP6L 5MP6L 2H8PA 1U8HB 1N8ZA 4P9ML 4XNQB 4JFDB 3RY5A 4OV6F 2XACC 4LDOB 1UM6L 5FB8A 3QAZC 5EC2A 3K4ZA 1I7TA 2EYTA 4LHUD 5GGTL 1SYVA 2PTTB 3MJ9H 4YNYA 4P4KB 4TVPH 2WINA 5IQ7L 2GJ6D 4F58L 1G7IB 3HUJF 1ZWIB 5IMKA 1GGBH 4QRPD 5LGHL 2UYLB 3GMLB 4NKMA 2YRPA 3MRJA 1XF5A 1ZT4A 2VUYA 1K6QL 4HS3B 5ACMA 3MV8B 5FF6B 5HD8D 2WBWB 3T0WA 1EX0A 1GGIH 4JPKH 2HRLA 5JZ7D 4FQ1H 3CFDB 3Q48A 4N8VA 4F57L 3VRIB 4NNPH 1MJ7L 1CT8B 4XVJL 1S9YA 1J8HD 4TOYL 1UYWL 1JN6A 4YC2C 1K2DA 3RUGF 2VC2L 3HUJE 4X5WB 2AJYH 4YHOH 5AEAA 1HHGB 2VH5L 3L3IA 4P2OB 2DWEB 1INDH 3BKYL 1G6RA 4DVRH 25C8L 1A6AA 2EDDA 1E27B 1LD9A 1L0XA 3PIQA 1QSEB 5EOTA 5A16A 5CS7A 4PJ9A 1MPAL 1XFPA 1HXMA 5D7SL 3RUGE 4TRPL 3EOBB 1RIHL 2DQUL 4C55A 1I4FB 2DI8A 3TJHC 1Z3GH 5C0AE 4G6ML 4X9IA 2CLRA 1AQDA 1WCQA 1S7XB 4GW5A 4LHUB 4TSCH 3TZVA 3TH3T 1IAIH 3RWCB 1MFAH 1ZA3A 4GRMA 1DQLH 1RIUL 2GJ6B 1ODAA 5TQ2H 3C8KA 4M3JA 1R5IA 3KLDA 3RI5K 4QRPB 3LEYL 4FN0A 3JWOH 1A6WH 3DX6A 4U6VL 2JJTA 3V6FB 1UA6L 2BHUA 3CAFA 4U1MB 3IDJA 4O4YH 4KRNA 1OPGL 3Q2CA 2EO1A 3CFKB 2I9TB 3CD4A 5DD0L 1J8HB 1OB1B 4XNZC 4JM2C 1IGCH 4U31A 4WI7A 3ECBA 4TTDC 1SY6H 1G9NH 3EDJA 2P5WA 3O6FC 3V8CA 1FAIL 1U93B 3NCMA 3SQBA 1IC7L 1JFQH 3HC0A 2FJGB 1M6OA 1FFNA 2FLRT 2IPUK 5JDJA 4GMTH 4UT6L 5E8DL 2X05A 5F97E 2ZJSL 2EIEA 2UVEA 3LN9A 4FNLL 1VFMA 3O6LL 3FQNB 3QEHB 2SEBB 4OFYD 4R8WH 1KIRB 1YEGH 1QKZH 1OTTD 3QPQD 3HZVA 4NUGL 5E8EB 3MCG1 5IJKA 1YPZB 2EXYC 5DEZA 3S9DB 3SJVD 4U1KB 5JW5A 1S9WA 3L6FB 4HWBH 5TDOB 5CEYB 3BP4A 2VE6A 1JGLL 5ALBL 3IS0X 1OHQA 4JJHA 3QNYA 2YUWA 3GSWA 3E6HB 4ODTH 1HE7A 12E8L 5BO1L 4U33A 4FABL 5I1CL 4OKVB 5HYJA 4KKLD 2ICWI 4UIMB 2Q8BH 4AIXA 1W8OA 4L4VA 4FQCH 4M3KB 4QRSA 1WLHA 3BJ91 3F7VB 3UC0H 1I8IA 2FEDD 3DVNA 4XHJD 3T4AA 3MLXH 3P0VL 5F7HA 3QXTA 2V5YA 3BDYH 2YD8A 1YJDL 1PKQB 4JY4A 1EAPB 3VFVB 1HILA 1FPTH 3JZ7A 1KJVB 4YIQB 2O61A 3CFCH 4MNHB 4L5FH 3S4SG 4KMQA 3NPZB 4J4PD 2AV1B 1AY1L 1J86A 3QQNA 1HSAB 2IGFH 5HI3D 2HJLA 3GFUA 1TZGL 3QRGL 4WU5A 1CDCA 1AGDB 2FATH 3EOAB 3U7WH 2JKXA 2DJ4A 3BMVA 4NQXB 5JHDA 2EDWA 3BFOA 4H5SB 2QKIB 2IALB 4Z77B 1W0VB 1EK3A 3MBEA 1G7QB 4JG0H 2BX5A 3RZCD 1V05A 3ARGD 3C2AL 4JREC 4XB7A 4OLVH 4NKDB 2XXCB 3BPCB 3BO8A 4IRSD 4LKCA 4M8QA 3SJVB 1A7BA 4HWEL 5FOBB 5HVWA 2PYED 1J7VR 4RGNC 2MCG1 3RY4A 1U3ZA 2F54A 2LE9A 2UY7A 1D5IH 4RMUA 2YPKB 3HLAA 4ZUVB 1NH6A 2H2PD 4X6CF 1CLYL 4HIEA 2CRIA 43CAA 1UJ3B 2B5IC 3Q1SL 4JPWL 2NZ9D 1A2YB 3S88H 5I8OH 5E1AB 5LJYH 1WFNA 4CVZA 4PLNC 5EZIH 4J3XA 3LDBB 1FL6B 2P7TA 4LCIL 5D7JD 4JO2L 2CXGA 2CKNA 1GC1L 2AJ3A 4LAQH 1IGYB 3G5YB 2XYCA 5ESQB 3D9AL 4B5EA 2BCKB 3N85H 4HBCL 2MHAB 4PJ7F 1I8KA 5BOPA 1IGIL 4X6CE 4ELMA 1PG7X 1KN2L 1FBIL 5IGXH 1S7SA 5C92A 5ITFA 1R3JA 2R0LH 5EORH 4U1LB 4R6UA 4L8CA 4R3SA 1VFAB 2DDQH 4QHUB 4PD4J 5HVHC 3C5ZA 3PG2A 3LQAC 2IF7A 1MF2L 2QSCH 3ULUH 1N6QH 1CGXA 3BWUC 5DMYA 2FJFB 3RZCB 5C0CA 3ARGB 1XGUB 5F1IB 5IKCB 1P6AB 3LEXA 4JZJA 4MD5A 4IRSB 5BXFB 3RVTD 5J6GA 5F72S 1DZBA 3FRPG 4XNUL 2PYEB 5A43C 35C8L 3HRZB 1JI1A 3H42H 2BK8A 3X11A 4KZEL 2FR4A 3AS3A 4KXZI 5E08H 3BGMB 5CFHA 5D7KE 3UPCA 3CX5J 4KUZH 4QWWC 2VLJA 4NC2B 2NY6D 4OCRL 5EOCH 1UWGH 3I02A 5CJ8A 2IC2A 1M05B 1U8KA 2JJSA 3DUSA 3GSRB 5B8CA 3LEVL 1F3RB 4DVBB 3L3HB 2EIZB 2IFGA 1V3JA 1VGEL 3UJIL 5EU6D 4F3FA 5D7JB 1FIGH 3GK8L 3HI5H 2BSRB 5J57B 1MVFA 2R1WB 4XPTH 1AC6A 3FQUA 4W6XB 3B2UD 3GNML 4KQ3L 3P73B 3O9WD 4JRYA 1KEML 2YEZA 4NJAH 3KPSD 1FZOB 1CXHA 1TLKA 2VRAA 3BPNB 2DQGL 4MQ7A 2A2QT 2L0DA 4RGMB 4MXWH 1FL3A 5DK2B 1S9XA 2H32H 1BWWA 1HH9A 2NY1C 4OQTH 5I8CA 5CLTA 4NZUL 5T3ZE 2A1WL 4HSQA 2GT9B 3MXVH 4MHHI 1U6AL 4XTRD 3QEGH 5I1LB 3DTXA 5DD1L 3MLVH 1T1YA 3GHBL 5BVPH 3UJJL 4EUPB 1NFDA 3VXSD 1FNSL 3S98A 4D8PA 3C5ZC 4Z0XA 1WWWX 2HMID 2FIKA 4Y5XA 3SKUD 2AI0H 3QDGA 5IUSA 5GGRY 1IQWL 2OTWB 2BXYA 3DSNA 3TO4D 1T21A 1A9EB 2H6PB 2BNUA 2XOTA 4WNQB 3MLUH 4LLQB 4WEBH 4XPGL 4XBPA 3ZE2F 3O41A 4WI6A 4F8QA 2NY6B 4P2QE 3NCBB 3LN4B 2LU7A 3CC5B 3ELAT 5DD3H 4AYFA 1QFPA 4K94C 4M7ZC 1ACZA 1OP3H 3BX7C 4K2UH 4WO4A 4MJ6A 1RMFH 2D7MA 1VCAA 5CEZH 4YPJA 2JJSC 4WI8A 4R0LB 5B8CC 1OGAE 4OCWL 5IB2B 4HS6A 4R96A 4RAHA 3O9WB 1B0RA 3MUY1 1PLGH 3L3GA 3KPSB 4JY6A 3TT3L 3ZE2E 3OR6B 4YO0A 4BQBA 4KK8C 3WD5L 1HEZA 1FRGH 2YWZA 4YDIL 1RJYA 3CVHH 2JCCA 4YHKL 4HG4K 1UEYA 5KSUA 3NZHL 5HJ3B 2WBJA 3MXWH 4JFZL 4LLDA 4KJQD 5IV2B 2ESVA 4ZOAA 1RHFA 3MGOA 1DBAL 4I0PD 1CXIA 3CZFA 3EJYD 5DT1H 2NR6C 4IRZL 1J1XL 1A7QL 5ID0B 3VXSB 2R1YB 2ZSVA 5FO9B 4NSKB 3W39B 4LQFL 4PJFA 1KPUA 4OCXH 4UOJA 2CIKA 2DIBA 3WKML 2R29H 3LQMA 3KDMB 3H3PH 4N8PA 4XWOC 1GPOL 1NCCH 3HCVB 1URLA 3GEWB 2L4OA 4OB5H 3TO4B 3REVB 3O3AA 4Y5XC 4TTGA 4NUJA 5I2IA 2A9NH 3IFOA 1F2XK 4XVTH 3UTTA 1IAMA 2C4FU 3F58L 1YEKH 4NQDA 1A1OB 1RD6A 5HGGS 1UXSB 1YDPB 2FD6H 5KBNC 4JAMB 5DA0B 3QXAB 5IFHL 1NGYA 4TULL 5J13C 5EULV 5SWQA 1ZHKA 5IHZB 1GYAA 2F74B 3D5OF 3TGXA 3QFJE 3KYOA 4N0UE 5E8NA 6FABL 3MLTB 3HPLA 3MO1B 3SQOH 4MDJB 4S1QL 3WLBA 3AAZA 3GMRA 3JWDH 3UAJC 1UVQA 1JWMB 2Y1VA 3V5KA 4UILH 5HHNB 5KW9L 1MRCH 1QSZA 3NFSL 1JUFA 3LKRA 2XKSA 2AKRB 1SVCP 1T3FB 3VGBA 3QUML 3G04B 4FQQB 2VXQH 4XXDB 5E0QA 4FFVC 4UUJB 3HA0A 5BZWA 4XBEH 1I1RA 3AC0A 4F37K 4KHTH 5H2BA 2QADD 5JQ6L 3TYGL 1PKOA 1CZ8H 1MAMH 4I0PB 2WBJC 5E70A 1YC8A 2V2XB 1YEIH 4YXHH 4HUWA 3DETC 4R26H 4B7LA 2J1KA 1XF3A 1K9TA 1N0LA 3I6KB 1U8PA 3JTTA 1JZ6A 1H3TA 3VFNB 3DO3A 4Z0BL 1CGSH 5A3IC 1GL4B 2P8MA 4OCSH 2FGWH 4DN4L 2ICWA 3NZ8B 5EBGA 4Y4HD 1RZFH 2R2BB 4NYLA 1TETL 1AJ7H 2NY5L 3OXRB 1P1ZA 1I3RB 4HT1L 2GK0A 1CN4A 1QSFE 2D7TL 4F7PB 5F89B 5L9DL 1QYGH 3QJHB 2F53E 2CUIA 3W0WA 3RWDA 1NBZA 4JQIL 1H3WM 5GGVH 2XTLA 3DSFH 3VFOA 5HHME 4LU5H 1CLOH 2X1OA 4S1DC 4OF6A 2IADB 4UB0H 3DHMA 1WWCA 1X5FA 4Q0XL 4XI5C 1EHAA 3OTTA 3EOYG 3TBVA 2ZCHH 1T0MB 3HC4H 4J3TA 1IE5A 3PGFL 1Q94A 3B2VH 4K7PX 1CS6A 3BRDA 3I6LE 1TJGL 1D5BB 1JV5A 1S78C 2VSDA 2FL5A 4CGTA 1T2QH 2WWMD 2KQNA 1ORQA 3BT2H 1MFCH 4J1UA 3ZSTA 2QADB 5ACZB 1IAOB 1U8MB 1NBVL 3C08H 2G5RA 2VQUA 4HZLB 5SX5H 4PJEF 5MI0C 3I3EA 5B4MC 1YJDC 3F8UB 3O3EA 4I3RH 2Z0BA 1T6WA 4E42A 3KXFD 3UTQA 5EIQA 4IEFB 3DI3B 1PSKL 4ZFOB 3IRZA 4OZGA 4P2YA 2NNAB 3EO0A 2K7PA 3GIVA 5DC4B 4C56A 2CMRH 5C09E 3F7PC 5JNYB 5C2BL 1QPXA 1A0QL 4JFFD 4ZYKB 3VCLA 5B38B 1Y6MR 1BX2B 3OGCA 1OF2B 4WV1C 3HAEH 5EN2A 3CSGA 4PJEE 5IMMA 4PP2A 4QRTB 3QAZB 5F7EH 2NW3A 3BIKB 3EDEA 1D7FA 3O2DA 4PB0L 5ANMB 4UI2A 3EJJX 1ES0B 2DQTL 2X10A 5GS0H 2AV7A 1DQDL 3BUTA 1YUHB 2ZSWB 4HK3N 3QNZA 1V5JA 3MBXH 3UBXI 4GW4B 4Z7NF 2VIRA 1EXUB 5GGQL 4LPYA 3STLB 4ZFOL 4K8RL 5B38G 1P5UA 1W2KT 4OLUL 3IF1A 5F7WC 1XF1A 2EKJA 1WICA 5C0NC 1LNUB 4I0KA 4NQEA 1NQBA 4HJGB 1A7NH 2VLKA 5E4EC 3TV3L 4XPHL 5ISZE 3DGCR 3A67L 1Z5LA 5C6WH 4NZTH 2BDNH 4Z7UA 1GC1C 4HCRA 4TTDD 4Y4FA 1SYSB 3QXWA 3CVIH 3KXFB 4GKNB 4YK4C 3R06A 2IH1B 2BHZA 4D94A 4Y2DC 5MEOA 5SX4H 2I9LA 1W8NA 2ARJA 3BSZH 3Q5TA 3QCVL 2ZNWA 2G5BB 3PV6B 4BZ1L 3BH9B 4N9OB 3MQIA 3W82A 4JFFB 4OF0A 1FORL 1P9MA 4LVNC 4PJGE 3WIHA 3PNWB 4J7RA 5C0GB 4OLZH 4LVHB 4XNYL 9CGTA 4ESKA 2DQIL 2VISB 3BP5A 1HINH 4DZ8B 4ONOA 5JDSA 4DFHA 3TFKD 1GH7A 3NVQA 1VFBA 5MEQA 2H8PB 4PJ9D 1N8ZB 1S7RA 1F4YH 3PABA 1U92A 5K59F 4M7KH 4XRCA 4WFHE 4OZFA 4NDMB 1U3HB 3LB6D 2D03H 2VDRL 5FB8B 4OF7A 1NGPH 3G5ZB 4PIRF 1WJ3A 3RVWC 4DGVL 1A9BB 2EYTB 4PLKC 3TZVD 3TA3C 1SYVB 4YNYB 3R8QA 4Z95L 2WINB 1JJUA 3QG7H 15C8L 1TQCB 5F7KC 5IMKB 4JY5L 3GKWH 1MVUA 3D85B 4NKMB 4BH8A 2CRYA 3CXDH 3MRJB 4F9PA 1R3HA 5GS1C 1PG7H 1QFWH 1XF2A 3VFSA 4ZOCA 3QZWA 4CAGA 2EYRA 3VJ6B 3RGVC 3T04D 4WI9A 4GFTB 4QTIL 3GGWB 4N8VB 3L5JA 3WEXA 1S9YB 1NANI 4D9LH 4DKFL 4HC1H 1LO4L 1K2DB 3BGAA 3WS6A 2DQHL 4YBLC 4KMTL 5T1DL 4Y4FC 3S3SA 4DGIL 3UMTA 3L3IB 2P5WD 3V9FA 1JWUB 4ZDHA 3L7FA 4MA3B 2OJZL 1JNLL 3F7QA 4FQLL 1ZEAL 3DV4B 3KPTA 2W0FB 1G6RB 1BMGA 5CGMA 1A6AB 4CDHA 5DWUL 5HHXH 1MRDL 4JVPA 3CFBA 1LD9B 1P9MC 4ZFGH 4JFDE 3PIQB 5EOTB 1KJ2B 5DJ2A 5A16B 3SE8H 4PJ9B 4M00A 5D1XA 4XNXH 5JHLL 1OAQL 2GITB 2MQ3A 1HXMB 2HFGL 1IARB 1VADA 2LV4A 4BSWA 3D2UD 2EDBA 5FIEA 1TVBA 4N8VG 4XCCL 3UZEA 4DW2H 2CLRB 2RBLA 1AQDB 5E8OA 4LNRB 3O2WL 1KCUL 1Q72L 4GW5B 3TZVB 4H1LA 4EDWL 3CSPA 3PWVA 4GRMB 1LP9A 3C8KB 1HSBA 2HFTA 1R5IB 3MV8E 5HYJD 3V79C 1M71A 1AFVH 4DZBA 1BREA 3ARBC 4L4VD 1HDMA 3DX6B 3SDDC 1WZKA 3T08A 1KT2A 3OZ9L 4W68A 5EPMA 5HDQH 3IDJB 5IHUH 3UO1H 3JUZA 2YD1A 3CPLA 5GRVK 3ETBF 1DBJH 4F9PC 1KJ2L 4ODWA 1JVKA 1DSFH 2AEIT 4BZ2L 1OP9A 5ID1A 1R3KA 3NTCH 5TE6H 1MI5A 2VDNL 1U36A 4F15B 4Y19A 3ECBB 3MREA 1B2WH 2P5WB 1RFDL 2QBWA 5IR1B 1KCSH 1EZVX 3WS6C 5DO2D 3HC0B 2BSSA 2CDFA 1FFNB 1QSEE 4W6YB 5LBSL 4PJ5B 4AEEA 1EEUA 1WZMA 2HLFD 4JREB 4N8CL 5JHDD 1EO8H 4K9EL 3GSNH 3LPWA 5C9KA 5GJTH 1OTUD 5JXAH 3QDJA 3MBED 4MNQA 5BCAA 1JPGA 3QUZC 2YK1L 4PUBH 5F1NA 1KTLA 3VXOA 4AEHH 2ZPKL 1JGVH 1N4XH 1WSST 3U83A 3NBNA 1VSCA 3MUJA 3D2UB 3CXHJ 3TT1H 3WUWA 4N0FA 4N1HB 4M4PA 5GGSY 5D8JH 2GJ6E 1S9WB 2XNAA 3C6LD 1OTSD 1HH6A 4QWWD 1CL7L 3BP4B 2VE6B 2DQJL 2V9RA 2F54D 3KWWA 4QRPE 3QNYB 4P3DA 3GSWB 4KJYA 1NEUA 4OD1L 4YE4L 4YXKH 4BFGA 3O4OC 3U7YL 4MJIA 1CF8L 5CZKA 3QUYA 2FX9H 3X14A 4L4VB 4QRSB 3RIFF 4RMQA 1KCVL 2HH0L 1I8IB 2CO7B 3DVNB 3T4AB 4EQ3A 3DRQA 1J8HE 5FK9A 1AQKH 4NT6A 3IVKA 4JY4B 1YPZF 3BZFA 1R24A 2OZ4A 2XRAH 4KROC 1HILB 4KGJA 5IFJA 1KEGL 3KYMA 3MFFA 1F90L 1MAJA 4XPFH 1GAFL 2O61B 2ZG2A 2AP2A 3STZA 5D70H 3TVMC 5HVHB 4LP5A 2XQYG 2VWEC 5DRXA 5LQBH 2HJLB 1MCDA 4C54A 4WU5B 1KFAL 4P9HC 1E0OB 4PGEB 5BJTA 3Q6GH 3C5ZD 5JHDB 3G6JF 3ZLQC 1QLEL 1RURL 3PP4H 3MBEB 1WZ1L 4WIQA 5C0CD 4LSUL 4YHNA 5GRJH 2VL5A 1VPOH 3DJ9A 4BQCA 4CDGC 5J8OA 4LKCB 3RPIB 2BSTA 4WW2B 3C6LB 4OV5A