1IFHL

A detailed analysis of the free and bound conformation of an antibody: x-ray structures of anti-peptide fab 17(slash)9 and three different fab-peptide complexes
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
217
structure length
217
Chain Sequence
DIVMTQSPSSLTVTAGEKVTMSCTSSQSLFNSGKQKNYLTWYQQKPGQPPKVLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSNPLTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG2A-KAPPA 17/9 FAB (LIGHT CHAIN)
publication title Detailed analysis of the free and bound conformations of an antibody. X-ray structures of Fab 17/9 and three different Fab-peptide complexes.
pubmed doi rcsb
source organism Mus musculus
total genus 51
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1993-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ifhL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ifhL01
1DTUA 1F90L 3RL1A 2F53A 3LEVL 5EULV 5FB8B 3GSNB 2QQKL 4N5EC 5FGCB 5JOPD 4F7MA 5I71B 1ZHNB 3KYMA 3O4LA 5IB3B 4PGJA 1I1AA 4KMTH 4P5MB 1Q9LA 2R39A 1ITBB 1CFVL 1ORSA 3V5HB 3CXDH 5MERB 1H3VA 1D7FA 2BY2A 4MXWH 3MMEB 4UQ2B 3RFZC 4OFKA 5ICZA 3RKDD 4H88H 5E00B 4KZEL 5IKCA 4ZAKA 5J9PB 4IRJB 3T0VA 3IXAA 1DVFC 4KHXL 4XVUC 2WBJA 3VXMA 1BZ9A 4XNUH 4TSAH 1YNTA 1FQ9C 3HS0A 3BWAA 3PJSA 4YHKL 5IFAL 2VLRE 3CXHJ 5IHLB 1GGUA 4MYWB 4RAVA 3DO7B 4HH9B 1P4IH 5ADPL 1BD2E 1R3JA 4WI8A 1UJ3C 2FEDC 2XZZA 3QR2A 3ZYOA 3IU4H 5KSBB 2F58H 4PREB 1A6ZA 2DQTL 3S37L 1IQWH 1BVZA 1OAZL 1WIPA 3P11L 4FG6C 5ESAB 1E6OH 4XC1H 3LZFL 5A16B 1UWEH 5F72S 3FFCA 2JJSC 4I48A 3I6GA 4Q6IB 1WBZB 4ODSH 3QCUL 5DVOA 1MFAH 3W0WA 1DFBL 1KB5H 3WXWL 4XP4H 4D94A 1IC4H 1X5YA 3WFDL 4N8CH 1DUZB 5I15H 5JMRA 4X5LA 1MREL 1MWAL 3VA2C 2AJ3A 1EMTL 4GKZB 3D1MC 4WTWA 2BNUA 2EE2A 5DJZA 3UAJC 3U83A 4LLVA 1IGJB 5IBLC 5F21B 4U0QB 3WNPA 3BN9C 1KCUH 3FQWA 3QXAB 1OP3H 4O5LH 4HJJL 3C60B 1A6VL 3LV3B 4JDTH 3DX6A 2VDNL 4MWFA 2VLRB 3LIZH 1A3LL 1A7QH 4UINH 4E5XA 2YSSA 4LF3A 4X6DE 2I27N 4PJFA 1MHHA 4G5ZH 5D1QA 4U1KA 3KHQA 4HX1B 1RUKH 1RVFH 3ALWA 1OF2B 1W0YT 4KAQL 5FUZL 4XWGL 1JRHI 4M03A 5HGHB 1WSST 4QRSB 2H2PC 4XPTH 2VZSA 4HPYL 3HZYB 4JZOB 3GM8A 1XGQB 4LVEA 4TUKH 4E41A 1V3MA 1TQCB 1NJ9A 2VDPH 3FQTA 2HLFD 2XRAH 1AD0A 1DQML 5DJXB 5BO1H 5BXFA 3KPSD 2BSRB 3INUH 2FECL 3HFML 3P4MA 3DV4B 1JF6A 1KG0A 2EIZB 3TA3A 1YEEL 4JREC 5FKAA 5BVJB 3DWTA 3KWWB 3X17A 4EDWL 3MJ6A 5KVFL 3QEQA 3BRDA 4ZXBD 3L5HA 1U93B 4LFHG 2VUYA 3PWPE 3MOAH 5IOPA 4NQVB 2DTMH 2G5BB 2VL5A 1A3QA 1OAUH 1WT5A 3WO4B 1S3KH 2VN7A 4PV9A 3H6JA 5F6HJ 1LQSR 2ICEA 5LGJB 4FQ2L 1OP3K 4HF5H 1SJVA 1DUYB 4JVUA 5F9JA 4S1SL 5CEXA 4R2GB 5ELIA 5BS0D 3SDCB 5C2BL 3RNQB 5FYKH 4EQ2A 1YMMD 4X6DB 2EEDA 3E1F1 4QHMA 3SQOH 5GZOC 4LU5H 4OCSL 3SE9L 1JVKA 2VXTL 2W1NA 5C0CE 4CVUA 3WS6C 1GOFA 5MI0B 4Z7WA 1UCBH 3LS4L 3HNSL 4KU1A 2GW5A 2DI7A 1ZSDB 3TO2B 4KK8C 2FX7L 4NSKA 1F8TL 1N8ZA 4Z0XA 4F37F 3W9DB 1KCRL 1AGCB 3GJFA 1GC1H 5TE4L 3RVTC 4WUUB 3EO1A 1IGFL 2RB8A 1VB9A 1KIRA 2COQA 1TZHA 1PZ5B 4L4VD 2HG5A 1ZEAL 1FO0B 1HHJA 4RFOL 1B6DA 2E7LA 5EBWB 1XCQA 4UU9A 3PWPB 5ID0A 3MSPA 5JOPE 1ZA6A 5F1OB 3RWCA 2M1KA 3IAPA 3QWOB 3VFOB 3QDGA 2QKIB 4PRHD 2IANA 4LSPH 4OCXL 5GGQH 3WUWA 4HXAL 1FH5L 4KPHH 4NN5C 1OM3L 1KT2B 3OJDA 5TDOB 2OSLA 3HC3L 2R23B 3CU1A 3MV7A 3QXDA 1KJ2L 3C5SA 2X1WL 4PJ9B 4G8IA 1EX0A 3QUKA 2GSGB 4MA8H 4NRZB 2X4PA 5HJ3A 5C0CB 2JK5B 4GS7C 2HFFA 3PDDA 1L7TL 5DK2B 2DI8A 4TVSa 3VRJA 1QFWM 4G8FA 4M62H 1P9MC 1BVKA 5EPMB 2BOBB 3BYTA 5AAMA 1LNUB 4XI5C 1AR2A 5GRUL 1KPRB 5F97E 2QEJA 1J12A 5TH2B 2EE6A 1T1ZB 3AVEA 2AERT 2B4CC 1NC2D 1PGRB 3NIDE 1K2DA 4J2XA 1RMFH 2XXCB 1J9CT 3TCXA 4OUUA 3O41A 4P2QB 4AH2A 4DVRL 5IM7A 2AKRB 3BD5A 2XN9D 1MCDA 1OB1B 5HGAA 3EYUH 4Y5XA 5C6TL 2GK2A 1CGVA 2P5WA 5I76B 1FFPA 3FT4B 1RJZA 4XBGB 5T1KA 2VLLB 4IOFD 3GSUA 1U8LB 5DO2D 1B2WL 1NCBH 1W0WB 1YN6A 2FL5B 4JZJC 3OF6A 4TNVK 2R8SL 3VFPB 4PJ7A 2VDRL 3DIFA 3I2CH 4FFYH 3ZE0F 1IQDB 4XPFL 4I3RL 1QVOB 4LARL 4CMMB 4Z7VA 4I0PB 1BMGA 5EORH 1R3LB 5L9DL 2QADC 1IEBA 1HIMH 1I8MA 4K7PH 1I3RB 5FGSA 5HYFA 5JPMB 3DGGA 4TUJB 1CIDA 3ELAT 5BRZD 5I1JL 5HHPA 4MHHG 5IK3B 4P3DA 3V5DA 2IPUG 1BOGA 2XY1A 5GISL 3ULVD 4LLWB 3KPPA 1DQLH 3W5NA 4YFEA 5DJAB 5D6DA 2UV3A 3FOLA 5EZOL 2I60H 1HSBB 3MJ7A 3ZTNL 2EEBA 5CJXA 1H5BC 1EEQA 1JWSB 4ZFGH 4HUVB 3OZ9L 3BW9B 3D18B 3KPSE 2Q76A 5AUMA 3O11B 3AXLA 2NX5A 5B38A 1LE9B 4WCYH 4R4FH 4RAUB 2ZCLL 3GMMB 4X6FB 4CU8A 3WDIA 5FYJD 5MEPA 2RAMA 3RWHA 5CGYD 4PJBB 2ICES 1BQLH 1YNKH 1T7XA 3QIUB 4MD5B 4KFZC 1VEOA 1TMCB 1FG9C 1A1NA 1PLGH 3TNMB 5F1NB 5HPMB 2VDKH 3FO9B 3U79A 2H26A 1YY8A 3BT2H 1YY9D 1A6TA 4ODWB 2PCPA 1VESA 1GGBL 2FO4B 1HHHB 1KFAL 1GZQA 3IRZA 3O6LH 2PO6C 1F3RB 5FO8A 1ACZA 1QP1A 1YNLL 1I7UB 3H3PL 4H8WL 2X4NA 5D8JH 1U95B 1YMME 3MLSL 1K3ZA 2PTUA 4JHBA 5DUML 2VWEC 3DI3B 3NCJL 3TCLB 1NMAL 5E6ID 1G1YA 2JKXA 4NBYB 2I25N 2DBLL 3QNXA 1GPOH 4OCMC 4RNRA 5LWYH 5DS8A 2EDOA 4HCRA 1YPZA 3VJ6B 3HC0A 1MFBH 4RGOL 4X7FC 4FTVA 4GG8A 3CD4A 3PWLB 3T4AA 3KPRD 1FAKT 1RK0A 5I1DA 2GK0B 4UNTA 1TVHA 2OCFD 4L4VE 3MJ9L 2QR0A 4ZXBB 2UYLA 2N7AA 4OLWH 2ZNXA 3FO2A 5AYUL 1N59B 1MF2H 3UDWC 3U1SL 3H9HB 5TJWK 5A1AA 1IKNC 2A6KB 5IMOB 2AEWA 2XZQH 4PRHE 5A3IC 2EC8A 4DN4H 3S36X 3L3JB 1KTLA 3O6FD 2EDLA 4XPHH 4YH6A 4M7LH 3G6AA 1KB5B 1I1AC 3P4OA 3PDOB 1RUQL 4HDIA 7FABL 4MJ4A 1I4FB 1I8IB 5GGVY 3L1OH 2YPKA 2VABA 1CFSA 3B9KD 5M7QA 1REIA 4D0DB 2RCSH 3BXNB 4UUJA 4XMKL 1FLRL 1Z9SA 3UC0L 4WEBL 4ZAKC 4Y16D 3VXPA 2VISA 1JPTH 5E1AB 5GRJL 8FABA 3BKMH 4U1IA 2WBJC 1HWHB 2BCKB 3O2DL 2X7LA 3HE7A 3KPQA 4YZFF 1AXTL 35C8L 4F3FB 3U48A 2BSTA 2OMNA 1A14L 4PBXA 5BQ7A 5IT2L 3NZ8A 1FV1A 4OCYH 3D39D 2XIDA 3D85D 3VGHA 1UH4A 3U2SB 2ED8A 2XN9E 4ODVL 3OB0H 4P9ML 3CK0H 2EIEA 4MA3A 4HK3J 2AJUL 5HTSA 1G0XA 4EBQH 2AI0H 3QEHB 1JHKL 3PL6B 4P57A 4PRHB 3BRGC 4IOIA 4U2YA 5ESQA 3K1KC 5C9JB 1HXMA 4HIEB 2Q8BL 5DRXA 1JL8A 1OGAB 2NY6B 4AG4H 5IW6B 2RIKA 4FQXB 5CEYA 4P2CG 4KVNH 4TN9A 4U2ZA 3QH3B 1R3HB 3LQAL 3ZT6A 2ZUQC 4S1DD 3AY4A 1UXWB 4HFWB 4PV8A 1S5IL 3UO1L 3VXRB 4ZS6D 4WW2B 3U0TA 2MQ0A 3TT1H 1OHQA 5FB8A 3GSNA 5BRZE 3GK8H 2FR4B 1ZHNA 4NKQB 5IB3A 3VE0B 1DN0B 2IPKB 5GS1B 4P5MA 3O4OB 5DQDH 4NP4H 3V5HA 3ULVE 1ED3A 5MERA 1U91B 1RQ5A 4PJ5D 1TQBC 2XTLA 1A0QH 4UT9L 1J1OH 3WLBB 1T03L 3DXAB 1NC2B 3MMEA 1PG7H 4UQ2A 1X5KA 3C5JB 5EN2B 4FOMA 5D1QC 5A40E 2VQUA 5AWNL 2WANA 5GRVL 5J9PA 5CZKA 2EDFA 3CZJA 3BRFA 4NZTH 3OB0K 4DQOL 1QFOA 2E27L 3IDMA 2DIBA 5FYJE 1KV3A 4M00A 2GTZB 3N1GC 1U36A 3ARTA 4HH9A 3GMRA 3DMMD 4PJAB 1X5IA 5DMGC 5ID1A 1TETH 3GSXB 5JW4N 2YPVL 3SGJA 4M6OL 5KSBA 3DX8B 3TA3C 4PREA 4X7SH 4LVOC 5ESAA 1EZVX 4ONGL 1RURL 4Z5RB 3LKRB 4NZRL 4RMSA 5A16A 2WAHA 1G9NH 1S78C 1OPGL 3S3SA 5I1GL 2B8OT 1JFQL 4Q6IA 4QCIB 2HTKC 1WBZA 5FV2A 3MOQA 1WT5C 1E6JL 2KDGA 2IBZX 2MKWA 2VC2H 2LVCA 4YR6B 1DUZA 3CXHK 3A6OA 5EU7E 3O3UN 3BQUD 4GKZA 1WBYB 4OKVB 1BF2A 3MZTA 1IGJA 4DTGL 4LGSB 3CSBA 3QXAA 2QV2A 3OTTA 4AMKH 3KPRE 3C60A 3LV3A 5DURB 1MHPH 4PJIF 3GI9L 2VLRA 4CKVX 5CJBA 4JVWA 2ED7A 4M6AA 2BVOB 1UWXH 5I1CL 4LQFH 3RZCB 3SE4A 4HX1A 3FOMB 1JHTB 4GAFB 1OF2A 4NC1C 1N0XH 3HPLB 2BXZA 3OJMB 5HGHA 4QRSA 2AJXH 1VKXB 4N8PA 2I26N 3G6JB 1OTTC 2A83B 3HZYA 4JZOA 4XX1G 1XGQA 1JNHB 4KJQD 2DLGA 2EH7L 2UY7A 5D72L 3QUZD 1FAIL 3TPUB 2E7LC 2VIRB 4O4YH 2BSRA 4CVZB 3U30B 4TVPD 3DV4A 1CXFA 4BZ2L 5ABDE 4Z95H 1FZKB 2EIZA 1AR1C 1J5OL 1KLUB 5BVJA 1E4JA 1TFHA 3KWWA 1XT5A 2WP3T 1ZK9A 3TWCL 1Z0MA 1IAMA 3NIGF 3EOTL 4RCAA 1IT9L 2VJXA 1U93A 2BNQB 3ET9F 4WHTB 1VGKB 4NQVA 5C0GB 4YHML 2F8VA 2G5BA 1MCWW 3OKLB 4ZODA 1OP9A 2VR4A 1J05B 2AQ1A 1AJ7H 4KRPC 4PIRF 2XKSA 3V4VH 3ULUC 1W8NA 5LGJA 3BKYH 2O5XH 3KPRB 5J3HD 4JAMB 1DUYA 2VSCA 3WFEL 3SDCA 3RNQA 4DFHA 4MCZB 1XIWB 4R26H 1UM6L 2ADFH 2FRGP 4X6DA 1JZ8A 1C5DB 3SY0B 2DBJA 3D39E 1UWXK 5FYKU 4NO5B 1UKSA 3QQNA 4EOWL 2XTJC 5A43C 1VERA 2AXJA 2C3GA 1YQVL 2W0LA 2C4FU 1CZ8L 1EXUB 1ZSDA 3TO2A 1ADQL 1FL5B 4K8RH 2A77H 3BZDA 3O6FB 4Q0XL 3RU8L 1NL0L 1X4ZA 1OAXH 5AD0B 4HBCL 1AGCA 4XNQB 4Y5XC 4I4WB 5K9QI 3GBNL 4O58H 5KBNC 4WUUA 1VFAA 3L6FB 2AK4B 3JWDL 4WWKD 3UYOD 4LSQH 4YHOH 4P46B 1QTYT 1PZ5A 2CLRB 4WTZG 4U6VH 3B9KB 1FO0A 1UM4L 4RIRB 3MUY1 3PWPA 4LEXH 2Y06L 4GKOA 3VFOA 3QWOA 4H20L 5D6CB 4Y16B 2QKIA 2YD8A 5DVLA 3GSOB 3THMH 3MODH 4ZPVB 4DKEH 5T3XH 2XYCA 3EAKA 1CDGA 4S0SD 4PJ5E 1KT2A 4NGHH 1T20B 2GJ6B 5IFHL 5TDOA 2N7BA 2R23A 2OJEB 1VGEH 2VERN 2YD6A 3LVEA 2XKNB 5L88H 4PJ9A 3D85B 2GSGA 5D6DC 4NRZA 4N0CD 1YMHB 5C0CA 2JK5A 5DK2A 1UACH 1CXEA 4FQLH 5CJXC 3K8MA 5EPMA 2BOBA 4JGMA 4A6YL 4ZSOE 3VXNB 1MRFL 1LNUA 4KGLA 5IEHB 2FDBP 4E0RB 4OB5L 2BVQB 5TH2A 1T1ZA 4NRXB 4PJDE 5IVOA 2F19H 3QIWD 1U58B 4MMXC 4P2QA 4WO4D 1JNLL 2AKRA 2VXUL 1QHOA 1OB1A 5IB5B 5D93B 4X9IA 5I76A 1GRWA 4NQDB 4TSBL 3FT4A 5FCSH 4XBGA 1HKLH 1A3RL 2VLLA 5DTFB 3RGVD 2HT4C 4H0IA 1BFVH 1U8LA 2FL5A 1W0WA 5TQ2H 1P1ZB 3SEPA 1S7UB 5DD1L 3VFPA 2R56L 4PJ5B 3A6BL 4TTDC 1BOYA 5D2NE 5EA0L 1UM5H 3MO1B 2UZXB 1IQDA 4M6NH 1QVOA 4CMMA 1B9ZA 1XAUA 4I0PA 5DRZB 1R3LA 2GHWB 4QOKD 1I3RA 5JPMA 4TUJA 2Q8AH 4PB0L 4X7DC 1PX4A 3ARED 3VGFA 5JA8B 5DSCB 2V9TA 3BUYA 1NBVH 4I18B 5IK3A 4IIQA 3QYCA 3AGVA 4TQEL 1FNEB 3GHBL 3IKCB 4LAJH 2WIIB 2VDOL 2DJ4A 4LLWA 2GYSA 2FH6A 4PJCB 5FDWB 4Z7NE 2XACC 1YEIL 3H9YA 5DJAA 1Q94B 4EXKA 1A7PH 3ZMRA 2V7HB 3PGCB 1MH5B 3DBXB 4PJDB 5CFHA 2EDBA 4PLKC 1HSBA 1CL7H 5D1XB 4KJWD 1JWSA 4PJFF 1QSFA 5JNYB 4HUVA 1CK0H 4QYOB 4JY6B 5K9OB 5CWSB 3BW9A 3D18A 2ESVD 3O11A 4N68A 1LE9A 1ZVHA 4TVPE 1U2CA 4RAUA 4NUJB 3GMMA 4X6FA 5J12C 2QLVB 2OTPA 4PTUB 5K9QG 1IC7H 4PJBA 4OLXH 1V05A 4MD5A 3QIUA 3IDYC 3RWEB 3BHBB 2ZJSL 2XY2A 5FUCE 2QJDA 5D2NB 4JR9L 2EDEA 5F1NA 5HPMA 3C09C 4Y8AA 3FO9A 3S9DB 1A1OB 1CG9B 3WIHA 5E2WH 3MOBL 4KJPD 4ZO6A 4ODWA 4MNHB 1MCFA 2D7PA 1HHHA 2FO4A 2PNDA 3DVGB 3ZZ1A 2R2BB 4UAOB 2DI9A 1X5FA 4TRPL 3I3BA 4D0BB 4NUGL 3OAYH 5IBUB 4RWHA 1G0DA 1I7UA 2W0FB 1GYAA 2JJTA 3ARYA 3N9GL 2HRLA 3WBDA 1U95A 1R5WB 5SWZD 3O6KH 1BAFL 1GSMA 1I3GL 3MREB 2V2WB 3HE7C 3HAEB 2LVEA 3M8OL 3MLWH 1KELL 5DJCB 3TCLA 2FO1A 3NZHL 5D5ME 3VFGL 4OD3L 3QUZB 1T83A 3VJ6A 5ICXB 1QNZL 4D9QD 4XMLL 4QNPE 3PWLA 3SKNB 5M95B 3O3BB 4Z7WF 5IW1B 5JA9A 1I1YB 4PP2B 2GK0A 2YD9A 4CBPA 3R4DA 5C1MB 4ZUSB 5DZOA 1F90H 3LEVH 5ERWB 2XG5A 4ZXBA 1ONQB 2QQKH 2BNRD 3CMGA 3QAZB 1ORQB 2HKHL 3WLWD 1FSKB 1N59A 1UQSB 3BJLA 5GGVL 3KYKL 3H9HA 2A6KA 3AY4C 3ARFB 5IMOA 5CLWA 4P2RD 1CFVH 4JB9L 3ESVF 4G9FB 3BZFB 2LFGA 1KGCD 4X7TB 4U6HB 4KKBC 3OAYK 2BVUA 5I71C 2EDDA 1KB5A 3PDOA 1UCTA 4HZLA 4KZEH 3CVHB 4XVSH 5DHXB 2OTUB 4M7JH 5CD3B 1HK6A 1I4FA 1I8IA 3JWOC 2Q6WB 1JIBA 3TFKD 4JKPL 4WEUD 4YHKH 4D0DA 5IFAH 5D5MB 1IAKB 3BXNA 1TJIL 4GBXA 1SJEB 5HSFA 3RI5K 2OI9B 5ADPH 5JIPA 1GH7A 1BWWA 5E1AA 1F11B 4S1QL 2BCKA 5F7DB 3WFZA 3RWIA 3HNTL 4ENEC 3QWQB 4QKXB 5K93A 3ULUF 4C56D 2DQTH 3NFSL 4Q6YA 4F3FA 1OAZH 3P11H 4B7IA 3MR9B 3BO8B 4M7ZB 2MCPL 2L7JA 1BIHA 4QT5B 2VE6B 3SGJC 3U2SA 1ZHLB 4EJ1C 3TESA 3QCUH 3TJHC 1DFBH 3WXWH 4XZUB 2BK8A 2NY3D 1TDQA 3QEHA 3PL6A 2UZYB 4PRHA 4JLRB 3ZKND 3WFDH 3ULSB 5D7LA 5C9JA 3QI9D 2X1OA 4HIEA 4OFPA 1MREH 1MWAH 3LKSB 4K23L 4Q6IC 1N3NB 4PP1D 3T2QA 1OGAA 5IW6A 1EMTH 1YDPB 4FQXA 2ZOKB 3ZKQD 1XR8B 2CJUL 3QIBD 1K6QL 1ROWA 3QH3A 3KS0J 1R3HA 1UXWA 4HFWA 3VXRA 5F6HI 1IJ9A 2EXYC 4PTTB 1LGVA 2EDHA 4WW2A 4OF0A 1JPST 4JO4L 4HJJH 4QOKE 1A6VH 4PJ7F 1OLLA 1F5WA 1DL7L 1X5ZA 2VDNH 1A3LH 2VAJA 1ZV5A 5EUOE 2FR4A 2E9BA 5HHOB 5ITFB 3SKJL 3BPOB 3RIFK 3VE0A 4Z7VF 1DN0A 2IPKA 2XA8L 3BDYL 5DMYA 1MVFA 3GRWL 2JIXB 4KAQH 4XWGH 5FUZH 1J1PL 1U91A 3RX8A 2DM3A 3C60C 4YUEL 5HI5C 3MRQB 5IBUG 2FHCA 3IFLL 3L5WB 2NY4D 1X5LA 3WLBA 3EFDL 5T1DH 5C0NC 4M9OA 1CDCA 3DXAA 4HPYH 1NC2A 5I1LB 1J0JA 2R9HC 2VLKD 3TVMD 3C5JA 4ACPA 5IP4A 2NXYD 4PGEB 5EN2A 3SE4C 3V4PL 1DQMH 3RKPA 2YUXA 2ESVE 3HFMH 3TJEL 3IFPB 3E0GA 2GJZB 1YEEH 3J7HA 2GTZA 1FYHB 4BQBA 4U7KA 2ILLA 2PW1B 1TQCC 4EDWH 3L3GB 4PJAA 5KVFH 2D4DA 3MBXL 3RA7L 1Z9OA 4WTZA 3GSXA 2D7MA 4CL7A 3MLPA 3NCEB 3IXTB 1U8HB 3UZEA 1P84J 4Z18A 3Q5YA 4Y4KD 3VFWB 3OHXB 1CXLA 3LKRA 5TF1L 4FQ2H 3HG1D 2H9GB 4S1SH 4OQ1A 3PHQB 4O51B 4QCIA 3AREB 2BSSB 4ELMF 1FYTB 3CFBA 3KLHC 5DK3A 3U82B 2WBWB 5IHBA 5SWZE 2VTFA 1DBKL 4OCSH 3UTOA 3SE9H 4YR6A 4M1DL 3PF2A 5IB4B 3RVVC 1MIML 4JN1L 2JJVA 4R2GC 3LS4H 3SDCC 1BPVA 4Y4HA 2IQ9L 1IZKA 3HNSH 3MA7B 1WBYA 2VDLL 4G6KL 3JZ7A 2N4IA 4OKVA 1N5AB 2FX7H 4PG9B 5AZ2L 5BCAA 3VA6A 3BEWA 1F8TH 5BJTB 1KCRH 4AQ1B 2ESVB 3DX7B 4D9QE 5TE4H 5MI0C 1L9MA 3JV0A 4P49A 4HBQA 5D7JB 1A7OL 1IGFH 1IKFH 1KIPB 1ACYL 2SEBB 3CDCA 3P0YH 5I66B 5F9DC 1ZEAH 2BVOA 1YPZF 4RFOH 3RZCA 3FOMA 4ZQKB 1JHTA 5D7IB 5IHZB 2BNRE 1A1MB 2BP3A 3VXOB 2NXZC 3F5WB 2NW2B 3HPLA 4G7YL 5INCB 3GEWB 3DTXB 3RTQB 1VKXA 4P2RE 3G6JA 4GRWE 2EO9A 2A83A 4OCXH 3HNVL 1QEWB 3OKOB 3V5KA 1X4YA 5B8CB 5KS9B 1JNHA 4JO3L 5H8DA 2D9QB 4U3CA 1KGCE 1FH5H 1JYNA 2X4QB 1OM3H 5FEBA 3TPUA 2VIRA 5CINH 2F74B 4CVZA 2ZZUT 5H35B 1KJ2H 5CJOL 4MAYD 2ZUYA 5SWZB 1FZKA 1LWRA 5CMAB 1FIEA 1XH3B 3KJ4C 3ROLB 3TT3L 4BQ6A 4EIZC 1L7TH 2E9IA 1QLRB 4YAQB 3WV0A 1CE1L 1MPAL 2BNQA 3WEXB 4WHTA 1VGKA 3BFOA 2ID5A 5C0GA 1IM3B 3I02B 3OKLA 4AIOA 4PJ9C 4OFYA 5EC1B 4N1CA 5E9DD 1J05A 1S9WB 5DEZA 2DMCA 2J2ZA 5K33A 4EVNB 2CDFB 2FATL 3KPRA 2YR3A 4JAMA 4C56E 4AZ8A 4KDWA 1MCRA 4MXQC 2YN3A 4MCZA 1XIWA 4C54A 4X6CB 1C5DA 3O9WD 4FQQB 4DVRH 3SY0A 3G9AB 4NO5A 5DJDB 2ZUXA 4OI8A 5C6TH 3D0VB 4X9HA 4UIKL 5TPWL 3MV9B 3STZB 4P2RB 3D0LB 4GRWB 2P48B 1B2WH 2R8SH 1EXUA 4BQ8A 1LO0L 1HINL 3BPLC 1FL5A 2VDRH 3O6FA 1CL7I 5I8OL 5AD0A 1HYSD 4Z77B 4XNQA 1IAIL 4OLVL 3JWOL 4XPFH 4I4WA 1FNAA 3KPNB 4I3RH 4LARH 1MCBA 3BP6B 3L6FA 2AK4A 4WU5B 3R06B 4P46A 3W2DL 4EUPH 4CGTA 2CLRA 5FM8A 3B9KA 4C58B 1NSNL 5FUOL 3AUVA 4RIRA 4ZYKB 5I1JH 4PRBA 5HDBE 4HS8L 4HUNB 4I0PC 4KH2A 4V1DB 4Y16A 1VFOA 1L4IA 1LDSA 5GISH 3GSWB 1Q9OB 3GSOA 3QEUB 1KIQB 4ZPVA 3OGCB 3VXSB 5EZOH 4C56B 1MCIA 1T20A 5DQJB 2GJ6A 3ZTNH 4XNYH 4ZDHB 5HI4D 3O6ML 2OJEA 2VLKE 5FDYA 4IIQC 4UILH 4YGAB 1PJ9A 1CE6B 1NUNB 3QQ3B 2XKNA 3D85A 2HLAB 1F4YL 2ZCLH 1YMHA 4L4TD 3TO4B 5CBAB 1RIVL 3BYYA 1P2CB 1I1CA 2DM2A 3N1QC 3V8CA 5EWIL 3QI9B 3VXNA 3F8UB 3FB7B 1NPUA 1MNUL 4WNQA 5IEHA 4Y4FD 3WFCL 2BVQA 1F58L 3FAWA 4NRXA 3SO3B 5E99L 4IMKA 1GGBH 3FQRB 1KFAH 5J57B 3DETC 2C3VB 3IKKA 3QIUC 4K3JL 1U58A 3H3KA 1CTNA 3HG1E 4Y1AD 2P4AB 2XNAB 1YNLH 4NWTL 3S4SB 3H3PH 4H8WH 1X4XA 1R0AL 2HMID 5IB5A 5KSBF 3MLSH 4FP8L 3IDJB 5CZVL 4NQDA 5GPRA 4BZYA 4LMQI 5DUMH 3D87B 1MI5B 3AM8A 5DTFA 3NCJH 1P1ZA 1NCCL 1S7UA 4L8BB 1NMAH 1FNHA 3LSOB 4FA8A 4PJ5A 2NY4B 4I77L 3WFBL 2JJTC 3O3EB 1WTGT 2DBLH 3MO1A 3TVMB 2Y5EA 1U8JB 4ALAL 2NXYB 4HK3N 2C4XA 1S7XB 4KUCD 4MDJB 4XMPL 4RGOH 5DRZA 2LABA 3TEUA 4U0RB 5L2KD 4BH8B 1T5XB 1T0NB 1BM3L 3CX2A 3GUTB 3HMWL 3FT2B 4BZ1L 5DSCA 5DWUL 2EYSB 2CRMA 3FMGL 4I18A 3M45A 1T83C 2HLFC 3MJ9H 1FNEA 4WIQA 3FN0L 3IKCA 4U31A 2WIIA 5F89B 3KAAA 4PJCA 5FDWA 2ENSA 5AYUH 3DUHA 3U1SH 2FB4H 1AIFB 1Q94A 3QO1B 3L7FB 1G6RL 3U7YL 2V7HA 3PGCA 1MH5A 3DBXA 4PJDA 4AEFA 2P44B 5D1ZA 5JUEL 4HJ0D 2AQ3A 2ZG3A 5ACZB 4PJ8B 5D1XA 3QUYD 5JNYA 3VWJD 3HG1B 4ZXBC 5IMKB 4QYOA 4JY6A 5CWSA 5DZLA 4J1UB 1N7ML 4AY0A 4ZTOL 4MJ6B 3VRLE 5I8CB 2LQRA 1RUQH 4NUJA 5ACLA 3CAFA 5HBBA 7FABH 1JK8B 2CGRL 4PTUA 3MCLL 3MUGA 4UI2A 1HYRC 2H32B 1QLFB 1MWAB 4W6XB 3RWEA 3BHBA 1AXIB 2MPAL 5D2NA 4CADB 4XMKH 1FLRH 3UC0H 4WEBH 1A1OA 4G80B 1CG9A 4D3CL 3WCYA 4K7PY 1JF1B 4MNHA 5E9DE 5GRJH 3DVGA 2R2BA 4EI5D 3O2DH 2Y4SA 1FHGA 1AXTH 35C8H 4D0BA 4GBXC 1JYVA 4A2MA 2W0FA 3EW3B 3C08L 3FO1B 1A14H 5IT2H 3ALPA 4U1MB 1R5WA 1N26A 3DI2B 2X1XR 4RA3A 3WJLA 1P7QB 4ODVH 3WKNA 3MREA 3WIFB 4P9MH 3HAEA 4N5UA 1HNGA 2EXWD 5DJCA 2YA0A 1YEGL 2AJUH 2BY3A 1O5DT 1JHKH 4X6DF 1EHLL 2EDTA 2Q8BH 4WFED 5ICXA 1QA9B 1A6WL 5J8OA 4R9HA 2JELL 3SKNA 3QUMB 3E6HB 3O3BA 3PL6C 1EH9A 1UGNA 5IW1A 4WGVB 2X1PA 2YA1A 3RVWD 4JVPA 1I1YA 1GJIA 4PP2A 1S5IH 2FECI 3B5GA 3UO1H 5GS0D 4HFUL 5KVEH 1QSZA 4KK9D 4KHTH 2XZAL 4QHUB 2NY6C 4X83A 4P2OD 5ERWA 4FQXC 1ONQA 1ORQA 4NN7B 5C0AD 1UQSA 2B4CH 3ARFA 4HGMA 4QRQB 5E9DB 2CQVA 4WW2C 5C0IB 3NACL 3F7QA 2DKMA 4G9FA 2ZCKL 3BZFA 3QA3B 4X7TA 4U6HA 3S4SG 3W9EB 1T03H 4CN1A 2F5BL 1U8PA 3B9AA 1FCCA 5GQBA 4GXUN 5AWNH 2CK0L 2CLZB 1I7TB 1WWWX 1NKOA 2WINB 3CVHA 4EZMA 2OTUA 4DQOH 5CD3A 5E2JA 2E27H 2R29L 1K3IA 5JHDD 4L4TE 2Q6WA 4U1NB 3SDDD 5IB2B 2FNBA 5E70A 3RVXD 5HDQL 3NVQA 2FLBT 1IAKA 5D5MA 4JGJA 5JZ7C 1XGYL 2EYRB 3WO3B 1MCSA 4NRYA 3QXUA 2R1XB 4GW1B 2YPVH 1F11A 1I1RA 5F7DA 4Y19D 1T2JA 4M6OH 3OKKB 3DLQR 4XRCB 3T0EB 4JFED 4ONGH 3RWDB 1M1SA 1RURH 3S98A 4Z7OE 1JI1A 3MR9A 2NY7L 4NZRH 3BO8A 5L7XL 5EO9B 1OPGH 5I1GH 4Y1AE 4QT5A 2VE6A 1JFQH 1GC1C 1ZHLA 3LH2L 1IGIL 5I9QB 2APXA 4YGVB 2RBLA 1E6JH 2AJYL 4LRNL 4XZUA 4G6AD 4JLRA 1H8OA 3ULSA 3N85L 3LKSA 4OZIE 3NFPB 2YD7A 4FFZL 4QRPD 4XVTL 5GSVB 3TP4A 1KJ2B 2ZOKA 2L4OA 1XR8A 4LHUD 2A1WL 3MTRA 3U0WL 4JG0L 1CF8L 1PG7X 3FN9A 4DTGH 1YN7B 5L2KE 4R8WL 4PTTA 1PD6A 5JO5B 4Y4HC 4X6BB 2E7HA 3GI9H 3FO0L 1UT9A 2GSIB 5F96L 5HHOA 5ITFA 3TZVD 3QUXD 1QD0A 2V9RA 5I1CH 4NM4L 1ITCA 2JIXA 1BFOB 1I8KB 2G2RB 4Y4FB 1FNSL 2DMBA 3MRQA 5EU6D 3L5WA 1PSKL 2NTFA 3MFFB 5C6WH 2YN5A 4LKXB 5I1LA 1YEFH 2XV6B 1T7YA 2ARWA 6CGTA 4PGEA 5D72H 3RZCC 1FAIH 4HS3B 4PUBL 1NANH 4Y1AB 3CCHA 3RUGB 4G42B 4KY1L 2EEAA 1T5WB 2G75B 3PP3H 2Z31D 2L7UA 2O26U 3IFPA 4BZ2H 2HVJB 5H2BB 3RY6A 3CH1B 2MSPA 2GJZA 1J5OH 4XBEL 3BISA 3NIDF 3QDJD 2PW1A 1ZAGA 3TWCH 3L3GA 2UUDH 2VZUA 3FQNB 3RHWK 5DI8B 4OZIB 3EOTH 4XCYB 1CDHA 4YBHA 3U30C 1Q38A 2JF1A 3CPLB 4I2XE 3IXTA 4YHMH 3L3OB 1U8HA 4P9HL 2CLVB 4YDIL 4U3XA 3VFWA 5L2KB 4PJBF 3OHXA 2A6DB 4EUPB 3GO1H 3UJJL 4BK4A 2H9GA 1DBJH 5DGRA 3WFEH 1UVQB 3PHQA 4O51A 3AREA 2BSSA 4DCQB 1FYTA 1UM6H 4MJID 2DOCA 4XVJL 2UWEE 2R0KL 3F7RA 1AXSB 1K85A 1IAIM 4EOWH 5IB4A 4XH2B 4AEEA 1CYGA 4XHJD 4OKDA 5KZCD 4MVBD 1YQVH 3KNBB 5AYQA 1CZ8H 1HSAB 1XIWC 3MA7A 4X7CC 1N5AA 3QUYB 4K3EL 1ADQH 4PG9A 4R96B 3VWJB 4WFEE 3FKUS 4Q0XH 3RU8H 5BJTA 1NL0H 4HBCH 2ESVA 3DX7A 2Q20A 3PP3K 4BUHA 3GBNH 5I6XB 5D7JA 3JWDH 4J4PD 3D2UD 4JE4B 5SWQB 1KIPA 2SEBA 4UBDC 1CXHA 4P5TB 1EZVY 1C7SA 5I66A 4UIMB 2UUDK 3O6FC 2VSDA 1UM4H 4ZQKA 5D7IA 5IHZA 2ZUWA 5EZIL 5J1AB 4I2XB 1AHWB 1A1MA 4I3SL 3S3JA 5B3JF 2JE8A 2Y06H 3VXOA 2ZUSA 2NW2A 3F5WA 5INCA 4WU7B 1AKJD 3VRIB 2C7UB 1A4JB 3DTXA 2W65B 3RTQA 3OXRB 4P46C 1IM9B 4R4BB 1CI5A 5FOBB 1RD6A 1QEWA 3OKOA 3C6LD 4HGWB 5B8CA 5KS9A 1QBML 4HIHB 5T3ZD 3B9KC 4EI5B 5I75B 4L3AA 2X4QA 1YEHL 3LKQB 5JOFB 2KL6A 2FIKB 5IFHH 3B8SA 2F74A 5GJSL 3K80A 5H35A 5FM4A 4KJYB 2IWGA 1RIUL 3JXAA 2KQNA 4Y16C 5SWZA 5IMLB 4R4NC 5CMAA 1XH3A 3MRIB 4NKIL 3ROLA 1G9ML 5JHDE 2EDJA 2NY5L 5F88B 2IGFL 1QLRA 4G3YL 4YAQA 3WEXA 4TTGA 4WUKL 4A6YH 1IM3A 3I02A 4S0TD 5EC1A 3IAQA 2EZ0D 1S9WA 15C8L 2DWEB 2WP3O 3TBVB 4OB5H 4XXDB 4ISVB 4EVNA 3RZWA 2CDFA 3MRPB 4Y19E 2V5SA 4YQXL 1Q1JL 4WHDA 5HYQB 3L3HB 1C5BL 4JFEE 3BDXA 4Y5YB 2DAVA 4XPAH 4X6CA 3ZE1E 4X7EC 1MELA 1GZPB 4FQQA 1DANU 5F7EL 1JNLH 5FYLD 1BJMA 2VXUH 2OLDA 5DJDA 5H37H 1RUPL 2HFTA 5IVXE 1XF2B 4O2CB 3D0VA 4TSBH 4IMKC 4S1DC 1KPUB 3MV9A 3STZA 2C26A 4P2RA 1II4E 3D0LA 1A3RH 4F7CB 4ZS6C 1BIIB 1MRDL 3BIKA 3HC4L 4XCFL 5DD1H 3MRRA 2R56H 3MLZL 3A6BH 5HDOA 5EA0H 4QRPE 4Z77A 1KNOB 5D93C 3PUCA 3KPNA 2Q7YB 1HHIB 3BP6A 3BKJL 4WU5A 4TUOB 3AM8C 3WE6B 5LG1A 4RGMB 3VG0L 3R06A 4KI5D 5DJ8B 4WI3A 4WHYH 5KJRL 3N1PC 4ZYKA 1SM3L 1S7WB 5ESVB 1PW3A 4V1DA 3STLB 3GHBH 2AXGB 2VDOH 3CIQA 4BH7B 3GSWA 4EUPG 4U05A 1Q9OA 3RY5A 4POZD 1HCFX 1WZLA 3QEUA 1KIQA 4WW2F 1TCRB 1YEIH 4ZFZB 3OGCA 3VXSA 1HZHL 1SJXA 4JM2B 3MV8B 3DO3A 5EU6E 2YWYA 5DQJA 4ZDHA 4I18C 2FSEB 4JRYD 3S88L 1AGFB 1OSPH 1CE6A 1V7ML 3MPCA 3QQ3A 4K94C 3PQYD 4LP5A 4PS4L 2PTTB 3TO4A 3OX8B 1IMHC 2FJFB 5CBAA 5D1ZC 4NQEB 2ITCB 3BKCL 1P2CA 5D1XC 3QHTC 3QDJE 1DBBL 5F8RC 3QI9A 3FB7A 1GCFA 4GW4B 3ZKXB 2ZJSH 3GB7B 3ULVL 3OJ2C 3FB6A 4JR9H 4QRPB 4W70A 5TFSL 1X44A 3PP4L 4I3GA 4HSQA 4HHAB 3MOBH 2PYED 1LO2L 3FQRA 1SYVB 2C3VA 4LCUB 1RHFA 4YWGL 4PJAF 4POUB 2FX8L 1C08B 4TRPH 4NUGH 1D5MB 5D2NC 1R6VA 2XNAA 4BSWB 3S4SA 3QG6B 5C8JB 2BVYA 3N9GH 1N0LA 5FYJL 4MJIE 3IDJA 3QDAA 3TZVB 4GUPB 3SKOB 1YEDB 2OS7A 1I3GH 3BIAX 1MI5A 3N0PB 4UAOC 5IROA 3M8OH 3L95B 4L8BA 1KELH 4NBZB 3LSOA 1BJ1J 5T1LB 1LP9E 3NZHH 4FMKA 1VEPA 3VFGH 3O3EA 1AGDB 2AJSL 4OD3H 4Y2OA 3MXWL 1EBAA 4YPGB 3UMTA 1U8JA 4AEHL 3WJLC 1S7XA 4MDJA 2NR6D 1QNZH 2QTEA 4TNVF 2DLHA 4XMLH 2Z31B 2W60B 3T4YB 1Y0LB 4BH8A 1W0VA 3U46B 1T5XA 4PFEA 1T0NA 3OAUL 3FT2A 1OAKL 3I6KB 3ZDYE 1UJTA 2EYSA 4GG6B 4NNXB 3UBXI 3RAJL 2AEPL 2BHYA 5F89A 4OZGE 4HUXA 1JTPA 4U4BA 2HKHH 4ZG1A 5GGVH 3KYKH 4OF6A 1AIFA 3QO1A 3L7FA 1M71B 1PDKA 2XT1B 4JB9H 3H8NA 3T09A 4L9DA 3VFTB 5ACZA 4PJ8A 5T3ZE 3HG1A 3QRGL 5EDXA 1W2KT 1WAAE 5CJ8A 5IMKA 3WMSA 3IETB 3QAZC 2XI9A 2G9HB 3SDAB 1FSKC 2HFGL 4JFFD 1G7HB 4MJ6A 4XC3L 4NNYB 5AZEH 5I8CA 1TLKA 3ARFC 4CRPA 1DN2A 4TOYL 4YE4L 3ARXA 1JK8A 3LN4B 3G6JF 3TF7C 1FVDA 1G9NC 3H9SD 2H32A 1QLFA 2YOCA 1MWAA 3DV6B 4JKPH 2DQDL 5KZCB 1CICB 3B83A 1Z9LA 2UY6A 3G04B 1TJIH 4CADA 1BWMA 1OAQL 3U6RB 4G80A 4KQ4L 4PRID 4EEEA 3ARBD 2OR8A 5SX5H 2IBBA 1JF1A 5EZLA 4AM0B 1FGVL 5JQ6L 2VLJD 4S1QH 4HIXL 5HY9B 5F7UA 3HNTH 2CUHA 3NFSH 4ODBD 1YC8A 2H3NB 3T1FB 2HVKB 4QHNB 2OI9C 3FO1A 1C16B 4U1MA 3UTSD 2MCPH 3JV5A 1QPXA 1ZT1A 4D8PB 2VNCA 4NJ9L 1FFRA 4OZGB 1P7QA 3AAZA 5LCVL 3WIFA 1MLBB 3U4EB 4XNZB 4HKBA 1WZ1L 4L5FL 4DKFL 2G5RA 1RK1B 4M7ZC 1NMCB 3C6LB 1K8DB 1RPQA 5CP3H 4YHYB 4K23H 5FHBL 1QA9A 2ERJB 2CJUH 4DZBB 1K6QH 2APWA 3QUMA 3E6HA 1NANI 2ZUUA 5IQ9B 4LKCB 3JV4B 4PB9L 4UQ3B 1RV6X 1GHFL 1VHPA 1KCVL 5DC4B 3IF1B 4KI5E 2J4WL 4QHUA 5E4EB 4OV5B 3SE8L 4KQ3L 1WCBB 3VFRB 1Z0NA 3HRZB 3MGTB 1KXVC 2CMRL 3TLRA 4EI6B 3P4LA 2I5YL 2XA8H 1ZHKB 1AQKL 3BDYH 4HJGB 4QRQA 5SX5K 4FABL 5E9DA 5F1IB 4QXWA 4M5ZL 1T1XB 3GRWH 4P59L 3ZKMD 5C0IA 2VR9A 3ISWA 3V4UL 1J1PH 4YUEH 3ES6B 1YUHB 3LRHA 4HXBL 3QA3A 3IFLH 3W9EA 3EFDH 2IPTL 4Q7DA 1TNMA 5TDPB 3DARA 2Y1VA 1A7NL 3BPOC 2IBGA 2NY2C 3V4PH 2ARJQ 2CLZA 3V52L 2WINA 4KKCC 4MJ5B 3TJEH 3PQYE 4UOW0 1LO4H 1CLCA 4U1NA 1TVBB 5IB2A 4FXKB 1J10A 4QRRD 2EYRA 1MAML 1BBJB 1MRCL 4MNGE 2R1XA 3MBXH 4LLQB 3CLFL 3HE6D 4GW1A 4PJXF 2DQGH 3G5ZB 3MLTB 1RAMA 3RY6C 5HPOA 3VU2A 5ALBL 5B21A 3OKKA 3LB6D 4XRCA 1UWGL 4LSSL 3T0EA 2PYEE 4L3ED 4X9BA 1ZS8B 4MDIB 3RWDA 5C0BD 4NC2B 5TF1H 4K8RC 4XCNA 4YDJB 5EO9A 4Q2ZB 1T0PB 4KV5F 4ONFL 4YGVA 4CDHA 3MXVL 4LPUA 4FMFA 1OW0A 1DBKH 4PJHE 4P23D 1J11A 4G6ML 5MHSE 4M1DH 2GY7B 2VDQL 4X5WB 1OT1A 1MIMH 2EH8L 3NFPA 1XF1A 3AREC 1BECA 2IQ9H 5DUPL 2X10A 4G6KH 2VDLH 5GSVA 1KJ2A 1NUFA 4X6EB 5AZ2H 3BH8B 1FL3B 2VMFA 1YN7A 4QGTA 5DFWH 3C2AL 1UZ6F 5JO5A 1ZA3B 4HWUA 5ANME 2WM0A 1A7OH 2BFVL 3F7VB 4WTXA 5I1KL 2Z9TA 4I5BB 1KSRA 5KSAD 3ABZA 3SE3A 1ACYH 4DJMA 4A6YB 2AQ2A 2GSIA 2J1KA 4MNGB 4OGZA 5EC2B 2F54B 4P4KD 1VADB 1HI6B 1HQ4B 4PRDB 4RRPG 1BFOA 1I8KA 2G2RA 4URTB 4Y4FA 1E0OB 5D7JC 2X6MA 5DFVC 4K71B 1EHXA 5CZXD 3MFFA 3QG7L 4LKXA 3HNVH 2LU4A 2XWJB 3CSPA 3OG6B 3ROOB 4JO3H 4HWEL 1R24B 4HS3A 3QHZL 2VKXA 4Y1AA 3RUGA 4G42A 4JDZB 2G75A 1T5WA 4O2EB 5EUKB 2Q3ZA 4XAKD 4PJCF 5I30L 4PRPD 4JFFE 5CJOH 3NCBB 1V3LA 1S9XA 1A6PA 2HVJA 5H2BA 3RTQC 3CH1A 1JF5A 4PJDF 4IDJL 4PJHB 5B8CC 1TCMA 2D7TL 2X4RB 2ZSVB 3TT3H 5GGSY 5A2JH 1J8HB 3H9SE 3FQNA 5DI8A 4OZIA 4XCYA 1YYLL 1CE1H 1MPAH 4DOHE 4PGDB 3CPLA 1DR9A 3L3OA 2ED9A 3HCVB 3TN0B 2CLVA 2VQ1B 4PRIE 1IGMH 5DVNA 3WS3B 2D7OA 5HI3C 1RI8A 2H41A 4J8RB 5KSVB 2VLJE 5L2KA 2A6DA 4EUPA 2FATH 3QWRD 4JJ5B 4TVPL 1UVQA 1LHZA 1WVZA 4XNMB 4Y2DB 4GXVL 4DCQA 1T66D 3UTSE 4R90L 2OL3L 1AXSA 1NFDE 3T2OA 4M6ML 4XH2A 3EGSB 4UIKH 3NCYS 5TPWH 3OR7B 3KNBA 1HSAA 4LNVA 5FOJA 2P8PB 2VKWA 4FFVD 1LO0H 1HINH 1EUTA 3QUYA 3VWJA 3D48R 4F7PB 2Z8RA 1IAIH 4OLVH 3JWOH 4RA0C 1QBAA 4Z7NF 2ICWJ 1MCJA 2DIAA 2NYYD 2W9LA 4HEME 3T0DA 5SWQA 3QDHA 4P5TA 5EBLB 2KBGA 3W2DH 3H9SB 3CDYA 4JCLA 4UIMA 3CVHL 1NSNH 4WJ5A 5FUOH 5E56A 3H7LA 5J1AA 4I2XA 4HS8H 1AHWA 3ZYIA 3AC0A 4CN6A 3UJIL 4PRIB 4WU7A 3ARBB 3VRIA 2C7UA 1A4JA 4NO0D 1IM9A 5EIQA 5FOBA 2VLJB 4HGWA 4RZCB 4HIHA 4M93B 4EI5A 4XB7A 3LKQA 1D5ZB 5JOFA 3SJVB 2FIKA 3O6MH 3IDIB 2WWKO 2X2YA 4KJYA 4F80A 3RVUC 4RFEB 4R0LB 3UTSB 2IAMC 5TF0A 5IMLA 4U1HB 1JHLL 4MJ2A 3MRIA 5IGXL 1F4YH 1NFDB 5EIIB 3BH9B 4KROD 4ZNEE 5LQBL 5DUBB 3B2UD 5E2VL 5F88A 1RIVH 1RHHB 1EHAA 4QRRE 4NFCA 1FG2B 1L9NA 2VRAA 5EWIH 2DRUA 1KTDB 4OGXL 3O2WL 1H9VA 1MNUH 2LAAA 2OX5A 2DWEA 5M94B 3TBVA 4XXDA 4ISVA 3WFCH 3TO4C 3MRPA 3Q48A 1CDIA 3W11D 3HMXL 4UOJA 5E99H 3L3HA 3QISA 4XP6L 3H2WA 5FHAL 5D5MF 2YPLB 2WUCL 4L3EE 3P40A 4Y5YA 4JPIB 2MWCA 5C0BE 4K3JH 3MJ9A 1WWBX 2J88L 1GZPA 3EJYC 3EHBD 4UT6L 1CFTB 4NWTH 1JN6B 2GFBA 4WGWB 1R0AH 2IFGA 3VMPA 1XF2A 2ENYA 4FP8H 5CZVH 4O2CA 4EN3B 5K59E 1KPUA 5TQ0L 2FX9L 4F7CA 1BIIA 4Q58C 3VWKD 5FM5O 1NCCH 3G08B 5H37G 4I77H 1QHPA 3WFBH 5DT1L 5HVGB 4P3CL 5FO9B 1KNOA 4ALAH 5F70A 2Q7YA 1HHIA 1A5FL 4XMPH 4TUOA 3WE6A 1A7RL 5HHXH 1LEIB 2J6EL 4AENB 1B0WA 5DJ8A 3VFMB 2NY4C 3F7PC 3N1FC 1BM3H 2DN7A 2R4RL 4QRRB 3U9UB 2CXGA 3RL2B 3HMWH 1PYWB 4BZ1H 5DWUH 1S7WA 4APQD 2NXYC 3FMGH 5ESVA 3STLA 4DN3L 3FN0H 4U0RC 2AXGA 4KKAC 4BH7A 4N5ED 3BGMB 1CTOA 4WHYG 3O2DA 4V2BA 4ZFZA 3NTCL 3CSYB 3PXHA 1G6RH 4JM2A 5J0BA 3MV8A 4KTDL 2CO7B 5JUEH 4XT1C 4FXLA 4L3EB 4GO6B 4MNQD 2C9AA 2FSEA 1WBXB 1AGFA 3H42H 3QNYB 3UTTD 2Z35B 1N7MH 3I84A 2BY1A 4ZTOH 4XAKE 2V17L 2PTTA 4PRPE 1JRHL 3OX8A 2WBKA 2FJFA 3BGAA 1KACB 4NQEA 2ITCA 1F3DJ 5E4IA 2CGRH 1Y6NR 3BJ91 2BHZA 3MCLH 4PJ8C 3I85A 1DVFD 1B4JL 2NY1D 1EERB 2ATKB 4UV4L 3EDEA 4GW4A 4JPKL 5T5FL 3AMLA 3HN3A 3GB7A 2MPAH 4YXHL 1EBPA 3MRLB 5SWSD 4QRPA 3Q2CA 1I75A 2GQHA 4P4RB 4D3CH 3VG9B 2Z91B 1T2QL 4HHAA 1BJ1H 4D0CA 5HHQB 5JIIA 2FEDD 3DSNA 1SYVA 3V95A 3E2HB 4LCUA 4XWOC 4NN6B 3SGKA 1C08A 5HVHB 1D5MA 5A2FA 4LOUC 1MEXL 4BSWA 5KSAB 2EE9A 3BDBA 4FG6D 4S1RL 3C08H 1AO7B 3QG6A 5C8JA 1XF5B 4P3WA 4GUPA 3SKOA 4KRMB 2EICA 3B8YA 4BM7A 5BVPL 3DVNB 4NNPH 3MNWB 1SJHB 3L95A 3CDGB 3RQ3A 1YEGH 3RWJB 3QT2A 1INQB 2QQNL 5T1LA 4JKKA 1AGDA 4YPGA 1EHLH 1QFWL 4RX4D 3MJ8B 1SEQL 5KN5B 2KKQA 4I8DA 1JTTA 1Q0XL 1A6WH 4PY7A 4PRPB 2Z31A 2W60A 3T4YA 2JELH 3UAJD 1QZ1A 1Y0LA 5D7KD 3GMNB 3U46A 5D96B 2ORBL 2XQYK 5J6GB 4HFUH 3QDMD 4OZ4B 3I6KA 3MRGB 4GG6A 4FN0A 4NNXA 1J18A 3I75B 2XZAH 1F00I 2E7CA 1T0MB 5LVEA 1M71A 4RISL 4FQ1L 5DVKA 1A6AB 3NACH 2IMMA 3VFTA 2ZCKH 2APFA 1MJ7L 2H2PD 2F5BH 1D5BB 1RZFL 1N4XL 3IETA 4NN7C 4RMQA 2G9HA 3SDAA 5D7IF 3GMQB 1Q72L 1G7HA 4KK5C 4NNYA 2CK0H 3RNKB 3LN4A 4EIGB 4ODUB 5KS9F 3IDNB 2R29H 3DV6A 3T2PA 4G6FD 1CICA 4NIKB 5HDQH 1N5YL 5E8DH 3G04A 3QPQD 1VENA 3U6RA 3UROR 1CLOL 5IG7B 1KENL 4AM0A 5HY9A 4OGYL 2GUOB 4RRPA 1QBBA 3CU7A 2ZG1A 2H3NA 4OF7A 2HVKA 4JFYB 3T1FA 3TBTB 1PKQB 3TH3T 1C16A 2NY7H 2HT2C 3MRDB 2D7NA 3VFSB 4D8PA 3EKCA 2XWTB 4PGZA 5HYEA 3LH2H 1IGIH 2O5YH 1MLBA 3U4EA 4LRNH 3T0EC 4RWYL 4CNIB 5GZOD 4NO0B 5FA4B 3NCMA 1BX2B 1RK1A 3P73B 3N85H 4X5XB 1K8DA 1WWAX 4OI9A 4X6CF 5CSBA 4HUUB 4FFZH 4XVTH 5I9QC 1AFVH 1EJOL 3FQUB 3AMKA 1LE5B 2DYPD 2A1WH 1OW0C 4KK8D 5HHVL 3KG5A 4JG0H 1SBSL 5KVDL 1CF8H 4OQTL 5IQ9A 2Z93B 4LKCA 3SKMB 4GRWF 1U3JA 4UQ3A 4R8WH 4N0UE 5J89A 2PXYB 3RVTD 1PQZB 3IF1A 2DF3A 4OV5A 4PJEB 2VITB 3FO0H 1WCBA 3VFRA 3HRZA 1NAML 5F96H 4HQQL 4EI6A 1ZHKA 4HJGA 4NM4H 4KMQA 5F1IA 3C87A 3S3PA 1T1XA 4GT7A 1S7VB 4OLZL 4IM8A 1FNSH 1YUHA 2J8UE 2DLEA 5IFJB 1PSKH 3SE3C 2VO5A 3WFHB 5TDPA 5IJKA 4I1NB 5CJQL 4MNQE 5ITBL 2YKLL 4PUBH 4KY1H 3UTTE 4ODHL 4Y4FC 4MJ5A 1MFDL 2DQJL 4YHLL 4L1HA 5I17B 3DRQB 1TVBA 4FXKA 4XBEH 1BBJA 2PR4L 4GQPH 1ADQA 4LLQA 5C0RL 43C9B 5SWSE 3G5ZA 2JB6B 3MLTA 4ZUUB 4F9LA 4P9HH 4XI5D 5CHNB 4YDIH 2ZUTA 3V2AR 5ISZD 1ZS8A 4MDIA 3RI5F 4I13B 3UJJH 4YDJA 5INDB 1KXQE 1FVCB 1S7SB 4Q2ZA 4NFDA 5EB9A 3CNKA 1LEGB 4KTYA 4APQB 3X3GL 4XVJH 1CQYA 3OKEB 4J6RL 5MENB 3QZWB 3PV7A 4NFBA 3CVIL 4E42B 4OF5A 4X5WA 4RGNC 3P0VL 1HOCB 2J8UB 3R0MA 5F9AC 3G5VB 3T8XB 5I18L 5C09B 3FQXB 1MFCL 4X6EA 3EYFB 4K3EH 3BH8A 1QPPA 1FL3A 2YD3A 2ZWLT 3UTTB 1J0KA 5BW7A 5F7FA 3MACH 5I0ZA 5D7KE 3F7VA 4I5BA 2D7QA 4HJ0C 1C8PA 5DQ9B 4A6YA 1DQJB 4MNGA 3QUYC 3ZDXE 3VWJC 1JZ6A 2NY1B 4AJ0A 5EC2A 1IFHH 2F54A 1VADA 1HI6A 4MZ2A 5GRWA 1HQ4A 5CSGA 4PRDA 5EZIH 1RZGB 2XPGB 4I3SH 5I6XC 4M61B 4NO3B 5F71A 1EEZB 4M8VA 4P5TC 8CGTA 2XWJA 3ZDZF 3RIFF 1JPFB 3ROOA 3HZMB 1R24A 1YEHH 3SDYL 4KGJA 5ILTL 3MC0A 2XXMB 4JDZA 4O2EA 5EUKA 5GJSH 1AHWC 4KKLD 4ZFFB 1P6FA 4R7NB 4L8SB 4F9PA 1T3FB 3EYQD 4GRMB 4PJHA 4X0KA 1BD2B 4AL8L 4Y5VB 1OTUC 2X4RA 4NKIH 3IU4L 4EI5C 5I75C 2ZSVA 1G9MH 1J8HA 4H8WC 4JEGB 2NY5H 2IGFH 1IQWL 4G3YH 2Y07L 3PWJB 4PGDA 3EOAB 4WUKH 4WV1B 2B1AL 4M1GH 4NJAL 3HCVA 3TN0A 5DLML 2VQ1A 4KVCL 5JXED 3WS3A 4MQSB 5KSVA 4J8RA 1SYSB 2ZKHL 4YQXH 5LJYH 4TPRL 4XP4L 4Y7MA 4H26B 4JJ5A 3CFDB 1OSZB 2BRQA 3HZVB 1U3HB 2YRLA 3QUML 4XNMA 3ARPA 1N2RB 4Y2DA 2PO6D 43CAB 3X3FH 5F7EH 4NWUH 4QO1A 4ONHB 1RUPH 1MIEH 2EE3A 5DA4A 3V9FA 4HIIB 4HPOL 5EZJA 1G6RB 3EGSA 3OR7A 5TE6L 4Y5YC 1MRDH 2P45B 1KCUL 2JJUA 2P8PA 3HC4H 1NCDL 4LSUL 5GHWL 5JIKA 3MLZH 1SHMA 4JDTL 4KXZI 1LEKB 3HTLX 2E7BA 4N0FA 2P5ED 1O7VA 4MHHI 3LD8B 1KEGL 2BVEA 2LAGB 5EOCL 1NUGA 4QXTB 1JJUA 3BKJH 1U9KA 3CSGA 1A4KB 3VG0H 3GZKA 5EBLA 2ZCHL 4H0HB 1FRGH 5KJRH 4JO1L 4G6FB 5DMIL 3T2NL 1A6UL 4JREB 1FDLL 4M1CC 1UKTA 1SM3H 2WQ8A 3B2VL 2VDPL 2XZCL 1ZE3C 4B7LA 5E08L 4PRIA 3ARBA 4Z7QE 3SGDH 4RGMC 3INUL 4RZCA 1K8IB 1HZHH 3RVXC 3EYSH 1D5ZA 3KGRA 2OBGA 3DOSA 5I8KL 3SJVA 1QRND 3IDIA 2JB5H 5A3ID 3B3IA 3S88H 1G7QB 3AFLA 3KXFD 4R0LA 4RFEA 3UTSA 1V7MH 3K2MC 4U1HA 4ZUVB 4W6YB 4PS4H 5LAXB 4TSCL 1EFXB 5EIIA 1NFDA 4JM2C 1I1AD 3BH9A 3RDTD 4OIBA 4YDVB 1F2XK 2UZIL 3VFNB 5DUBA 4PY8J 2WV3A 1RHHA 3ZT7A 3BKCH 3P4NB 4P5KB 1O0VA 1RZ8B 3DHMA 3PWUB 1FG2A 1DBBH 5IR1B 5FO7B 1KTDA 2CK2A 3ULVH 2Y23A 5A2LH 1RIHL 5TFSH 1IZJA 4XB8A 2XA3A 3PP4H 2ZNWA 5IW3A 4YDKH 1RZIB 4ZAKD 4DW2L 4K7FA 1LO2H 3BVNB 4KKNA 3LKNA 4YX2L 4WFHD 2YPLA 4HULB 3VXMD 1BVLB 1U92B 3LKOB 4JPIA 2V9QA 4YWGH 3ZKXC 2FX8H 2K7PA 3OG4B 1CFTA 2YUZA 1JN6A 5DEGB 1ZT7B 3WIIL 3EYVB 3R8BB 3LQAC 5FYJH 1ZTXL 4BELD 4EN3A 4JY5L 1Z2KA 4NO2A 3LKPA 3QCTL 3K4AA 4YHIB 5IEKB 4UMGA 3SGKC 3I9GH 3OSKA 3G08A 1CR9L 2IEPA 4C4KO 3SKUD 3P9LA 4LLDB 4QHKI 1L6ZA 2NCMA 2O5ZL 1IL1B 2AJSH 5FO9A 3MXWH 2ARJB 3DGCR 1U42A 1CCZA 3UJTL 4O9HL 1OGTB 3PXJA 4AEHH 4MAUH 5CKAA 2OR7A 4MZ3A 1LEIA 3FCTB 2BSED 2X4TB 1MFNA 4AENA 1FBIL 3VFMA 4ZNEA 3OKNB 4QRRA 2GY5A 1WIOA 3RL2A 3OAUH 2BVPB 1OAKH 3L3IB 1NCUA 4LCWD 4MB4A 3RAJH 2FHBA 2AEPH 1U8NB 1X6NA 5GRXG 1F3DH 2Z31C 3BGMA 1GL4B 1DP0A 4OT1H 3CSYA 3TGXA 4OLYL 4HUMB 4L3EA 1UKQA 4ZOCA 1WBXA 3RP1A 3QNYA 2Z35A 2HFGH 4XC3H 3PV6B 1MCEA 1U8QB 4TOYH 4YE4H 2DQIL 1IEAB 2EDKA 3GKWL 5CSZB 9CGTA 1F4HA 1FFQA 1SEBB 1AGBB 3B9DA 3D9AL 5CP3A 2ATKA 2VUOA 2DQDH 5MEQB 3RUGF 3SDAC 3MRLA 4E41D 3S8WA 4LDLB 3SPVB 4JKLA 1OAQH 4G9DB 1TZIB 1WQVT 2XOTA 2XQYG 1QFHA 4HWZB 5DMGD 2QSVA 4P4RA 1FJ1B 4KQ4H 3NIGE 5GRYA 2Z91A 3R1GL 2HJFA 5HHQA 1FGVH 5JQ6H 4HIXH 2OR9L 2C1OB 4DKAA 1F4WH 3CFCL 4XHJC 1CICC 3TA3D 3ZE2F 4OZIF 5KSAA 5LXGL 4D9LL 1AO7A 1AY1L 4GOSA 5ADOL 3QEQD 1A9BB 1XF5A 1FN4B 4NJ9H 1HNFA 1JTOA 3I2CL 4KUCF 3DVNA 3GRWA 2HTKD 5CUSL 5LCVH 3MNWA 3Q6FB 1MFEH 1SJHA 4M43L 4GMTL 1ZGLB 5DD6B 1S5HB 3CDGA 1WZ1H 3RWJA 4L5FH 4DKFH 1INQA 4JQVA 5EORL 1NEZB 3HB3C 3MJ8A 4IDLA 5FHBH 5KN5A 4PBVC 1VFUA 5DYOB 3B4NA 2P5EE 3B5TA 4OZFH 4XNZC 4PRPA 4YNYB 1A02N 4HAGA 5BS0E 1NGQH 2EC9U 3GMNA 3GIZH 4Y8DC 3TIEB 3K7UA 2I9LB 4PB9H 5T33L 1NMCC 4MCYB 5J6GA 1GHFH 1T21B 4OZ4A 4Z7UF 3EDDA 5DC9B 3MRGA 1KCVH 4YHYC 2J4WH 3I75A 3ZO0A 5EO1B 3SE8H 2I60L 4KQ3H 2ERJC 3BN3B 1T0MA 1JWMB 5FK9B 2CMRH 2I5YH 5C0JB 3EO9L 4FABH 3OAZH 2Q86B 3X13B 3ZHDA 4M5ZH 4P59H 4X9FA 3V4UH 4HXBH 5E4EC 4EQ3A 3KPSB 4LNRB 2IPTH 1YEJH 1CVSC 1D5BA 3QWRA 3FB8A 1QRNE 1A7NH 1EA9C 3ALXA 3VXQB 1BQLL 4IBLT 3KXFE 2EZ0C 1EDQA 4OFIA 5GS0L 3S5LB 3RNKA 5GS2D 5C2UB 3LOWA 3O81A 5GSRB 1D5XB 2W59A 4JPVL 1D3CA 4ODUA 3IDNA 5E94B 2R0ZL 3QDGD 4AT6B 4H0GA 2JJWA 1AR1D 1TPXB 5EU4B 5IJKC 3MLUL 5LGHL 1MAMH 1YZZA 1MRCH 3JVGA 4J3SA 4YBQD 3NA9L 3QPXL 2W92A 3CLFH 5IG7A 4LAQL 3MNVB 1M4KA 3MV7D 4RDQG 4NHUB 2P5EB 1GIGL 2GUOA 5C08D 5BS0B 3NCYP 4LSSH 4LP4A 3PNWB 4K9EL 1MCWM 1YMMB 2HA1A 2ZPKL 3BE1L 4JFYA 1NCTA 4KRPD 1PKQA 4WFHE 3TBTA 3VXME 4P99A 1EAJA 3U9PL 1NH6A 3ULUD 3MRDA 3VFSA 3IRPX 2XWTA 2BMKB 4LDOB 4F9LC 5JDJA 1BFTA 1CDJA 4ONFH 4PLNC 1F4XL 2NMSA 3JWDC 3MXVH 3E8UH 3KLAB 1QQDB 4CNIA 5DDHB 5I19L 4G6MH 4NO0A 5FA4A 3OAZK 1BX2A 3P73A 4X5XA 3MGOB 1NDGB 2VDQH 3VMNA 4AIZB 3QNZB 2DB8A 2EH8H 4LL9A 4K94H 4HUUA 5DUPH 3FQUA 1DBML 1LE5A 3SO5A 2A9NL 5DD0L 4Y88A 3KXFB 4S2SB 2Z93A 5HVFB 4POZC 3SKMA 4L4VB 3K4DA 3C2AH 3KYMB 4GH7B 2PXYA 4B5EA 2P5WD 1ETZB 1PQZA 1X5JA 2X9XA 5DJYB 2CRIA 2B0SL 3RDTB 1JV5B 2BFVH 3WHXB 5I1KH 4PJEA 2VITA 1P7HL 3OF6D 4FQHB 2GITA 4O02L 4XAWL 2VL4A 4MSWA 4LCWE 3CC5B 5BW7C 3ZL4L 1UH3A 4FNLL 1JGLL 4F15B 1S7VA 5ICZB 1RUMH 1JP5A 1AQDB 5C3TA 5IFJA 3WFHA 2V2TB 3QG7H 3CZFB 1JMZA 1FNFA 2DD8L 2ICWB 4HWEH 3JWNC 3QHZH 2M26A 4QF1B 5F93C 3O45B 3ARDD 4K71C 4PJFE 2ICWI 5I17A 2Y25A 1W72L 3DRQA 4JM2F 1NEZG 5FV1L 1JPTL 4IDJH 2D7TH 4E9LA 3C5ZD 4IHOB 1MCNA 2R1YB 1YYLH 3IJYB 3L3KB 3MRCB 3HAEH 43C9A 1ZLWH 1H3GA 5ETUB 3T3MF 3VI4E 2JB6A 4YHZL 4ZUUA 4F9PC 3KPTA 1FZOB 5CHNA 3IVKB 1N64L 2NX5D 5E00A 2FHFA 1BZ7B 2FZ3B 4K3GA 5INDA 3UTQB 5SX4H 2XN9B 3O2VL 4IRJA 1FVCA 4FS0A 1S7SA 1D5IL 4TVPH 1LEGA 4GXVH 1GVIA 4APQA 1S9KC 2CKNA 3QEQE 3TN0C 3QJFB 4LCWB 3U4AA 1KOAA 3GMPB 1KTKE 3DO7A 4R90H 2OL3H 3KPOB 3BP4B 3OKEA 5CJ5A 1GAFL 5MENA 3QZWA 4E42A 2WMPA 4M6MH 1KB9J 2OYPA 1HOCA 1SBBA 2J8UA 2XICA 2YXMA 3SGDI 3KR3L 3G5VA 3T8XA 4Y2DC 3BIBX 3FQWB 2HT4D 5C09A 3FQXA 1ZHBB 2R0LL 3EYFA 1DBAL 3S5LG 5C70A 3UTTA 2J12B 4E5XB 5MP6L 4JRWA 5HGBB 4NOBA 2A6IB 1SVZA 4PJFB 1N6UA 3EJJX 4U1KB 5BRZB 5JR1L 2YZ8A 2WLZA 3DUUB 4UTBH 1P4LB 5DQ9A 5L8KB 4L29B 2VXQL 4Z7WE 3CVHH 1J1OL 3B9EA 1JPSL 1ZLWK 1FZMB 1RZGA 2XPGA 4OD1L 2K9UA 4M61A 4NO3A 3UJIH 1EEZA 1XGUB 4FTVD 1JPFA 5EOCJ 4GG6F 4NC1E 3VCLB 3HZMA 1XF3B 4WRLA 4MXVF 2LV4A 4ZFFA 4OCWL 2MJWA 4R7NA 1WLHA 4L8SA 1J0HA 3ARBC 4CDGC 1TITA 1T3FA 4OLUL 4GRMA 1JHLH 5BV7L 1BD2A 1Z9MA 1HCVA 2I07B 4M93C 4Y5VA 3BAEL 5IGXH 1CD9B 1NCNA 1QBLL 3QDGE 5LQBH 3MROB 3NA4A 4UV7L 3PWJA 2WUBL 4R0LC 3EOAA 5F1KC 4WV1A 4HKZB 4OGXH 1BQSA 3O2WH 4JM4H 3AB0C 3MV7E 5T3ZL 1SYSA 2AJZB 2BRRL 5DJXA 2P8LB 4OCLC 3RHWF 5C08E 4ZFOL 3HMXH 5L6YL 4FXGB 5B39B 1A9EB 4XP6H 4H26A 3CFDA 1OSZA 2GT9B 2WUCH 3HZVA 5EBGA 1U3HA 1N2RA 1KEML 1T89A 4WI4A 3ULUE 43CAA 2J88H 4UT6H 1GGIL 1FGNL 4ONHA 3GKZA 4X8JB 5E6IB 4HIIA 1G6RA 4MQXC 5TQ0H 2FX9H 3S35X 5JW4M 1R3IH 1WFOA 2YUWA 3GJFB 2VN4A 3HE7D 2C4FT 2BJML 2AV1B 4KTEH 1CBVL 1MHPL 1G7PB 3PG2A 2ICCA 3PGDB 1LEKA 4HWNA 5DT1H 4P3CH 1RFDL 4WI7A 4EN3C 1BQHB 2DLTA 3ME0A 4W4OA 3CGTA 3KPMB 1A5FH 4QXTA 5IF0B 1L0YA 3ZKMC 1A7RH 4U1LB 1A4KA 2J6EH 2P5WE 5FYLL 2R4RH 1JGEB 2DIJA 4OGAC 1NUDA 3NGBB 4XTRD 3ZHLA 2WK2A 4D9RD 4DN3H 4NCC2 5DEFB 3LDBB 3C5SB 1D9KD 4Z7VE 3NTCH 4AIXA 1K8IA 5C08B 4KTDH 3W9DA 4XP9H 1GGTA 3VMOA 4ZS7L 1Y6KR 3MA9L 2ATPB 1G7QA 3T0BA 2A6JB 4KKBD 1MHEB 1RZKL 4JY4B 3ARZA 4ZUVA 5LAXA 3T3PE 1EFXA 2V17H 1MY7A 1M7IB 3E3QC 1JRHH 3KJ6L 4YDVA 5EBWA 3VFNA 1OQXA 3C8KB 4LVHB 4GLRH 4P5KA 3P4NA 1RZ8A 3V7AE 3PWUA 4JG1H 1JCKA 1B4JH 5IR1A 5FO7A 1EO7A 12E8L 4UV4H 4JPKH 4F7TB 4YXHH 4OZFB 3H0TB 3UPRB 1T2QH 3BVNA 2NX5E 2R0WL 3MFGB 1BVLA 1U92A 1H3PL 3D39B 3LKOA 2W0PA 4ENED 2P5WB 1YEKL 1T04B 4NZUL 2AJVL 2ADJB 1MEXH 3IDXL 2BX5A 2H1PL 4S1RH 5DEGA 1ZT7A 1E27B 4IJ3C 4UNUA 1BBDL 4HC1L 3EYVA 3VD9A 5HD8D 4NKDB 1A22B 4HWBL 3VG9C 1YJDL 3DHJA 5FYJU 5BVPH 3E2HC 4ELME 4YHIA 4NN6C 1HQRB 4K3DL 3TJHD 5HVHC 1LO5B 4O58L 1KPRA 1KTRL 1EO8L 4LLDA 5KSAC 2QQNH 3SOBL 3LEXB 4LSQL 2HT3D 4M7KL 1I9EA 3KVQA 2ARJA 4UDUB 4PJGE 1OGTA 1QFWH 4HKXB 1XCTB 1SEQH 1BLNB 1Q0XH 3FCTA 3MUJA 3ARDB 4C83B 2X4TA 4JQVC 3OKNA 2ORBH 3GSVB 3J8F7 3OV6A 2BVPA 1GXEA 3L3IA 3FOLB 4OLEA 2NZIA 3C5ZB 2OP4L 1U8NA 1OTSC 4I0KA 2ADGB 2AP2A 1NGPL 5B39G 5D96C 1YPZE 2CDEB 1HHGB 4RISH 4FQ1H 2D03L 4FTVE 3C60D 1LDPL 1MJ7H 2VLRD 1RZFH 4R7DB 1N4XH 2R9HD 1Q72H 3KYAA 3LHPL 3PV6A 1FC1A 1TVDA 1U8QA 4XCEB 2OXGA 4X4YB 4QXUL 4ZSOB 1IEAA 3DMMB 4ELMB 1P7KB 5DD5L 4JN2B 1SEBA 1AGBA 1G84A 1CGSL 1M05B 2MQ3A 3I6LD 5ALCL 2Y6SC 1N5YH 5MEQA 1GZQB 1BQHG 3SPVA 4G7VL 4G9DA 1TZIA 4PJGB 2DJUA 4HWZA 1MY5A 1FJ1A 4GRWH 3OPZL 1XF4B 4PJHF 1KENH 1ND0B 3REVB 3GFUA 2FD6L 2C1OA 4OGYH 2R4SL 1CLYL 3BPCB 4XBPB 4LPVA 1V3JA 1NGYB 3JVGC 5TQ2L 3X14B 5CD5D 1A9BA 2B2XL 3ZKSD 1FN4A 3BEVB 1CQKA 1BZQK 2D3VA 5KAQG 1RZJL 3P9MB 1F2QA 3BQUB 3Q6FA 1ZGLA 3KLHD 1X5AA 5DD6A 2NYYC 1S5HA 2L0DA 3CLEL 4RWYH 3TNMA 1QOKA 1NEZA 3CFKB 1NBQA 4BFGA 1B4RA 1C1EL 4NQUA 1TTGA 2P1YA 2B1HL 4DGYL 3VW3L 4MS8C 1I9JH 1R5IB 2ADIB 1SY6L 4R2GD 1MAKA 3G6DL 1EJOH 4OV6F 5DYOA 4LVNB 4LSRL 4YNYA 1B6UA 1Z6JT 4NCDA 5HHVH 2DQFB 1SBSH 1K4CB 3TIEA 3P0GB 4OQTH 5KVDH 1MJUL 2I9LA 4MCYA 4ODTL 4PYHA 1T21A 5DGQA 3CMOL 1B0RB 3NBNA 5A2IH 3EIFA 4YIQB 4Z76B 5EO1A 5F3HB 3Q1SL 4OZFG 3I50L 4RSVA 1NAMH 3QRFM 1ZLVH 5FK9A 5E2TL 4HQQH 3AROA 3CFJB 4D9RE 4L1DA 4OZHE 2CUIA 2Q86A 3X13A 5JXEA 1A21A 2PXYC 1F6FB 4OLZH 4WUUD 3JTSB 2NXZD 3KPSA 4LNRA 3IJHB 1Z3GL 5F9OL 4AYFA 4YC2B 4OLXL 3VGBA 4KZDL 5CJQH 3VXQA 5T5NG 5ITBH 5SX4I 3UX9B 2YKLH 2B7DT 2OL3B 2PKDA 3S5LA 4M7LT 4ODHH 5GSRA 3PGFL 1D5XA 5CEZD 1MFDH 1NCAL 1QSED 2DQJH 4YHLH 5E94A 3IJSB 4AT6A 2D4FA 3DSFL 4KI1A 5EU4A 5FF6B 5KSUB 1P5VA 4KDVA 1JNNL 2PR4H 3EHBC 2BDNL 3MNVA 3ZLQC 5C0RH 2RGSA 4LLYB 2YD2A 2P24B 3LMJL 4NHUA 2P5EA 3G5XB 3L3JA 1NFDF 3EJZC 3MX0A 3NZ8B 3F6IA 5BS0A 4GSDL 2VZ3A 3PNWA 2CR3A 1YMMA 2LTQB 5C0CD 3X11B 3MLWL 2FGWL 4NT6B 5CIPH 2JTDA 3QO0B 4KHXH 2BMKA 2J8HA 3MV01 3X3GH 5I73B 1ZLVK 4OZHB 3KLAA 4EXPX 1QQDA 4DGIL 5DDHA 1LK2B 2EIDA 2DMKA 4J6RH 5D70L 1KLGB 3CVIH 3IFNL 3MGOA 1NDGA 5KSBE 1DLFL 1D9KB 3P0VH 4IRJC 4AIZA 3QNZA 4UNVA 2QSCL 1MCHA 5I18H 2JLLA 3C8DA 4APQC 2EO1A 4OTXL 4Y89A 4K55A 1MFCH 3S37H 4J12A 4P2QD 1P6AB 3ILQD 3KXFA 4WWKB 5CKGA 4S2SA 3LZFH 4L4VA 2CKBL 2MFNA 1IEHA 3ZSTA 4MLSA 5I1HL 1LVEA 1ETZA 5DJYA 3LAFA 3MLXL 3RDTA 3WHXA 1JV5A 1EO5A 4QRUB 1EJ6A 1ED3B 1DQQB 2P46B 4FQHA 3CC5A 4WDIB 3QJHB 4IEFB 1BEYL 2EKSB 2H32H 3FONB 2E6JA 4I0PD 2NZ9C 5EOQL 1AQDA 4XVSL 2H2SC 5IVNA 2V2TA 4M7JL 2VAAB 3UPCA 1FL6B 3CZFA 1I7RB 2NY1C 1O7SA 3IDMB 2XKUA 2ICWA 1I9IL 3SDYH 5ILTH 4QF1A 3MLVL 3O45A 3GMRB 1XGTB 5ID1B 4X99B 4AL8H 2DLFL 3V0VB 5GS1A 3I6LE 4IHOA 2R1YA 1JYWA 4Z9KB 3MRCA 2Y07H 1KYOJ 1WTLA 2HYMA 3IJYA 3L3KA 5C07D 5ETUA 4L8SC 1QSFD 2B1AH 1MCOL 5K59F 4NJAH 5DLMH 1FZOA 3IVKA 3UXFA 2V5YA 4KVCH 3QIWB 4Y5VC 1LO3L 4HIJB 2ZKHH 5J13B 1DQDL 3EBAA 4OUOA 1BZ7A 2FZ3A 4WO4B 3DVIA 3ZSSA 2GKIA 3UTQA 3A6CL 2XN9A 3HAEG 4TPRH 5CCKL 3TC9A 5I74B 1EIBA 1INEL 2CXKA 4WV1C 3DETD 3QUMH 5F8QC 1FIGL 3QIUD 3QJFA 4LCWA 2LE9A 3GMPA 3BP7B 3RGVB 2ZP0T 3KPOA 3BP4A 1FP5A 3MNZB 4HPOH 4N90D 1NLDL 3IB4A 5D7SL 4PY8I 5TE6H 1U3HC 3DX8A 1T89C 6FABL 1NCDH 1ZHBA 2CIKB 4LSUH 2X4SB 4PLOB 5GHWH 4HZAA 3VFVB 4Z5RA 4QOKB 5H94B 1T1WB 5HGBA 1KEGH 2A6IA 5EOCH 5C2BH 4OFVA 2WWMD 5BRZA 5EUOB 5C6PB 5LGKA 2NLJB 3DUUA 1P4LA 3WO4C 5E2UL 5GGTL 5BZWB 2ZCHH 1TJGL 4L29A 2DM4A 4HG4J 5T1DL 2DDQL 4JO1H 4MD4B 3GDBA 5DMIH 4GLRI 2VXTH 1A6UH 4GKNB 1FDLH 3T2NH 3LD8C 3OGOE 1FZMA 3B2VH 4W4OC 2DQCL 2XZCH 1KB9K 5E08H 4Q9RL 4H5SB 4POYA 4PPTA 1G7MB 1XGUA 1OLZA 3MLRL 3GIVB 1EEYB 5F44A 4WUUE 1YECL 3VCLA 4KRNA 4FZ8L 1XF3A 1VEMA 5I8KH 3E6FB 3QPQC 4Z6AT 2C3XA 3HA0A 1NDMB 3O8XD 2IG2L 4CVWA 2X4OB 2E3VA 4TSCH 2I07A 3KHOA 5CEZE 1QSEE 4IRSD 1YA5A 2UZIH 1T7ZA 3MROA 3RIAK 2H45A 5F7YC 1JGUL 4HKZA 3OJVC 4QHLB 1KC5L 5GIRB 4DEPB 3UPAA 4P0DA 2Y7QB 2QQLL 1RIHH 3CJJA 4HXAH 1UEMA 2AJZA 2R2CA 3MYJB 2FEEL 4XPGL 2P8LA 1QFWI 4DW2H 2BZDA 1S9YB 1WEJL 3HC3H 4FXGA 5B39A 1GOHA 4YX2H 1PAMA 1A9EA 2B20A 5JHLL 2GT9A 3MUZ1 3BPNB 1J0YA 1KLUA 5GGRY 4UB0L 4GBXD 1KJ3L 2HKFL 3WIIH 3K74B 1H3WM 3K0WA 4X8JA 2AV7B 5E6IA 1ZTXH 3WHE0 4JY5H 5IESL 1EFQA 3QCTH 4KDTA 1M7XA 4HV8B 3D69B 1CGXA 1J1XL 5GRUH 5JW5B 1VFAB 1CR9H 2NXZB 2AV1A 5L8JB 1IKFL 3JV6B 1QFUL 3V8OA 1G7PA 3PGDA 5GZND 2O5ZH 5E8OB 1NKRA 3P0YL 3UJTH 2DTSA 4O9HH 1BQHA 5JDSB 4P2QE 2VYRE 3KPMA 5IF0A 1NC4D 4U1LA 1WC7B 1QSEB 1FBIH 3W81A 1AGEB 3PL6D 2BNRB 1JGEA 5DHVH 2QQQA 3UTZB 4JFHD 5D7LD 4ORZC 3KJ4B 1OGAD 2NY6D 5CINL 5DEFA 4FQXD 1F13A 1PG7W 3G9VA 4LPWA 2P47B 4ODXB 4C59B 5C0FB 3BD3A 1KLFA 5DA0B 5C08A 4K2UL 4OLYH 1FORL 4PJEF 4QXGL 3VXRD 5IHUL 2IH3B 2MCG1 4LHQB 2ATPA 2FH8A 3NIFF 5L9DH 5L2JB 3T77B 2A6JA 1MHEA 4JY4A 4XP5L 5D2LE 5A2KH 1M7IA 3WXVL 4OIIL 3HZKB 3C8KA 1ES0B 3RKDC 1HKFA 2DQIH 3GKWH 1HILB 5D6CA 2KZ1B 3D9AH 2YEZB 4F8TA 3DXAD 1F6AB 4F7TA 3P2TA 3EYOB 5DD3L 5FYKD 5C07E 5JZ7D 4OZFA 4XNXL 3H0TA 1MLCB 2ZUVA 1QSFE 3UPRA 2OQJB 3R1GH 3BPLB 5I1AB 1L7IL 3QXVA 4LIQE 1CU4L 2OR9H 3OZ9H 3CFCH 3D39A 2X05A 1MQKL 2F15A 1T04A 4N1EA 2ADJA 1NAMB 1XFPA 1KN4L 4PJBE 3UZVB 3WNKA 4D9LH 1E27A 5LXGH 1AY1H 2XG4A 5ADOH 3MZGB 2NY3B 4NKDA 2PETA 4XPBL 2HTLD 5CUSH 1HQRA 3MRNB 4GMTH 4M43H 1LO5A 4N90E 2N1KA 4JFQB 4E0RA 1IAOB 3LEXA 1KCSL 3QIBB 2ITDB 2AEQL 2UVEA 4UDUA 4DWHA 4HKXA 1XCTA 5D2LB 3NAAL 1BLNA 3BUYB 1S7TB 3ARDA 1T6VN 3CH8A 4C83A 5J6HB 4IIQB 3WD5L 4BUGA 4K7PX 2J8UF 3S97C 3WYRA 2WLYA 3GSVA 5T33H 4LSVL 4FZEL 4XXCA 2HJKB 1H3UA 4Y4HD 3V6OE 3VI3F 3C5ZA 4XNYL 3QSKB 4KKLC 4L9LB 4PGCB 5C07B 3ARSA 2ADGA 4UILL 1QSFB 2O61B 3EYQC 2CDEA 2AXFB 1HHGA 3EO9H 1WIUA 2VLKB 1PEWA 1WCQA 3ILPB 1WV7T 1EGJL 5B3JE 1C5CL 1K9TA 2N56A 5DMJB 5CIPB 1NGXB 5DURD 4OBSA 1CXKA 4M3JA 4R7DA 5IQ7L 2AAVA 5HYSB 1EPFA 2OTWB 4P9HC 4OD2B 4J3UA 3MRHB 4H25B 2IALB 4XCEA 3RZCD 4X4YA 5GS0H 5JXEC 3S34L 4ZSOA 3DMMA 4JPVH 4ELMA 1P7KA 3HUJE 2CD0A 3JBG7 2R0ZH 4JN2A 1G0YR 1M05A 3MLUH 5LGHH 3HI1B 1KBGL 2HJLB 4OI7A 4JKMA 3NA9H 4DUWA 4PJGA 5IB1B 3QPXH 4Y4KB 4LPYA 4LAQH 2X5PA 1ERNA 1XF4A 1ND0A 3REVA 2Z0BA 1MSPA 1GIGH 5I2IB 5K9OA 2X41A 5D9SB 4H1LH