1IFHL

A detailed analysis of the free and bound conformation of an antibody: x-ray structures of anti-peptide fab 17(slash)9 and three different fab-peptide complexes
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
217
structure length
217
Chain Sequence
DIVMTQSPSSLTVTAGEKVTMSCTSSQSLFNSGKQKNYLTWYQQKPGQPPKVLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSNPLTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detailed analysis of the free and bound conformations of an antibody. X-ray structures of Fab 17/9 and three different Fab-peptide complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2A-KAPPA 17/9 FAB (LIGHT CHAIN)
total genus 51
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1993-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ifhL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ifhL01
1GL4B 3GIZL 3FHQA 3O9WD 1J7VR 3VGFA 1Q9KA 4J23A 1S7VA 4PB9L 3MOAH 3QDMA 5CBAA 1EH9A 1JPTL 3C9NB 4A2MA 4WW2A 1DVFB 4JFDD 1FO0H 5F6IC 1HEZB 1S5IH 1ZGLM 1U2CA 3C6LC 4YE4H 3O3EB 1S8DB 5F6HI 5D2LA 5HTSA 4D8PA 35C8H 3T1FA 3PHSA 3TIDB 1ACZA 4PJIB 3EO9H 3W39B 3WL9A 1J18A 5D5MF 1MHHB 4X4YB 3MJ9L 4LARL 5CD5D 2VL5A 4U05A 4F9PC 1RHHA 3Q6GL 5H2BA 1G7HB 4V2CB 1G7PA 2W9LA 3UYRH 1RK0A 3VXSA 5GS2D 4JO4L 2A9MH 4DGIH 5TDPA 4XI5D 3C5ZA 1U93B 5JXEC 3KNBA 1NCDH 5DYOB 1AKJD 2FHFA 5H2BB 2IQ9L 2FIKB 1F11B 1E4XL 3KJ6H 3UJIL 4Q9CA 3JV4B 4EXPX 2D7MA 1IKNA 3N85H 1SM3H 3ULUC 1IGFH 2Z4QA 4OJFL 4IHOA 4V1DA 1DN0B 5HYJA 1M1SA 1XGPA 1MHPH 4TUKH 1AD0B 4JRYE 4KQ3H 5EOCL 1QRND 3T2NH 5GQBA 2GTZB 4ZFOB 1I1AB 4FQXC 3VDBA 2A6DA 4LCWD 1YEJL 2A0LC 4P3CH 2EO1A 1FLTX 3P3YA 1FAIH 4LGPB 4E0RB 5FYKL 4I0KA 4OCMC 3CXHJ 3QIBA 1QBML 4HFWA 3DVGA 2Y1VA 4HUXB 3RZCC 5D72L 1AFVH 5BQ7B 5ISZA 2O5YH 1F5WA 3MRQA 1ZLVH 5MHSE 4OM0H 4HZLB 1OGAB 3NPZB 3MZTA 3D39A 1QFUL 2BVOA 5HDOA 2YRZA 5HI3D 4R4FL 5DMGC 4D2NA 2C3VB 2CKBA 3X3FH 4I3RH 4OBSA 4EN3B 3S35L 3VI4F 2J8OA 2Z0BA 1L9NA 1MF2L 3L3GA 5IMKB 4PRPE 1FNEA 1BFOA 2R56H 5J3HC 3ARED 3QFJD 4KDVA 1FG2A 1DUZA 2F54E 5I8KH 2JCCB 1OTUD 5CD5C 4EJ1C 1WWAX 4PRIE 2CXGA 3JWOH 1PG7H 4PLKD 2UZYB 3V5DB 3BEVB 5T5FH 2F74B 1A3RL 1UC6A 3IU3B 4U3HA 4LVOC 4LLWB 3GBMH 3C6SA 3ME0A 3PV7A 5IWLA 5ITBL 1W0WB 3HG1A 3UDWA 3HLAA 3HUJB 5TGBB 3X11B 4CKVX 1CD1B 3QUMA 4HC1L 1CFQA 2HLFC 2A38A 3D3VA 4GKSB 4ONFH 4U3CA 5A2FA 2W60A 4BSVA 4OCYL 5A3ID 3IU4H 4WHTB 5J57B 5GRUL 3V5DA 1YECH 2AABL 4HIIB 1DEDA 4HIEA 3G5VB 4R96B 1X6NA 3O9WA 2FWOB 5DUML 5JMOC 3OZ9L 4H0HB 5E8PA 3SDCA 4OKVA 1MEXH 3BPOC 4G9DA 1PZUB 4PJEE 2CKBB 4NWTL 3EZJB 1MNUH 2X4RA 5FYJU 3P0YL 3E1F1 2MKLC 5L2KD 3AUVA 2FWOA 1KXVC 4FFYL 4JZJC 4UINH 2W59A 3VU2A 4E5XA 4XH2A 3EO1A 5T1LB 1H5BB 2BY1A 2A1WL 5I15L 3ARFC 4HWEL 4YDJB 5IESH 3SGKC 1MJ8L 2VZ1A 1NMBL 2EE6A 3U0TA 2X1XR 1OY3B 5GJSL 3FFCD 1I1AD 2BSTB 4KVNL 4JRYD 1JK8A 5EFIB 5ID0A 3SPVB 3MLZL 1XZ0A 4M7KL 1MCWM 4JPWH 1JGEA 1LNUB 5I9QC 4MJ4A 5I0ZA 1CLOL 1P9MC 5D1QC 3PDGA 4LCYA 3SCMC 2VLJB 1G0DA 2FL5B 2HRPL 1U8IA 2FX7L 4EUPG 3RVWD 4XXDA 3KWWA 5FO9A 3BMWA 4JDTL 3V4PH 2PTTA 4YWGH 3TV3H 4N0YL 4ZSOB 4GAGL 3REVB 5GRWA 5I1EH 3BT2L 2EDHA 3B5TA 3GMMB 3LD8C 3BH9A 2B1AL 5F89B 5J13C 1KB5L 1X5XA 1HHIA 4K3HA 4G8GE 1FVEA 1JF1A 1JNLH 3RU8L 5FF6A 3MODH 2AK4E 4NCC2 1KT2A 1J8HD 3VXSB 1U41A 3LDBB 3HFML 3TBWA 1OAKH 4I2XB 1LE9B 4V2BA 4ZUWA 5F7WC 1JI1A 2R4SH 2CMRL 1N26A 4GXUM 3CFDB 2EDYA 4RIRA 3VFVB 3TF7C 1OTTC 5TPWH 1HIML 4AL8L 2AK4A 4HS3B 1WAAF 4P2RA 2F19H 2EXYC 3DTXA 3TBWB 4WI6A 3RWHB 1T6VN 1YY9C 3I3EA 2CR3A 1RIHH 5CFHA 2HFEB 1YYLH 4ZOAA 3K4ZA 1R0AL 3CUPB 4ZTOH 3EFDL 3O11B 4LPXA 1KIQA 4NFDA 4YXLH 2PYEB 4HJGA 1MFEL 4FQLH 3ULUE 4WFEE 5IVNA 1OW0A 1JPTH 4MD5A 4P49A 1B3JA 1J05B 3MJ8B 4LKXA 2WUBH 2EC9U 3FOLA 5HGBB 1C12A 1T1YB 4U6XB 3MACL 2ZCLL 1PX3A 1YQVL 2J8UA 1OAZH 3ES6B 4H20L 4YK4C 4P2QD 25C8H 1S9VA 5C07A 4F7PB 3VD9A 1KLFA 3CXDL 4Y2DC 2FLBT 1M7XA 2AEQH 1BGXH 4U1HA 4PJAF 3ULVE 1NGPH 5MI0B 3RVWC 5C0JB 3O0RH 2VLLA 4PD4K 1I8IB 1GGUA 2K3TA 1EAPA 1HNGA 3T4AB 3SDYH 1WGOA 4O5LL 4U1LB 1L9MA 3PGCA 1PGRB 4PRPA 2VQUA 4NKMA 3SDCD 2Z35B 4NQCA 1NGXA 4UNTA 5F7NC 2NYYC 1BQHA 4PFEA 2J4WH 1H0DA 3QISA 3DYMA 3QUXC 4N1EA 5HDBE 4NUGH 2X05A 4X6EA 1QG3A 2NX5E 5ICYA 1EDQA 3TCLB 4D0BA 3VH8G 2PW1B 2Q86B 4DN4L 2XPGB 5IESL 4YXKH 4S10A 1HHIB 5EIVA 5JOPD 5IV2A 3MV8E 3MGTB 1IAIM 1AQKH 3LIZH 3QXAB 3DSFL 2GK2A 3O4LD 4ONGH 3GBNL 2ZOKA 2QV2A 2EH7L 5GGRB 5BS0A 4JRYA 5ABDE 4R2GC 3BYTA 1FGNL 5GIRB 2Q3ZA 2AGJH 3TA3D 4HIIA 1ETZA 4X7TB 4IOFC 3MROA 1FNSL 3HG1E 3W5NA 3QDME 4LFHD 5KVGL 3GSNH 3GI9H 3BP4A 4U1IB 1IC7L 4L4TA 2QKIA 4XNQB 1UM5L 1A7BA 1FNAA 2GK0B 2M1KA 3EFFB 4KI5F 3T77B 2UV3A 3K8LA 5D2NC 1YN6B 1QRNE 3PNWA 4KKBC 3N9GH 1B0RA 2GTWA 2R56L 4QYOB 4ERSH 2BJMH 4QNPE 5EU6E 2CDGB 4U1IA 3LKOA 3WO4B 3BZDA 1NMBH 4Z78B 2AEWA 4LIQE 4M02A 3VXSE 1AGFA 2P46B 1NCAL 3SGJA 4M9PA 5ETUA 2V9TA 5T5FL 4G8GB 1YA5A 5T1MA 4J12A 5EUOB 3D0LA 4EI5B 4M6NL 4KROC 1FV1A 3TNMB 2XZAL 1S7QA 4GKZB 4OFPA 3LDBC 4JGJA 3MRHA 1FYTE 4JO2L 1W8NA 1I8LA 3V52L 2VWEC 3QSKB 5EB9A 3B2UC 4P2QB 4JFYB 4D3CH 2IH3A 2IQAA 3C60A 3VGAB 4XBGB 5EUKA 5HDQL 2R23A 3MV8A 3FRPG 1BVLA 1A6WH 1A4KB 3OKEB 3U4EB 5I1GH 3X14A 1WWBX 3CSPA 2R0ZH 5E8DL 3RDTB 4M43H 1VPOL 1KN4L 4M7LT 1YJDH 3NCBB 5FKPA 4MSWA 1XFPA 1RV6X 4AIXA 1WFNA 2VR4A 2FH6A 4PS4L 5KBNC 2P48B 3PWPA 3TO4D 4R8WH 2ZCLH 3F6IA 4PJDF 4IIQA 4M8QB 1D9KA 2UYLB 5KJRH 2Q76B 1LD9B 3O2DH 2VISB 2NY5L 3U1SH 5IVOA 1FHGA 2JJTC 4M9OA 4EDWL 3WFBL 2CH8A 3FT3B 5LCVH 4RZCA 2D7OA 1CWVA 4KHTH 4RIRB 5E70A 3HMXL 3VFGL 2FHCA 1EERB 3BN9C 4WGVB 3ZE2F 4FQPA 4NC1C 5C0JA 2P5EE 3D6GA 3QIBC 4X6CE 4MAUH 3O4LB 2BVQB 5HHXH 4O5LH 1RULH 2ZCHL 3BXNB 3IT8D 3VE0B 4B53A 1SY6A 3AMLA 4TULL 1T1XB 1KTRL 4X6FB 1QLRB 4HUWB 2VDQH 5DEFA 3ARGD 2VXUH 4FHBD 4Y1AB 2HVJA 1PLGL 4KZEL 1RHHB 2QBWA 3TC9A 5E4EC 2SEBA 5FYJL 1EUUA 4L4VE 1A1OB 1ADQH 1QEWB 1QSED 2BDNH 5HI3C 3T0XA 4JRXE 4NCC1 3U4AA 4MNGB 3LY6A 2Z8WC 1ZOXA 1YMHB 2IH1B 25C8L 3HZKA 5SX4H 4F3FA 1WFTA 1FZOB 1HHHB 1N64H 2BFVL 4MNQB 3V6OE 5TF1H 4HH9A 4Z7UB 1OT2A 2I5YL 3GSQA 4MAUL 1NBVL 3BPLC 4CMHB 4NRYB 1GIGH 3BWUC 3T4YA 4JQXC 3ARSA 5D7SH 1GPOL 2DQEL 1A4JB 4XVJL 1TTFA 4XPFH 5GHWL 3MQIA 3P4MA 2G2RA 2BP3A 2XYCA 3S37X 1P7QB 1A7PH 1X5LA 2OTUA 4FQIL 1TDQA 1U8JB 5TPWL 1N7ML 1CR9H 5LBSL 4P4KB 3PV6A 1QLEH 3GB7A 3W9DB 5HVHB 5DJYB 3N1MC 5FHAL 1U8OA 1BX2B 4DKFH 3VDCA 3QDJB 3JWOC 4EUPH 4Z7VA 4EDXB 2I9LA 1PY4A 3KS0J 5JIKA 3BE1H 3F7PC 1KXQE 3QYCA 3ZTNL 2A1WH 1XMWA 1EXUB 5I15H 3F12A 4O2FB 4WU7B 3ULVH 5E6IA 2VOTA 5CIPA 1DR9A 2G60H 4O2CA 1CYGA 5DXWA 1CLZL 1XZ0B 2X4QA 2R8SH 2J2ZA 3HZMA 5I1DA 3T0EA 3QHFL 1MRCL 4G6FD 4JY5H 4W70A 5C8JA 3LH2L 2AJSH 3RPIB 1HI6A 5T1KA 3FONB 5MP6H 1Y0LA 5F21B 5DQJB 4C83B 3TPKA 3TPUB 4IOSD 4N9OB 5FUOL 3K8KA 5CJ5A 3ET9F 3GM0A 3V5HB 3LS5H 3K80A 5JHDA 1RU9L 5B21A 2F74A 4YH6A 4GJTB 2CLVB 5C6TH 4HWBH 1R3LB 3GMMA 5J7CC 3V8CA 3E8UH 3OB8A 4G7VH 4WEBH 4HDIB 5ENWA 4FQHB 1FL5B 1EHXA 1I3RB 2BNQB 3O4OC 4AYFA 5IB1B 1P1ZA 4DKEH 5D9SB 4X5XB 1BFTA 1FDLH 1C1EH 5FA3A 1A7OH 4K2UL 5IMKA 4WDIA 2UY6A 4RCAA 5E8NA 1R6VA 2UYLA 3EDJA 5IKCB 1F4XH 1FSKC 4ZQKA 4L8DB 3L6FA 3HC0A 1KFAH 1QO3B 3KYMA 4RA0C 4EI6B 5EBGA 1IGMH 4BQCA 4AEHL 4YX2H 2EH7H 3T3PF 2D31B 4APQD 4OM1L 3C6LA 1DEEA 3SDDC 4YIQB 3BYYA 2Q6WA 1H15A 3UTZA 3L6FB 3H9SA 4BELD 4JDZA 2A6IA 2EEAA 3ARGA 1H5BA 1G7MB 4K3DH 5GRZA 1OAUH 1IC7H 1NJ9A 1FN4A 1KTKE 4XP6L 3GUTA 1I7ZA 1XF4A 4HC1H 3D69B 5CJBA 2VLME 2GFBA 4Y4HA 3A0OA 1S7RB 3AY4A 5E5MB 1ZHNB 3WKML 3I6LE 3IXTA 4OAWB 2ZSVB 5DRWB 3O81A 1NGQH 3FN0L 4POZD 1XGRA 2FBJL 4R7DB 1GGYA 3QPXH 1V3MA 1LK2B 4FP8L 1E27A 4OBRA 3S4SG 2GIYA 1QKZL 4AM0A 5DO2C 1ZVHA 4K9EC 4P57B 5GRJL 4EQ3A 4LU5H 1L4IA 3EZ8A 5D1QD 1YEEH 5DQJA 4C83A 4Z7WB 1F4HA 2OTWB 3WEXB 4U1JA 1XIWC 2QQQA 5DJ2A 1FFOB 3UC0H 4K8RH 5ICXB 4ZUUB 3MV7E 4R26L 3BGMA 3C60D 2EEBA 4HKZB 2CO6B 4AZ8A 1I1RA 3QIWC 1MRDL 5B3JE 2DM7A 1QBBA 5ITFA 1AR1C 1SJVA 1SJHB 3BSZL 4P46A 2DQHH 3R0MA 3IFPB 5HYQA 4H26A 5DRNB 2ENSA 1OARL 2P5WB 1WC7A 1H3PL 3TN0A 2JJUA 2I24N 5AWNH 4LDOB 4XCCH 1MFDH 4U6VH 1Z9LA 3B83A 4NRZA 3HNSL 2D9CA 5C9KA 3RWEA 4NQCE 4U0RB 1L6XA 1GC1H 4FQCH 1CXHA 2YXFA 2OK0H 4ZUVA 4RGNB 5C1MB 4JZNB 1VKXA 3S36H 1OAXH 3D3VD 2DKUA 1FIGH 2FJFB 1XF1A 2CLRA 1NH6A 2LE9A 1NGWA 2N4IA 3KXFD 5DJZB 3M45A 1R3IL 5I1LB 5JOEA 4XZUA 2P8LA 5EOTB 3RWDA 2JJVA 4LHQB 4N8VG 4DZ8A 1HINH 3BVNA 1IC5L 1PG7W 3FRPA 3WIHH 4IOFD 3BW9B 2R9HD 1A2YB 1MFDL 4U6VL 3L5XL 1F02I 4P48A 3MRKA 4LQ1A 4JO4H 4HUUB 4MHHG 4X9IA 4XPAH 2CLRB 4XP5L 4KKAC 2GCYA 2QSCL 3B8SA 3VI3E 2XWJA 1DQLH 4UQ2B 4PJGF 3H3PH 3C5ZB 4PRHA 4MDJA 1JI2A 3HAEG 4ZUSA 1SYSB 5F1OB 3QHZL 4QXGL 1CN4A 3GJFB 1U8KA 5DFVC 4JRXB 2IQAB 5I1AA 1JTPA 1RZGA 2Z91B 1BHGA 3BFOA 4KDWA 3UPRB 2VLJD 4G80B 4HMCA 5DQ9B 5EBWB 1IBGH 2JCCF 3FFCA 4LF3A 4YDLC 3MMEB 1PD6A 3TIDA 4MXVE 5F7UA 5MEQB 4JDVB 1OP3H 2FL5A 1ZLSL 3WL9B 3KWWB 5FO9B 4HS3A 3AREB 3GJFK 4F9LC 5C09D 1QSEE 1VFMA 4L3EE 5I1IH 1DQQB 2YRPA 4JVWA 5GGSY 3MUHL 1DQJA 2XZZA 1NCWH 4WW1B 5DURD 5HGGS 5D7LE 4PJ9C 3VMPA 3WLBB 2P24A 5DD5H 3HI5L 4RMUA 2FECI 3UTSD 5I1CH 1TZHA 4Q6YA 1S3KH 3BZFA 5J6GA 4PJXA 5ALBH 4LSUL 4XNQA 3GBLA 4KQ4H 3LEYH 5FDWB 2B1AH 2PCPB 3H6JA 3X14B 4M1CC 1FO0B 2YZ1A 1A9BA 4LCCA 4JKPH 3KYKL 1NBZB 2FJGA 3CFJA 3X12A 2X89A 1G1YA 1CE6A 1I1FB 3NN8B 3MBEB 5E1AB 1QFWH 3UTOA 3DV4B 4G8FB 1D3CA 5HHPB 5MP6L 3GSVB 3MYJA 4NGHH 5ELIA 5EO0B 2IPTL 4QTHB 4ZG1A 1ZHKB 1NBZA 3D9AH 1JZ6A 3D69A 3OWEA 1W0YT 3TCXA 4PJ5E 3MBEA 5A16B 3IDMB 5DUPL 2R0WH 2ILLA 5KOMC 2MCPL 1FGNH 4L1HA 3QCTH 2DM3A 5D6DA 3E8UL 3EYVB 1H3UA 5E00B 1WJ3A 4CW1B 4FMFA 5EC2A 4YHZL 1Y6NR 5GJTL 1ORSA 3SBWC 5B8CB 1KBGL 3BD5A 2XQBL 3ARGC 4P5TA 4PPTA 1YNTB 4YUEH 3TZVC 3WBDA 4JPIA 5IW1B 3TN0D 1NLBL 4WW1A 3MNWB 4U0QB 1G6RH 5DJ6A 2HFFB 3OGCB 4F80A 4KDTA 5IB5B 5FUCE 4OD3H 4UV7L 4QTIL 4RGMC 3VRJA 5DHYA 2WBJA 4GW5A 4LSPL 1XH3A 3SDCB 1YDPB 3UTQA 4NNYA 5CEZL 2X4PA 1SM3L 4BZ2H 2VLLB 5T1MB 2OQJB 2EE9A 1ETZB 1NGWB 1TENA 4XAKD 3RHWF 3WNPA 5C6PB 5FUCC 1UQSB 2VZOA 5TH2B 4NKOA 2VKWA 4OB5H 1ZA6B 4R4BA 3GSNB 1XF3A 2W1NA 3BESR 5HGDB 2E6PA 2D7QA 3MOQA 1RIUL 1DUYB 3NACH 3ZE2E 4QRRA 4YHPA 2JF1A 4CBPA 2MNUA 4N90E 4K7FA 5BVJA 1IT9L 2HVKB 5E2VH 3MRKB 2VLKA 2Q7YB 2KUTA 2J4WL 1C5BL 3HZMB 4MVBC 4NT6A 4K23H 3TJHD 3U82B 3NFSH 4XBPB 4YNYB 4HS8L 5E8EB 3D85A 2RB8A 3WIFB 3UMTA 1QFUH 4ZTPH 4L5FH 4M62H 2Y5TA 1Z2KA 1MCJA 4QRSB 2YD5A 2AV7B 3UPAA 3T4AA 5E8EA 4XZUB 5FUZH 2XKUA 3TYFB 1HQRB 1JRHL 2R2CA 3O3BB 3V4VL 4GRLB 3DARA 3RAJH 2NZ9C 2ZPKL 4YGVB 5IF0A 4NC2B 2EDFA 1MQKL 1DVFD 1TQCC 3FZUC 3MGOA 4JFDB 1V05A 1CGWA 3W2DL 5HGBA 5HYFA 5EZIL 4HIHB 2C4FT 4TSBL 1UACL 1JTOA 3RP1A 5DSCB 5K59E 1UYWH 2VXVL 4LMQI 4PRDA 3VG0L 2EXWD 4YPJA 3KJ4B 1Z9OA 4LSSH 4FFZH 3F7QA 3V0VB 1MUJB 3L3OB 2P8PB 5D1XA 5GISL 3I6GB 2PXYA 3MSPA 1OTSC 1JRHH 4MXQD 2NLJB 2P1YA 1KC5L 4X0KA 2AK4B 3ARXA 5DJCB 3STLA 5C86A 1AE6L 2WWMC 4YPGB 5EZOL 2XZCH 4Z7UF 4U1GC 4DFIA 3VFRA 2EDJA 4XI5C 2H32H 1BBDL 1SHMA 4ZSOE 2VLRE 3QQ9C 4YO0B 4MJ6B 1OTUC 3B3IB 5FF6B 4X8JA 1DDHA 1GAFL 2FZ3B 5B4MD 3WNLA 2VO5A 2ZUWA 2VLKE 3MV8D 2WMPA 4YHNA 4HK3J 4W4OA 1FBIL 1U2HA 4HWZB 4OAWA 5JR1H 3LPWA 3T8XB 1HSAA 2CQVA 2V17H 1L0QA 2PYED 5I1GL 3BJ91 3WE6A 5CHNA 5KS9B 1PEWA 2B39A 1M7DA 1NLDL 2B4CL 1ZK9A 3E6FB 1A1MA 1NC2B 4Q9RL 3VXUA 1EGJH 3QG6B 4NJ9H 2HG5B 5DJ0A 3QCUH 4X80H 3TNMA 5ECJE 1HYRC 4PD4J 4R8WL 4URTB 2VISA 2BMKB 4JFEA 3VGAC 1P2CA 4F7CA 5GRJH 4JO3L 1NBYA 2VIRA 4FQ1L 3U1SL 1S7WA 1FFOA 2GSIA 3OX8A 4ZXBA 4WFGE 1E4KA 4A6YL 1EZVX 2CGRL 4DUVA 1UEYA 5I1HH 2YBRA 5D71H 4JZJB 4RQQB 3QFJB 1J8HB 2ADGB 3VXSD 4XNXL 4PJEB 4M7JH 1N4XL 4ZQKB 2W9DH 3RPIA 2BXYA 2IAMA 4UT7L 5F1NA 3VXNB 1IILE 2IPUK 3AREC 5I73C 4P99A 1QFHA 2ITDA 4UT6L 5FGCB 1P53A 4GFTB 4LPWA 5CGYC 4YUEL 3V6BR 2YWZA 4EI6A 2J6EH 4NPYA 4Y7MA 3LQAC 1BOGA 4LSTH 5EDXA 2AGJL 1C16A 3VRIB 4HEPG 5DD1L 4PLKC 2YD7A 1EEYB 2HJFB 3WV0A 3V6OA 4M4RA 3C60C 4LSPH 5C6TL 1RK1A 4S1RH 3BRFA 4XNXH 5DZLA 5E5UB 4HPOL 1RPQA 3D87B 2YD8A 4M03A 3QEQA 5GRXG 1LO2L 2A74A 4I5BA 3QIUB 3UPCA 4HUXA 1QQDB 5JXAL 1ZLUK 2F5BH 2Y72A 3REWA 2ZP0T 1U92B 3MRNA 2F54D 5IB4A 3LKOB 4UDUA 1P7QA 4IBLT 4X6CA 2J7LA 3KYMB 4P23C 1OP5K 4LEXH 1T2XA 3NH7H 1T1ZA 1QA9A 5CZKA 3I2CL 5FO7A 4FFVD 4IMKC 1OCWL 1AY1L 3MNVA 5KTEL 1Z9MA 2VR9A 3W0WB 2IALB 3MROB 5DD0H 1FNGB 4OKVB 3BPOB 1G6RA 4YFEA 1MI5A 1SYVB 4HK0B 2BVUA 1I8IA 4M6MH 2KBGA 1J1XH 2HTKD 4WWKB 3F12B 4NQVB 4DKDC 1NC2A 5EBWA 5L8KB 2R1YB 3EJJX 4P3CL 1XGQB 2BHUA 1HYSD 3QUZC 2IGFH 1VSCA 5I2IA 5A2JH 4CU6A 3GSXA 3EYQC 5DK2B 3MRMA 1AO7D 2KPNA 4RFOH 3MLWH 2YD3A 3P77A 5SX5H 5B3JF 2NW2B 1VEOA 4JHWH 3NCEB 5TGBA 3RUGB 5I17B 1G84A 3K8MA 2R8SL 5CGYD 2HKHH 1RUAL 3GB7B 4PJXF 3SO3B 4HLZG 3ZKXC 3ZKQD 3ARUA 2GCYB 3AMKA 4LARH 2UUDH 4NNPH 1BBJA 5DRXB 4UBDD 2VWEE 5FYJD 3BEWB 1EEZB 1OGAE 4ZFGL 1RJYA 3A67L 2ZG3A 2X44D 1O7VA 3FQXA 4U6HA 4OZGA 4APQB 1HXMB 2W92A 1EXUA 4HS6A 4J3SA 4G5ZH 5SX5K 1Z0MA 1U6AH 1OB1A 3A6OA 5ICXA 3B2VH 4QWWC 3IKCA 1AQDA 2OTPA 4FQIH 3HPLB 4O9HL 4Y4FB 2NY5C 1BBJB 2XN9D 5DRXA 5IM7B 1LP9A 4PJ7A 1WEJH 1F4YH 2BVOB 5DRZB 6CGTA 3VE0A 2GJJA 3F5WA 1FO0L 3QUML 4XHJD 1XR9B 4PJ9D 1J05A 3V5KB 3HNVH 1IEBB 4Y19D 5HYQB 3FOLB 3R0NA 1FZMB 4MCZA 4Y88A 3P40A 1XGQA 5GS0C 3C5ZC 1LO0H 4J3UA 4QGYA 5FM5M 1EO5A 3QUXD 4YFLF 5TQ0L 2V7NA 2X9YA 3F5WB 5C0GB 1T21A 4XXDB 3D18B 1T7XA 3FB7A 1CXEA 4O9HH 4QCIA 1IVLA 3HTLX 2VDML 5K9QG 3IAQA 5LXGH 3K2MC 4HIJA 2H2SC 5JA8B 4NRYA 1TETH 3GUTB 3HAEB 3LEXA 5I66B 5JZ7D 1MCWW 1HYSC 3L3HB 3SGDI 3D18A 3HRZA 3MV9D 5IQ9B 2ZSWA 4XHQA 4EIGB 3GK8L 2WIMA 3CC5A 3O2VL 5KSUA 1F11A 2M26A 1CVRA 2YXMA 4M93C 3P9LB 4RX4D 5CBAB 3LV3B 3MO1A 1P69B 3FCTA 3RKDC 1KB5B 3BKJH 4IRJC 1FC2D 3SCMA 3U36A 2Y07H 5BRZD 3WKMH 3H3KA 4QTIH 3EO9L 5F7HA 1IFHL 3JTTA 4EKXA 3TN0B 5D6CA 3CMOH 4NQEE 3NIDE 2WZPD 4LPUA 3EBAA 2R4RH 3VFSB 1T1WB 3RVTC 4YDLB 1QKZH 3QG7H 5HXMA 3VWJD 2VE6B 4KY1H 5ADPH 1S7XB 1JJUA 1U3YA 4I1NB 3DX6A 1IM9A 5H37G 1I9IL 4DAGH 5DA4A 2FX7H 1D7FA 2R1WB 2JIXD 3D5OF 1OCWH 1FJ1A 3GGWB 2VLRA 1QPPA 1A8JH 3RZWA 2I9TB 1VADB 4ELMB 5JOFB 2VE6A 4HBCH 1TTGA 3D3VB 4GKSA 5I6XC 5ICZA 4HPOH 5IFJA 4OM1H 4XPTH 4X6DA 1AKJB 5I1KL 2NY2C 1TZGH 4RMRA 2BY3A 4PYHA 5B39B 3QUYA 1MIEL 3PNWB 4LCIH 4S1DC 2AEIT 1N6VA 4KC3B 5HYSA 3BIKA 2F5BL 4D9QD 1W8OA 5D7IE 3DHMA 1N2RB 1NCWL 3WLBA 3ZSTA 1P5VA 4XP6H 5GGTA 3C5JB 4KK8C 4X6DB 1XF2A 1GHFH 5I2IB 3CFEB 4NO0D 2BNUB 4NBYB 3RTQD 2NY3C 3I9GH 1JUFA 4LPVA 1O7SA 5DVMA 1FVCB 2AXGB 4DKEL 2H2SD 1T0NA 1QRKA 5EIIA 3MRIB 4ZFFA 1S3KL 3DGCR 2FNBA 4M8VA 1YEGH 5IIEB 4XPTL 3I50H 5DQDH 2R1XB 5E5MA 1NFIA 5JDJA 2D0GA 2QQNL 4JM2D 2X4UA 2PYFB 4ZXBD 3VCLB 1A0QH 1HNFA 4L9LB 5K9OB 1T1WA 1S78C 3MLXL 2AXGA 2ZUYA 3NOIA 2GT9B 3BPNC 1WWCA 4WUUE 2HP4A 3RKDD 2BNUA 3UO1L 4TTGA 1RD6A 4PRPD 3MRPB 4OF6A 1KPVB 2BRRL 2AABH 2BNQE 4HKJA 1FORL 1UWXK 2OP4L 4WHTA 1EO8H 1RJZB 2Q7NA 3BN9D 2YUZA 4RDQF 1N6QH 1DVFC 3G6AA 4YIQA 5B8CC 2AJVH 3CDYA 4U7KA 1JYWA 3FQWA 4I4WA 3RY4A 4HC1A 3FB5A 3PABA 4A2LA 5TQ2H 3B2UD 2MQ3A 1UZ8A 3GKWH 5GIRA 4H88H 2NTFA 3GSWA 5HHPA 3BE1L 4JJHA 4O2FA 3VXRA 5L8LB 2ZCKL 3BKYH 1V7NH 3IDXH 1WIOA 3TZVA 2EDQA 2IANE 2PETA 1YEHH 3QT2A 2XWBB 1F8TL 2Y6SD 5I8EA 1CU4L 4DVRL 1IJ9A 3QDGB 3DRTA 2J8UB 3QH3B 4NWUL 3IDGA 1WEJL 5ADOH 1BVZA 3MLVH 4MVBD 4QHNA 4GRLC 4F33A 3DURA 3NVQA 1NC4A 5SWZE 5DRZA 3O3BA 5FV2A 3I85A 1AGBB 2MCG1 3SE8L 3B3IA 3IB4A 1YEFH 2DWDA 4LOUD 1BF2A 3OKYA 1P84J 3S6CA 3TVMD 4BH7B 3G5XB 1CXKA 5L6YH 2JTDA 1YEDA 4OCXH 3RVUC 4U3XA 4IDLA 1G9MH 3CDCA 3G6DL 4U1LA 3L5HA 1BZ7A 2H1PL 5F8QC 3R06B 2VDKH 2VSDA 1K4CA 4K9EH 4KMLB 1T03H 3BQUA 2DYPD 4AY0A 1R5WB 1RUQL 3OXRA 4WV1C 5ISZE 1I75A 2PXYB 1X3DA 4OD1H 1DL7L 3U46B 3QWRD 3NFNA 3NCFB 4R90H 4L4JA 4M1DH 3VD7A 4XCCL 4JQXA 4M4PA 1D6EA 5EOCJ 2MQ0A 5HVHC 1KUMA 3HNSH 4KK6D 1JBJA 3A6BL 1QRNB 2XXMB 1DE4A 1FZJB 1F4AA 2QADB 4XMPL 4WTZG 2IADB 2OM5A 4YHOL 3UZEA 1B0GA 3BIBX 3GEWB 3SGEH 5I1EL 3FTGA 5F7MC 5EBLA 4MQTB 4ODWB 4ZSOA 4BUHA 5C70A 1MJJB 1SJEB 5D5MB 5IGXL 4ACPA 1JNLL 4KTEH 3UTTA 4GRMB 2BNRD 1ZVYA 1B2WL 3O2DL 1WLHA 2X9XA 3WJLC 1KGCE 5KS9E 5CEYA 4KTDL 1HOCA 1BVKA 2AJ3B 3VFGH 4BQ9A 2MSPA 4PRBB 4Y5YB 1P7KB 4MS8D 2BOBA 4L4VD 3ROLB 1A0QL 5MEPB 1LE9A 4ZMAT 3SE4C 2CO7B 4MNHA 1PQZB 5EO9B 1T20B 2HFTA 1S7VB 1SJXA 2DWEB 5T33H 1GYAA 5KSAB 3R4DA 4YHPB 2HVJB 3MFGB 5EC2B 5KW9H 1WBXB 5E6IC 1TLKA 4LPCA 2FBJH 2VLKB 1PDKA 5T3XL 4AM0B 1YEKL 3GMNA 4HUVB 2NW3B 3PIQB 4NSKA 3RIAF 5I6XB 4YBHA 2X4RB 2JELH 3QH3A 1WFUA 3BP4B 5C0CE 4PGEA 3ULUD 1UJ3A 5IMOB 5CZXD 3J7HA 3JUZA 4WI9A 4PTTA 2O5ZH 4J3VA 4FFVC 3KPPB 4HV8A 2OI9C 4QXUL 4J4PD 2WBJB 4GW5B 3PDDA 1AGCA 4NNYB 3P73B 4QRUB 4Y4KA 1BPVA 3FQWB 3GKWL 3IDUA 1VERA 3D0VA 2IALA 5ID0B 2FHBA 5JXEA 4ZYKB 1UM6H 2DQUH 1SY6H 4M3JA 5IHZB 5HYEA 5ACZA 3DVNB 3QUZD 1HWHB 4BSVB 4Z8FH 2Q8AH 4EUPB 4N0FA 1JGUL 4NQEA 2WIIB 2XZAH 3JSSA 5I30H 2K7PA 4FOMA 4P5TB 1DEEB 4Q58C 1S9YA 3RGVC 4ZO9A 3RQ3A 2YBRB 43CAA 2CUHA 2B1HL 3D39D 2X4SA 3CK0L 3IXAA 5E8OA 1T3FA 1QR1A 4LLDB 4Y5YC 4HKBA 4KJWD 4HBCL 5F3BB 5DO2D 4XP4H 4R6UA 4MQSB 2VXTH 1IC4L 5FXCH 3W11C 2EKJA 3AREA 2P45B 3UTQB 4YHKL 3RNKA 4M6OL 5I1KH 3GSVA 3D9AL 5E6IB 4GUPB 3N9GL 4UT6H 4F37K 5EO0A 4YJZL 4P5MB 1DFBL 1HH6A 4W4OC 2DQIH 2VLMD 1T5XA 1EEYA 1JNHB 2XN9B 1OWWA 1OGAA 2CK0H 3QIWB 5IW6B 1G7JA 5HPMA 1U3HA 3MCKB 3QIUC 5JPNB 3PV6B 4IJ3B 3OJDA 5JHDB 5KANI 1A14L 3ZYZA 3AAZA 1HN1A 3HG1D 5KS9F 2VQTA 3Q6FA 3D2UB 3G6JE 4RQQA 4XPAL 5I75B 2Q8BL 3LEVL 5D7KD 4TUJA 5MEPA 1KCRL 1IEHA 1UWXH 2J8UF 4MA7H 4EI5C 1T7VA 5J11B 2W91A 1T20A 2XKNB 1GVIA 2HT2D 1BQLH 5EOCH 3B43A 5SWQA 1LP9E 3BKCH 4DVBA 2O61B 4L4TB 3R1GH 2YN5A 3ZYOA 4GSDL 4IMLB 5JR1L 4X0KB 2Y5TB 1NAKH 3P2TA 4MNQD 3OKOB 4P23B 3ULVL 4MX7B 4C55A 4LVEA 1K8IB 4LLYA 4WWKC 2BCKA 3RAJL 4LLVB 5TFSL 1B88A 1LEKB 2DQJL 3KLAA 2IWGA 2APFA 2C3VA 4ALAH 1PAMA 2HT4D 3QHFH 4EN3A 3MTRA 2WLZA 4OTXH 4JGMA 4NO5B 4KAQH 5I1IL 2MPAH 3KJ6L 4MQ7A 3V5HA 3EGSB 1QYGL 3TT3L 3JV6B 5D5ME 3L3JB 4PJBA 2IF7A 1BJMA 2MWCA 4NC0B 3GSXB 4KJWC 2DJSA 4V1DE 3CFBB 5HGHA 1MHEA 1UKTA 4BZYA 1TJHL 2J12B 1X4XA 1NCNA 2DBJA 1VESA 4KKLD 1TZIB 5EWIH 2DIBA 1NUNB 3SDAB 3UYPA 4LKCA 2HJKA 3PQYA 3M1BB 3Q0HA 4ALAL 1ND0B 4QWWD 4WO4B 2WWKT 3OAYK 4MD0B 3QNZB 4GOSA 5H94A 5EOTA 3RWDB 1RMFH 3IGAA 2NX5A 4JAMB 4NNPL 4RFNB 3K1DA 1NMCB 4CN1A 5SWQB 4YE4L 3SJVB 4NCDA 4OKDA 2ID5A 2A6KB 4Y4FC 1TQBC 4LQFH 3WNMA 5IB2A 4XHJC 4DKAA 2BC4A 3M1BA 3O6KL 1NL0L 1TZIA 3SQOH 3KXFB 1EBPA 3RY5A 2DD8H 1E27B 1RZIB 2LAGB 3WFBH 4YK4B 1F3JA 4KJYA 1LDPL 3DHJA 5I17A 4UV4L 1NDGB 4HUKB 1KJ2L 4E41D 4HLJA 1F4YL 4PJ8B 3OPZL 4NO5A 1RULL 2ZCHH 3ILQC 3V7MA 4OFDA 1JWSB 1UADC 2GFBB 4Y4HB 4JY4B 1X7QB 1AO7B 4U1SB 1JV5A 3RWIA 3MLUH 3T0DA 4P9MH 5BO1H 2E27L 4R26H 3PL6C 1EPFA 4MCYA 4AQ1B 2O61A 1GZPA 2FB4H 4YDIH 1G6VK 3H9YA 5J56B 3L3KB 4GRWH 4OGXH 3FN0H 1C08B 5GJSH 5DFVD 1R3KB 2QLVB 3QXTA 1FQ9C 3BH8B 3BAEH 5JDSB 4UIMB 1RZ8B 2FIRT 3QXDB 4NHUA 4OF7A 4WI3A 5DWUL 2NW2A 4JN1L 2XA8L 3ULVD 3QNXA 4C54A 1UWEL 1JYXA 1P7HL 1MJ7H 3MRNB 4K71B 3VWJC 4KROB 1KPVA 3UDWC 4QRRB 3P77B 4P3DA 1RIUH 2AP2A 3MCKA 3OZ9H 4P2QA 1OF2A 4LK4A 4JFED 4HIXL 1UVQA 4QHMB 3S34H 3LKPB 4YC2C 4N0YH 1A6TB 3JZ7A 4OZFG 1CGTA 4K94L 1A64A 3MLRH 2EE2A 2R2BB 3NCCB 1VHPA 3NA9L 3DV6A 2I60H 4JM4L 2WAHA 3C6LD 4PBXA 3SDCC 5JXAH 1JZ3A 4ENED 1I3GL 5BXFB 3KLDA 4N5EC 1B6DA 6FABH 1JFQL 2CK0L 5C08B 4MJIB 3GNMH 4RNRB 1AH1A 3UTZB 1CICC 1VGKB 5HHMD 3VGHA 3D3VE 1MJUL 4ZUSB 5F7YC 2EH8L 1ZXQA 4HUNB 4EN3D 4ZS6C 2V5SA 3QI9C 3L3KA 1ULVA 4C4KO 3NA9H 1IE5A 5CS7A 4J4PA 1ZHBA 5INDB 5HHNB 5E8NB 1J1PH 3P0VH 1QPXA 1UM6L 2V5TA 5BS0D 2G75B 5FUOH 2OYPA 4OCYH 3ZKXB 4ODVH 3LQAL 3PWUA 5J1SC 1XIWA 4R9HA 3FB7B 2AKRB 4GXVL 3BO8A 2OL3B 5IWLC 1QSVA 3QUZA 3QULB 4KDTC 3VXME 3MREA 1OT1A 3BP6B 3WFEH 1UVQB 2PW1A 1S7TA 1PG7L 3HE7C 4PJFF 1ES0A 1XCQB 1B4JH 1PKQE 1DBAL 4PJXB 1ZV5A 1DQLL 3IKKA 1M05A 5GGUA 4XNMA 4Q2ZB 2HA1A 1U8PA 4Q9QL 5JOPE 3BHBA 1J0HA 2RR3A 3LV3A 5J6GB 4P59L 1UM4L 3L7FA 4EXKA 3SCMB 3U36B 1HH9B 5FYLL 2HFEA 5DS8B 3QXDA 4NZRL 1D9KD 3O11A 3VGBA 3LRGA 1KJ2A 4UV4H 2I07A 2FATL 4M3KB 1G9NL 4AIZA 2AXFA 1FNFA 3HZYB 3UAJD 4HGWB 2QL1A 2EXWC 2QSQA 1FCGA 4AQOA 2YA0A 3QO0A 3WJLA 3EFDH 5T5NF 4LSQL 1MJJA 5D5MA 5FM8A 2DS4A 4LKCB 3VD5A 1FRGH 4ZS7H 4RMTA 5ESQB 1YEDB 4X4ZA 2AXJA 1UFUA 1OAXL 4PUBL 3HA0A 5D1ZB 5TE6L 1S9VB 5C07B 3HNVL 4NDMB 4EN3C 2JK5B 4MS8C 4PB0L 4G9FB 1AGEA 1AD9A 1FFPB 1D6VL 2PN5A 3IRPX 2YS4A 4JM2B 4NYLB 3DRTB 4HCRH 3O3AB 1F8TH 2DRUA 3DVGB 3WLWC 3VA2C 2PNDA 2XG5A 1S7TB 3SKNA 3ULUF 5TFSH 4K3GA 4LSQH 1A47A 4KWUA 1DLHA 1JPSL 3U83A 3H2WA 2X70A 3LZFL 4H25B 1WK0A 3N1FC 3BZ4A 1N8ZB 2ICEB 1A2YA 5C09E 2KQMA 1JHKL 3MR9B 3JV0A 2WSKA 5DJCA 3STLB 3WUWB 2MPAL 5HI4D 4O51B 2E7CA 2NY1B 4TUOA 1KEGL 5FCUH 1ZGLA 4OCWH 2VABB 2GJZB 3LSOA 5DS8A 1YEEL 3HE7D 4LRIC 3GHEL 3QIBD 3LMJH 4XCNB 2DLFH 1KJ2B 1W2KT 3T2QA 2EECA 1FZKB 4MAYC 3VFOB 3KPRD 2RCSH 4M61B 1DLHB 5I71C 3D25B 2J3SA 4LLQB 1Z9SA 1ORSB 1D5IL 3QUXA 3ZT6A 2Z8SA 1AHWA 4XCFH 2D7TL 3RFZC 1FLRL 1JE6A 1NCDL 2HVKA 2E7LA 2CR6A 2NY3B 2MOVA 3RDTD 3CFCH 2GAZB 2WWMD 2MHAB 1QSEA 2UWEB 2VZSA 4NDMA 2BY2A 2IH3B 3C60B 2E9WA 4OFYA 3VWKA 2XI9A 2AV7A 2YKLL 3INUL 5BW7C 2DBLL 4JFFA 4XVUD 4D0CB 1XAUA 2CDEB 2OQJA 1A14H 1NCUA 1AI1H 3W0WA 1KULA 3R06A 1I8MB 1AY1H 2P49B 3VXRB 1DBKH 3IDIB 4BKLA 2AJUH 1XF5A 3SCMD 3WXWH 1DQTA 4S11A 4ODVL 2AXFB 1MQ8A 4HW6A 5DJXA 5DHVA 2X6MA 2ZOLB 4GAGH 4K7FB 3QUYB 2G5RA 1CGXA 5FIEA 3BKYL 3JV5A 2OZ4A 4B5EA 1U8NB 5BXFA 1IT9H 3EO1B 5E2VL 1RAMA 3ARWA 5DLML 3U0WH 4DGVL 5J1TC 3AS2A 2QKIB 5FA3B 3KPOB 1OGTA 5HI4C 3V52H 2JLLA 5I8OL 5KW9L 1MRFH 4UMGA 1ZHKA 4UNVA 1KB9J 1MCBA 2CLZA 9CGTA 3KVQA 4ORGA 3QJFB 4G6FB 1CFBA 3GJEA 1OTTD 2W0KA 1ODAA 3KPOA 2EDXA 3LEYL 3GI8L 3T3PE 5JW3L 4JKMA 5DJAA 3BZEA 3O6MH 4YHLL 5DJDB 4ZD3H 5FDWA 1S7UB 4QXUH 1IQDB 1U8OB 2C1PA 3HPJA 4YC2B 1OP9A 2HTKC 4NRXA 2A6IB 3MA9H 3QZWB 5L2KE 5D6CB 4GO6B 4JKKA 2NY0D 2VAAA 5CD3B 1KIUA 4OUUB 2KL6A 3LPFA 3HG1B 1P6AB 1MHCA 1RSFA 4LSRL 4AEFA 3KR3H 1JIBA 3AXLB 4MJ5B 3QIBB 7CGTA 1FC1A 3W11D 5C0EA 1K2DA 1NMAL 5DJDA 32C2B 1I1YA 3UZQA 4NN6C 5JW4Q 4GRMA 3QG6A 3GIVA 4IIQC 1G0XA 1WCBA 2WINB 5JOFA 4J3WA 5BS0B 3P11H 3H9HB 3KPTA 4G8IB 3NIGF 3BP7B 4QOKB 3RUGF 5EO1B 2R39A 1KEGH 5CJXC 3V79C 1A9BB 4X5LA 5C0AA 2VDOH 5EU5B 5AG8A 4OCRH 1JGVL 3H42L 1ZT4B 1ZGLP 3ZHKA 4HAGA 3FCTB 4XTRD 3MUGA 4EZMA 3KPMA 4ZAKA 4K8RC 5A1AA 3BP5B 4G8GD 4X6CF 3T77A 5L7XH 4C57C 5I1JH 4WUKH 4P2QE 5EU6B 2B4CH 1F4WH 1KYOJ 2NQCA 2JB5L 4I3SH 1VEPA 4PJAB 1VACB 1GPOH 3BQUB 5D1XC 1CICA 4X98B 3CCHB 4KRPD 1DVFA 4H1LG 4MB3A 3S36X 4PV9B 5C2UB 3X3GL 5FO8A 1RZFL 2X70B 4WIQA 4DVRH 3SJVE 3PL6D 2SEBB 4FFZL 1WT5C 3IFNL 1XCTB 3CH1B 1AIFB 4KHTL 2RHEA 1ORQB 3FRUA 4EDXA 5KSBF 1K4DB 3EOYG 1GC1C 5DF0A 3GFUA 3ZYJA 4GAYB 1G9NH 2YPKA 3BH9B 4QY8B 4L5FL 4JPKH 4UT9L 1XGUA 4O58L 4JGUA 3RIAK 3S35X 3ULVC 3MV8B 2EDKA 2EZ0D 5A2IH 5EO1A 3EGSA 2JJTA 4TULH 5IJVB 3KXFA 4PR5B 1ZHNA 5L8JB 1BAFL 3O2DA 2ESVA 2X41A 3ISWA 3NZHH 2ZPKH 4L8BA 1HXMA 3WS6C 1ZWIB 5TE6H 1FNGA 3TIEB 5AD0B 4OLEA 1C7TA 1MAJA 4Z77B 3S7GA 4FQQA 3QIWD 5FGBA 1DQDL 4U49A 3OKOA 4P23A 4TVPD 3NFSL 3HZKB 1ZHBB 5INDA 5FOBB 3UBXA 4I0PA 5F3HA 5ERWA 1KB9K 3ARGB 5ANMA 2RQ8A 1FFNB 2HMIC 5C0FB 4R97B 4H8WH 1OGAD 3ARFB 4BH8A 4LASH 4H5SB 2BVYA 1E6OH 1YEIL 3V5KA 4HKJB 3ZL4L 4GMSH 2XWTA 3HKFA 5FK9B 2H8PB 2FEEI 5MENA 4YAQA 4TQEL 2J88H 4J8RA 1A6WL 3MRCB 3FN3A 5IMLB 3ILQD 1FORH 4FFYH 4F57L 2R23B 3F6LA 4L4TE 3WFDH 2V6HA 1VPOH 3QI9D 2AK1L 3WFEL 3PGDA 3IXTB 2A2QT 4AMKH 4OF3A 4PJDA 3QEGL 5JZ7C 3CJJA 1EJ6A 1SYVA 3BX7C 4GW4A 1BLNB 4G42A 3WFZA 2YUVA 5D7IA 1TCRA 3RNKB 4Q9QH 4LLYB 3W82A 1KFAL 4I18A 3CX2A 1NGYA 3DX8A 3MXVL 4QHMA 4JPWL 4GSDH 4HK3N 3H9SD 4X9BA 4NZTH 1R3LA 3VXTA 5IHUL 3L3DB 1FN4B 4PYGA 1YNKH 5JW3H 5I30L 4OCSL 2OJZL 2OXHA 4N0FB 3RWCA 4GAJH 2YMXH 3RVTD 3HNTL 3VFUB 3PWJA 2B2XL 1CDUA 3IU3A 1JHTB 2DQFA 5C0AD 1PEZA 4Y8DC 1BVLB 2BSRA 1FVDA 1NPUA 4XH2B 5T1LA 3T0EB 5I1DB 5C0AB 4RNRA 5KVDL 1CE1L 3E6HB 3QEUA 3L3DA 4L3ED 3I3BA 1H8NA 1NBYB 1W0VB 2VIRB 3SGKA 4FTVB 1UWGL 3T0VA 5DMJB 3C8KB 1IKFL 5DVNA 4GQPH 3D39E 2OL3H 1ZLVK 1TVBA 5K9JL 2R1XA 2JCCA 1HHKB 2PYFA 1FNEB 4QLRA 5CP3H 3PGDB 4GG6F 3JUYA 3UTSB 4XCEA 3ULVF 1CICD 2XKSA 5DUMH 3HUJF 4OT1H 3E6HA 2IAMB 3VXNA 4JRXA 4K2UH 3IDNA 1Q9LA 3UXFA 4LSTL 1EO7A 5IW1A 3G9AB 4X80L 4GS7C 3LOWA 3QDHA 5T3ZH 2B1HH 4OZHA 1KPUA 4KV5E 4Y0GA 2C1OB 1CF8H 1PYWB 5DEGA 3WXVL 4N5UA 1WZLA 2CD0A 4QYOA 1IFHH 5JLZB 1P4IH 2WNGA 2DLFL 5H37H 3QDGE 5JW5A 4R7NB 4MA3A 3FB6B 3STZA 2GW5A 4U4BA 4HT1L 2PXYC 1ZEAL 4AG4L 2WUBL 3HS0B 4M7ZC 5D7KE 4I9WE 1ED3B 2LQRA 4NUJA 3GMQA 4PV8A 4XVTL 4TRPL 5IROC 2P43B 4C56E 3LRSB 3FQRB 1Q9WA 1FG2B 4YZFE 4QRQB 3GRWL 5T3ZE 3WN5B 4M93B 1QSEB 2UWEA 3PQYE 2OSLB 4IRJB 1FNHA 4QXGH 1O5DT 4WV1B 3ALXA 3DX9A 2L4OA 3FFDB 3DVIA 1IEBA 3NIDF 5B38A 4GKNB 1PBYA 3TJEL 1AFVL 1U93A 1A1NA 4ZPVA 4LVOB 1MWAH 5HHOE 3UTTE 3RL1B 4NBZB 1GOHA 5ISZB 2ED8A 2E9IA 2DQCH 3T0WA 2BOCB 1RIHL 3BAEL 5T1KB 4ZTOL 4I77L 1VGEL 3LHPL 3MJ7A 3UAJC 12E8H 3CDFA 4YXLL 3AM8C 1AQDB 5DI8B 5IVXE 1UB5A 1Q72L 3OGOE 3EYUL 4D8PB 1P6FA 5HSFA 2V5RA 3QNZA 5H94B 3BDXA 3BUYB 1N5AB 1P4LB 3MACH 5I76A 4OCRL 4XVSL 3U7YL 1OAKL 3MV9E 5F9JB 3ARBB 4L8BB 2CMRH 4WI4A 5K33A 1LO0L 5DI8A 5BV7B 3H3PL 4Z7QE 4N90D 1CGUA 4PRID 1JPFB 5CBEB 5K59F 1I8KB 1R5IA 4YXHL 1I1CA 3S88L 2BSSB 1MRDH 3UBXG 12E8L 3WLWD 2ZNWA 5FKAB 4HZLA 4F33B 3QPQD 4XXCC 3G6AB 4TSCH 4PGBA 2YK1L 1TETL 1PLGH 1X4ZA 2ZJSL 5ANME 1MCDA 4IRJA 5F70A 5DR5L 1R5IB 3UJJH 3TT1L 4TNWF 4APQC 4LLQA 1T7WA 3RKPA 2IGFL 3IFPA 3VI3F 2WBJC 5J6HA 4MWFA 4FABH 1TPXB 1VFOA 1ZS8A 2EDOA 1HE7A 2EIBA 4KV5F 3FL7A 2G5BA 3D85D 4RFOL 5E6ID 4WTZA 1NANI 3ZT7A 1NCTA 5IB3A 1K4CB 5F1KC 1G9NC 2C3WA 4OZIF 3VXRE 1QSFD 3S37L 3H0TB 3FB6A 2JCCE 3RWGA 1RHFA 4OI7A 2PF6A 3ZTJG 3BZ4B 3MJ6A 5J0BA 5CZXC 3EDKA 3L7EB 1JN6A 3FJTA 32C2A 3WCYA 4M00A 4PG9A 2UWEF 4POUB 3RX5A 5I19L 5E9DB 3A67H 2Y4SA 1KGCD 1OD7A 4GXVH 4KMQA 1TXKA 4EQ2A 1X5KA 1G6RL 1WQVT 4UI2A 4FQJL 4WW2C 3RDTC 2X4TA 1KENH 1NAML 1H3WM 1U8HA 1ZA3B 2R0KH 4L3EB 2DLIA 1IEAA 2ESVD 2Q20A 4K7PX 4IRSA 3HPJB 5A16A 3DMMA 2FX8H 5KVEL 3BPCB 4QRPB 4XPBH 3LEVH 2Q8BH 1KNOA 5E2TL 2FEDD 5SX4I 2Z9TA 2A77H 4X6BA 3VRLF 2EDLA 4KJPD 1U8IB 5L2KA 2E7BA 3MPCA 1KPRA 4JRYB 2NR6C 5CJ8A 1J88A 2DIJA 5L2JB 1A6VH 4IDJL 3CLEL 4MGXA 1V5JA 5EULV 2Z31B 4D0DB 1A7RH 4LCCB 3HC3H 1A02N 4M7ZB 2R29L 1HKFA 3TO2B 4XBEL 5J11C 3PUCA 2HFFA 2IJ0C 4Y2DA 1IKNC 5C0IB 2ORBH 4EUPA 4X6EB 3OAUH 1N6UA 3X13A 4KGJA 1BQHB 5FV1L 2BHZA 4CL7A 3KGRA 1GSMA 4M7LH 3MXVH 4NRXB 5HDQH 3KLHC 5IEHA 2D7PA 1R3JA 4ERSL 4LSUH 5HHOB 3MLTB 4NQDA 2EIEA 2IC2A 1TZGL 1AGCB 1C1EL 4X5WA 4FQXB 4GUPA 4D0CA 5ESVA 3DPBA 5F93C 2D03H 2I9LB 3OAUL 4ELME 3QG7L 4BQ6A 1ZT7A 2GQHA 1NGZA 1MRFL 3SE9L 5F1IA 2WBKA 3QB7C 1BFSA 2LVCA 4JFZL 5J89A 4J2XA 1I9RH 2CIKA 3EJZC 3K46A 3PHQB 4P3DB 1MCCA 3VJ6A 3CSGA 3RUGE 4KKAD 1KCUH 2HT4C 3L1OL 3FRUB 4XVJH 5F88B 5I1CL 4JB9H 1RZJH 2CKBL 3O6LL 3D1MC 4QKXB 2VJXA 1EFXB 2Y25A 3PGFL 1CDCA 5JPMB 1QTYT 5DDHA 3F7VA 1N7MH 3T0AA 2GTZA 1IGCH 4LPYA 4YEEA 4ZFOA 3CVHL 4G43B 1S7WB 4OZ4A 4Z95H 2X2YA 2B0SH 4OFYD 1N8ZA 4PRHE 1U91A 4HJ0C 4BKLB 1IGIL 3QIUD 4F9LA 4JFFB 4PJCF 1BFVH 3RWFB 1AC6A 2ESVB 3TH4T 5D2LF 1Z0NA 2QHLA 1U9KA 1OSZB 4HPYL 4X6BB 5I71B 1N0XL 1HK6A 2P8PA 5D1XB 2MMXA 2V7NB 1AXIB 4PRDB 4WTXA 4AK1A 3WE6B 1FYTA 1PKQB 3D39B 3VG0H 4K8RD 2DMBA 2J5LC 3AFLA 1F00I 2HT2C 1BWMA 1Q94A 2YN3A 4HKXA 2NW3A 5ICYB 4MQ7B 5C07D 4NO3B 3ILPB 2HLAB 4ZODA 5MHSD 5L88L 1GIGL 3NA4A 4W81A 2QQKL 4MLSA 5LQBH 4UQ2A 3KLHD 1JPSH 4IRZH 5J9PA 4WUUD 3O8XA 5E03A 4ZOEA 4I3GA 2LFGA 1JHKH 3JWDL 2HFGH 4WWKD 4HUMB 4S0TD 2FSEA 2YHGA 1R5WA 3OXRB 2EXYD 2V5MA 5DZOA 1X44A 3WNKA 1ADQL 4LHUB 3BGMB 1D9KB 3QQNA 3JWDC 1WAAA 3HR5A 4XBPA 4L3CB 4PJIF 1GAFH 1B9ZA 1F4WL 3HR6A 4LHUD 4PB0H 5DDHB 1IZJA 2FO4A 3PF2A 4H0GA 5JORA 3KPSA 1AGBA 5IQ7H 4Z7UE 3BHBB 3SOBL 1YPZA 1DBJL 2A9ML 4PJBB 5GRYA 4DGIL 2EZ0C 3MRFB 4H88L 3C8DA 4NYLA 1ROWA 3VMNA 1A4KA 1HSBA 2APBA 4KKLC 4UTAL 5DEFB 1BF8A 1WC7B 1V3KA 3O4LA 4Y2DD 4C56B 2OTUB 4J6RH 1XGTB 2PO6C 3G08A 4R7DA 4O02H 4BYHA 3GMPA 4YFDB 5E5RB 4UIKL 3TZVB 1J86A 2ATPA 5I8EB 3NBNA 1NAMA 4K23L 4G9DB 2JKXA 4PTUA 3BKCL 3OSKA 3WHXA 4P2OA 4Y4FD 1FH5L 4YHKH 1KTLB 5FHBL 1WCBB 2WINA 4TPRH 1I1YB 1LD9A 2CLZB 1LO2H 5EORL 5C7XL 3PWUB 4LLVA 2CK2A 5JNYB 1CICB 4OQTH 2OTWA 4X98A 1CLCA 3RPKA 4G43A 4ORZC 5GGQH 1BOGB 1R24B 5I16B 1ERNA 3R8QA 3QDJE 4KVNH 4UB0L 4OFIA 3U0PB 4P5KA 4M1GL 3D2UA 4HZAA 4TUJB 3MUGB 1ZAGA 2F5AH 2XKNA 1OAQL 4PREB 3RX7A 4X6FA 4OUUA 3VG9B 5GS0D 4JFFD 2DQTL 4P46B 4LCWE 1C7SA 1UH4A 4JR9L 4UUJA 2DI9A 4GBXA 2ATKA 4P5MA 1NCCH 3DO3A 4YX2L 4AEHH 1T5XB 4Z8FL 1A6PA 1UA6L 5DA0B 2D0HA 4DFHA 2FJHA 3TJHC 3GI8H 2GY7B 1T2QL 4OF8A 4CMHC 3NIFE 4N9GB 4UUJB 4N8PA 2NX5D 3MLTA 2ITDB 4NQDB 5KZCB 1M7DB 3T04D 3UX9B 5B38G 3HS0A 2JELL 4NPYB 4WFED 2XNAB 3NCYP 1X5JA 5HYIA 1WBYB 1T3FB 1N2RA 5GSRA 1U36A 1QR1B 3WD5H 2AV1B 4PLJC 2QADD 5F3BA 3O3DA 1Y0LB 4GG6E 2J1KA 1CTNA 1YMMB 3EOAA 1MHCB 2NZ9D 2P24B 1MI5E 4ONFL 4U6YA 4KU1A 2GYSA 3QUKA 1Q0XH 3C6LB 2JIXB 1NDMB 4OLVH 5DJ8B 3DI2B 2X89D 4PRBA 3CSBA 4HXBL 1FCCA 2Q1EA 4LSDA 4MNQE 1WBYA 1MVUB 2EYRA 2GT9A 4L9LC 1QFWL 3RWIB 1I3RA 4N5ED 2ICEA 4XCYA 5SV4A 3IAPA 4YBQD 3KPQB 1I7ZB 5DQ9A 4WFFE 4FQHA 2E27H 5DD6A 3OJ2C 5CCKL 3VRIA 2DM4A 2G5BB 4JPVL 3SKOA 3U4BH 3E6FA 4ZS6D 7FABL 2FIKA 2UZXB 4OCWL 4NKDB 3CSYA 1A3RH 5C0RL 1E6JL 4UDTB 3CNKA 1F58H 1S7SB 1HHJA 1NCBH 4BM7A 1NGPL 4NZUH 3QNXB 1OM3H 4P4KA 4QXTB 3L95B 4GQ9H 3ULSB 2D31A 4JN1H 4PJGB 3TO4C 1A5FL 3S5LB 4Q97A 5K93A 5E9DA 1MCFA 3SDYL 3FO0L 4LRNH 4OZFH 3U46A 2ICWB 4RISL 5C3LD 1OOAA 2QSCH 3I84A 4DZBB 4R3SB 3B2VL 4W4NA 3QI9A 2F15A 3QHZH 3B5HA 4F57H 1FGVL 4OSUH 3GK8H 4HXAH 5EZLB 2L7JA 2RAMA 2O5XL 2NLJA 3U2SB 3SY0B 3BKJL 3EDDA 1I4FA 4PJHB 1MVFA 2IBBA 2Z93A 1NAMB 3ARBD 1Z5LB 3GSRA 5CJOL 4L8CA 2AJSL 2QADC 4P0DA 4ODTH 3SO3C 3HE6A 1RUML 1NC4B 2FR4B 3CDGA 1KG0A 2R2HA 4O58H 3LQZA 3GM8A 2XPGA 1D9KC 3OKKB 1NC4D 1OPGL 3VXPA 3VD4A 2VLKD 4BUGA 1E4XH 1RJCA 1U8QA 1DDHB 1TITA 2CXKA 2H8PA 3TWCL 5MENB 5C09A 4U33A 4R97C 2DQJH 1WZKA 2XWJB 2CIIB 1YQVH 1IL1A 2W07A 1EVTC 3B9KA 5A43C 1MHHA 4XP5H 3PWVB 2HKHL 1C5CL 4U1NB 4X4YA 5DMIH 1WZMA 1TTUA 3RA7H 1J9CT 2A6DB 5F9WC 5CIPB 2VZUA 3RWHA 3SJVA 1NBQA 1QYGH 2DKMA 2X5PA 4PV9A 3LHPH 4KMTH 4DEPB 2ICWA 1EEZA 4P3WA 2P8LB 1I8LC 1BEYH 3RL2A 1Q72H 4LAQL 3VFMA 5EIQA 1IL1B 1M7IB 1KV3A 5D2NB 5EU7C 3LN5A 3QA3A 3U0TB 3EO0A 4WUUA 3IS0X 1AXTH 4ZAKB 3B8YA 4JRXD 5CILL 1DBAH 4K55A 1YQ2A 3A6CL 3HMXA 1PYWA 2ESVE 3FO1B 1OD9A 3ZDXE 2X4OA 1MIML 4JHWL 1I7TB 4LOUC 3QUMH 5GSRB 1NQBA 3VXUD 2A6JA 1KXTB 4P23D 3DUHA 3GSUA 1A6UH 1XIWB 2BHYA 2IPUG 2BNRA 2E6JA 2OLDA 2XWBA 4U1MB 3TH2T 2CRYA 2N7BA 1NMAH 1F90L 2E9JA 3QFDB 5KTEH 3U9UA 5AUMB 2OP4H 1N5AA 5IG7A 2C4XA 3QO1A 3NABH 5J4MA 4PV8B 3EYSL 5HDBF 1KCUL 3L1OH 2IANB 1GZQA 3VRLE 4XVTH 3C5JA 1EGJA 2NXYD 1T7ZA 1KJ3L 5EBMA 4MMZC 4GRWE 4XNYH 4TNVF 4H1LA 1CLOH 2QR0B 4RWHA 4JPVH 2BSRB 4LU5L 3WFCH 4NJAL 2VC2H 4ZPTA 7FABH 3I75A 1GGBH 1YNLL 1BOYA 5I0DA 4ZDHB 3RL1A 2FEDC 2BJML 2EE3A 1YEGL 1NCBL 1ACYH 4K8RL 4DK6A 3QCTL 3OR6A 3MXWL 6FABL 2XZQL 2F53D 2APTA 2GITA 3O45B 2NR6D 3OKNB 4G6JL 3MLSL 3QUZB 4HLZH 1TVBB 5D7IB 3VA6A 1QSZA 1HZHH 1CT8A 1JF5A 3KS0H 3MX0A 1Q9WB 1VENA 5D4QA 4ZUTB 3LRHA 3HI6H 3K2UH 2OJZH 2VC2L 2LTQC 1X9QA 4PJ8A 1CL7I 3VFTA 1IAOB 4DOHE 5FM5O 4DK3A 2R2EB 2FD6L 1Y6KR 5JTWA 4YAQB 2JE8A 1OF2B 4DTGH 4XGZA 1U8NA 3H7BB 4ISVB 2KKQA 4G6JH 4JO1L 4Y16C 3CLEH 4L8SC 1A6AA 3HC3L 5C0IA 1MWAB 1KB5A 2W9EL 2IBZX 3B9EA 4XBEH 3DROB 3HMWL 3CH8A 3IDYB 4K7PL 2R4RL 5JIIA 3FO9B 2Y06H 2C4FU 1C08A 3F65A 3OL2A 2NXZB 3IDIA 4KKCD 4NC1E 2FRGP 4TUOB 1G7QB 1ZKAA 5HHQA 4J4PC 3RIFF 3MMEA 4CAGA 2J8HA 1ONQB 4S2SB 4JFFE 3KYOB 1I8MA 3WSQL 4OUOA 2OR9H 3N85L 5C3TA 5HI5D 3MV7B 3SJVD 5KAQG 2ARJB 4WNQA 2NY0C 4RAUB 5IVZB 1U95A 5FB8A 2GITB 3O45A 4ODWA 4DKFL 5D1XD 4LEOA 3TBVA 2AQ1A 4CN4A 1QFWM 2AEQL 4LKXB 4PJCE 1BM3L 1RIVH 4NKIH 2LABA 1FLRH 5FKAA 2CDGA 1FE8L 4G9FD 1WV7T 2YSSA 1UJ3C 4Z76A 4QHKJ 3OXSB 3LQZB 5FYKH 3WKNA 2DYPA 5I8CB 2IEPA 3BWAB 3FO2B 2AJZA 1UCBL 3U0PA 4WUUB 4KK9C 3OAZK 2PO6D 5IMMA 4QOKD 1U8LA 3DSNA 4PGCB 4XVSH 3LSOB 3NAAL 1EAPB 2QHRH 1F3RB 2Z35A 4NQCB 1FBIH 1WF5A 1MI5D 2VR5A 4X7DC 1N64L 2BFVH 1LVEA 4TYUA 2PKDA 3CCHA 2P47B 1TCRB 1D5ZB 5JHDD 2GY5A 3S88H 3DRQA 3FMGL 2EICA 3IJYB 4XP1L 1FPTL 3G5XA 4RWYL 4P4KD 5CSZB 3H7LA 2VDPH 3CLFL 1U42A 1KC5H 1WBZA 3PWLA 4X9FA 1CLYH 4HUWA 3O3AA 1I85C 4I48A 1INDH 5F7KC 4C4KT 4M5YL 2VDQL 3EDEA 1BIIB 4LP4A 4J1UB 1PKQA 4KFZC 2VN4A 1XF3B 1JZ4A 4LHUG 1UXWB 5CUSH 1W72B 4CRPA 4X8JB 3QDGA 1MQKH 5ADOL 1QOKA 3EYUH 3IJSB 1RFDH 1VFAB 4B41A 5CWSB 4CJ0A 3HE7A 1KYOK 4ODTL 1R5VA 1AJ7H 4F58L 3CUPA 3OKLB 2FYYB 2A6KA 5IB2B 4RRPA 4DZ8B 4QRQA 2EDEA 3TNNA 4IRZL 3H0TA 5FO8B 1CG9A 3BVNB 1KCLA 2EDWA 5IB5A 1VA9A 4ZNEA 5I73B 4ODHH 2IAMD 2VXQH 3MRDB 3ARDD 3ZYIA 3O6FB 4P9HL 15C8H 4I4WB 2BSTA 5EN2B 3VH8B 1DQML 4LLDA 1V7NL 3IDXL 4ZXBC 4YHMH 2VNCA 3MRRB 4NIKB 3RDTA 1YEHL 5J8OA 2DL2A 1YMMD 5KSVB 5HHMB 4MAYA 3RWEB 4Y5XC 1Q9OB 4PLJD 4M6NH 3PHQA 4WCYH 3C09B 1FRGL 4ZS7L 4XP9H 3T3MF 3MRPA 1WISA 4ZAKD 5IP4A 4HULB 2EIZA 1T83C 1CGVA 4ZYKA 3PWLB 1UKSA 4WFGD 3CSYB 1CF8L 3MRHB 3H9ZA 1YUHA 4UV7H 4Q0XH 3MRJB 4AH2B 3MYJB 1L0YA 1MFBL 4F8TA 2N1KA 3HMWH 4BQBA 5E1HB 1KPRB 4X5XA 1U91B 2HMID 4FXLA 5BRZB 3OKNA 4M7KH 3IDJA 1YJDL 3FO9A 4GLRI 4OB5L 4KRLB 1UZ8B 4XWOC 3QI9B 3DWTA 4YEFA 5D7JA 3IRZA 3AXLA 4MJ5A 4BJLA 1BWWA 1JVKA 4HG4J 5DK0A 4EDWH 3VJ6B 3QEQB 1UCTA 3NPSC 4NKDA 3ZDZF 1J8KA 3KXFE 1F3DH 4I5BB 5EA0L 4JFXA 2YPLE 3OKDB 2VUYA 1CFNA 5D9SA 4DWHA 3GJEB 3CFKB 1OAQH 4K7PH 1T5WA 3S96A 5FFLA 1E28B 3IF1A 2YD9A 5A2LH 4WU7A 5IBLC 5CINL 4JFOB 4P2YA 5ALCL 4PLNC 3SKMB 4WGWB 2HG5A 1A7OL 5DJ0B 3RVUD 4F7EA 4JR9H 4WO4D 4ZO8A 5IR1B 4JZOB 3VXUB 3U0WL 3MNVB 4Z7VE 5IMOA 1KTDA 4QT5B 3TEUA 2P8MA 3C08H 3WS3A 3G9VA 2N7AA 5BMFL 4J8RB 4BFIA 3M07A 1WZ1H 2Q6WB 4W6XB 4ZO6A 1UZ6F 3B5GA 3FQUA 4LASL 4Y1AE 4YBLB 4OV5B 3S35H 4KZDL 3JVGA 2AV1A 5EO9A 1YN7B 4FXGA 4KK6C 4NQCD 2ICWI 2AJYL 4LGSB 4TQEH 5IHZA 3FQNA 1TJIL 1GGCH 4X7SL 2BOBB 3AU1A 2HN7A 2K1MA 3RTQA 5D7JB 4NKMB 1G1CA 4U2YA 1CVSC 1AP2B 1AO7E 1U3ZA 3U7WL 4AMKL 2XZCL 3JWOL 3DX8B 4QTHA 1I9JL 1J87A 1SEQH 3A6CH 2W65B 1NGYB 4FG6D 4KTEL 4Y19A 2YRLA 3HE7B 3S3JA 4F7TB 2A6JB 4HV8B 1Q8MA 2DL9A 5I75C 4LHJB 4FS0A 1XR8B 1MHEB 1C5DB 2YOCA 1MAML 3L3GB 5EORH 5C7XH 2VXQL 4LGRB 4CVXB 1E6OL 1YEIH 43C9B 5CKAA 4N8CH 4JFHD 3OR7B 4MB4A 4Z9KB 4YHNB 2A9NL 3QFJA 4HWZA 4PJBF 2PXYD 2H32B 1ZA3A 3FAWA 3VFPB 4ESKA 3HE6B 3K7UA 3JVGC 1A7NL 2VL5B 4P9ML 3T4YB 4DOHB 4WCYL 1NGXB 1RMFL 1IZKA 5HJ3A 3UEZA 5IW3A 1RUAH 3MOBL 2YWYA 5ESQA 4XWGH 2VZTA 4NNXA 1REIA 3ARBC 3QCVH 4O2CB 5EUOE 3HR5B 1P4LA 4NM4L 3E0GA 3VXRD 4OLYL 3FQXB 4U6HB 2GJ6D 1T89A 2DQEH 2DD8L 5CEXB 4NQDE 3FT4B 1HINL 4WW2B 2VTFA 4TN9A 5C0AE 1JWSA 2JJWA 2VDNH 1A7PL 5FGBC 2OZ4H 3L5XH 3W81A 4Q6IB 5D7LD 4IS6A 1OP5H 2WLYA 5BVJB 1LEIB 2PTUA 1BX2A 2JB5H 4I3SL 1HSBB 3DXAA 1H3PH 3EW3B 2FGZA 1S7SA 3RUGA 1K9TA 3MOBH 1KG0B 2X4NA 1G7HA 4MA1B 5JPNA 3MRMB 1OQOA 5AYQA 2F8XC 1Q1JL 4IS6B 1ZTXL 1OTSD 3QIWA 3B9AA 4E0RA 4FNLH 4MMXC 3QULA 1NEZA 4JDTH 3V4PL 3ARRA 4I0PB 5F3HB 4B7IA 4QRSA 3TV3L 2VDNL 1ZEAH 1F3DJ 5LGJA 1R3HA 5J12B 3ARQA 5K9KA 3LS4L 4JPKL 4UT9H 4WUKL 3ETBF 1QVOB 1RJLA 3BD3A 3QPQC 3GIZH 4MSWB 1F2QA 1A1OA 3SDAA 3WJJC 3SPVA 5B4MC 4KJPC 3LQMA 2IH1A 3H9SB 2W0LA 5B8CA 2DLHA 5IJVA 5CLTA 2QQNH 2R15A 2BOCA 5DEGB 3OBAA 4S1QL 3QDGD 2WBJD 5F9DC 3SDXF 1OL0A 5J9PB 3TESA 3O3DB 4IJ3C 4MB5A 4HWBA 3MRLB 2FECL 3RRQA 1EFXD 1HHGA 3MCG1 1U3HB 1I9RL 3OJDB 3D48R 4RMVA 4A6YB 3E2HB 2CRIA 5JA9A 4M43L 4AG4H 4RGMB 5E7BA 2Z8VC 4PJBE 1FDLL 5IBUB 1MIEH 4NQXB 4G8FA 4Y2OA 3MUJA 5DGRA 4JKLA 5EU3A 4XPGL 1CFNB 1IM3B 4HF5H 3KHOA 5CINH 5LGHL 2R0LH 2GUOB 3OR6B 4PY8I 1T0NB 1I7RB 2B0SL 2XT1B 1U8LB 4JDZB 4A6YA 1ZLWK 1JK8B 2L7UA 5DK3A 1DSFL 5EFIA 4BFGA 5JIHA 4FXKA 4LMQE 1H15B 1WAAE 3PDOB 5DUPH 3FT2B 5F71A 5MENE 1U8HB 4L3EA 1U8MB 4M6AA 3FB8A 1M71A 1N3NB 3J8F7 4QXTA 1RUPL 2FBOJ 4QF1A 3ULSA 3DETC 2K9UA 3MO1B 1RZKC 5GJTH 3B4NA 3U6RA 1HDMB 1JNNL 4BSWA 1ES0B 2BVEA 1UA6H 4XNYL 3K74B 3MV11 4Z7OE 4TVPL 4XCEB 1BMGA 4OCSH 4Z7QF 4WW2F 3SN6N 1NC2D 4CN6A 2XY1A 5DJAB 3BZEB 1BZ9B 5T3ZD 4JHZA 2EKSB 4EBQH 4S1SL 4F15B 4P46D 5IVXA 1X5IA 4X6DF 4ZFFB 1FJ1B 3GGWA 1WVZA 4JQVC 3JWNC 4OZHE 3THMH 1SJEA 3FN9A 4NQSB 5F96H 4J3XA 4F7PA 1BIHA 5BS0E 4BSWB 5HHNA 3C2SA 3G5VA 4R96A 4P4KC 1MLCA 3GMRA 5C9JB 4LFHG 5F1NB 3RIFK 4EIZC 3WMSA 1JPGB 3EAKA 4QXWA 3RGHA 2C26A 3DIFA 3EKCA 3EO0B 3FOMA 1IEAB 5FOJA 3I3DA 4ONGL 1R3KA 4KH2A 2FH8A 2XA8H 3VWKC 2WIIA 4NZTL 1QNZL 1RZ8A 5E08L 1UWEH 4Q6IA 5D8JH 4XMKH 4QOKE 5C08A 4XCNA 1PQZA 3CH1A 5CILH 2QEJA 3PDOA 3VXTB 3VFOA 5T1KD 5AZ2H 4JKPL 4PJ8C 3A6BH 4ODXA 2UWEE 1TMCB 4TUKL 3QFDA 4P2OB 5E95B 2NMSA 4JQIL 1ZLWH 2BVTA 2WBWB 4G8EB 1R5VB 1UB6B 3ZKND 1F6FB 3ES6A 4Z7VB 5BO1L 4I2XA 1I3VA 3ARDC 3MJ9H 1HXYA 4OD2B 4OIAA 4RBPH 3FAXA 1FG9C 5GS1C 3QEHB 3TWCH 3QRGH 1SYSA 2HH0H 5AWNL 2VDKL 2G60L 2DQGL 3VD3A 1CLZH 5J13B 1W72H 4XPHL 5ID1B 1RZGB 1MCSA 1VCAA 1HQ4A 2XN9E 3MCLL 4CU7A 2VITA 2NY6D 2WP3T 4UBDC 4H1LB 4NJ9L 3PL6B 1UACH 3TA3A 3OMZA 4CGTA 3DXAB 4KUZH 1N5YL 1D6EB 4MAYB 1KCSL 1KIQB 5C0BE 1PFCA 5FCUL 1NFDF 5JHLL 2WUCL 5CBEA 2XFXA 3ARBA 4OZGB 4APQA 3CVIH 1LO3H 3LEXB 5DC0A 2AVGA 1IGFL 4OJFH 2OR7A 2X10A 3MNZA 5L9DH 4LSVH 1YEFL 5F9OL 2X09A 2DMKA 1CK0H 3LKQB 5E4IA 1JV5B 5SWZB 3O8XC 1RUMH 4XCFL 1W72L 4XPHH 1MCIA 3G6DH 3RVXD 2XFXB 3BUTA 2FYYA 5JW5B 4U1JB 3BOVA 4G80A 4QEGA 1EEQA 3IFLH 1SEBB 1T03L 4JG1L 4UOW1 1I9EA 4KAQL 1ZT1B 3X17A 1DUYA 4YHYB 4KJQD 2HLAA 5IOPB 4XTRC 3S5LA 4FZEH 2X4OB 2IFGA 4XWGL 1RJZA 3V9FA 1XCQA 1WCQA 3FQTA 5CJQH 3REVA 3OQ3B 1JWMA 1DTUA 5GGTH 1G7JB 2A73B 3IETA 1D6VH 1NEZG 2XTLA 2NZIA 3E3QC 4HEME 5IFHL 5EZJB 1CFSA 1T04A 3ARTA 4JFEE 3BP7A 3AS0A 1MWAL 2I26N 4CUCA 1J5OH 3G6JF 2GI7A 4FQXA 4U6TA 3KYOA 3RGVB 2DLGA 3P0GB 2IMNA 4PIRF 5DT1H 5KAQF 4Z7NE 1NUGA 3UTPE 3RTQB 1QBLH 4AIZB 3CFKA 2VSCA 4CVUA 3P0YH 1H8OA 3QEUB 1H8SA 5DC9B 1KOAA 2FJFA 1EO8L 2ZKHL 3ZZ1A 2CRMA 4Z7WA 3TBTB 4PRAB 3B9VA 1EK3A 2OR9L 3SKJL 3TBYA 2Q7YA 3BIKB 5CCKH 1QA9B 5E99L 2GEEA 1IAIL 5HHME 2YSSB 2GJ6B 2BERA 4JY6A 3IYLW 2GHWB 3OXSA 1NGQL 2VUOA 1VGKA 4KHXH 4G9FA 3M17B 3O6LH 2X42A 1C5DA 2ZUQB 4L1DA 4NZUL 5D1ZA 1BM3H 1RIVL 4NKIL 4XNMB 4FP8H 1B0WA 1Q9LB 3QP3A 1Y18A 1U3HD 5E94A 3F58L 5LWYH 4WWKA 4NZRH 5AAMA 3HI6L 4LLUB 4KI1A 1UQSA 4AENA 1A3QA 2R1YA 2F9BT 4F37F 4ZUTA 2X1QA 4MA7L 2D9QB 3QR2A 1ONQA 2NTFB 3DNKA 5EZLA 2VZ3A 4RGNC 4S1SH 1RY7B 4RGOH 4LVNB 4D94A 3MA9L 5A2KH 4RAVB 3HZVB 4FQ1H 1LMKA 4QRRD 3LKRB 4JCLA 3IF1B 1E28A 1WIUA 1T83A 3BPLB 3STZB 4IRSB 4JE4B 2PCPA 2VXTL 3DECA 3DUSB 2B20A 4NJAH 1K2DB 4RGNE 5CMAA 3T65A 1MAKA 1GOFA 2C9AA 2YPLA 5FYLD 1FP5A 1CS6A 3V8OA 1LWRA 1H9VA 5LWYL 4GH7B 5DUBB 1W0WA 1A6ZB 1DFBH 3DVNA 1H0DB 3RTQC 1M05B 1SY6L 5AYUL 3MXWH 1DQQA 2ARWA 4RAVA 4HX1A 1JN6B 5LKNA 1JGUH 2DOCA 2YPLB 2C1PB 1PY9A 4XMLH 4PRHD 3ZTJH 4FQJH 4DGVH 5DD1H 3SE3C 4ELMA 3DGGB 1CG9B 1SBSH 3K2UL 1EGJL 5HPOA 4D9LH 5CLWA 5E8PB 3S5LG 3DYOA 1T5WB 3S96B 5GS3A 4H25A 3F7YA 2NY1C 4OIBA 4G8GA 4I3RL 3QDJA 2Z91A 4OQTL 2ZOKB 4JO3H 4R2GB 1DBMH 4G9FE 3F62A 3HB3D 4LLUA 3PP3K 5C07E 5I18H 4XRCB 3KJ4C 4YR6A 3W0WE 2YEZA 3TBSB 4PJEA 4C56A 1X5GA 4X4XB 2DWEA 2Y36L 5KSAC 3NZHL 4Y19E 1D5IH 1AXTL 1TQBB 3O6KH 4MXVF 1ZANH 2OMBA 5T1LD 3WDIA 3QQ3B 3CXDH 4G6KL 5ERWB 1UXSA 1UM5H 3K81A 5IKCA 5C8JB 2LU7A 3QXVA 3CFCL 4JJ5B 4WHCA 4JFEB 3BI9X 4LP5A 3VFRB 4UU9A 3OKLA 3OJVC 5JNYA 3ARPA 2CUIA 3T0BA 4H8WL 1JTTA 2Y07L 4K7PY 1CFSB 1T04B 3VWKB 1TJHH 4XVUC 5HJ3B 4UQ3B 1M4KA 4MWFB 2OS7A 4PJ9B 3S8WA 2F8VA 3QWOA 5EUOF 4ZNEE 2VB5A 1XR9A 2X9WA 3DURB 1AGDB 3VXMB 5HHXL 5TDPB 4HJGB 4Q2ZA 3PJSB 5FECB 4X7EC 3QWOB 1WWWX 3HN3A 5SWSA 2AS5M 5KSBE 2F53B 5ANMB 3GRWA 4CADB 4HPYH 2XTJE 4MD4B 2YC1B 5C0FA 4ETYA 5FOBA 4K3EL 4OLWH 2Z31C 3KPSB 5D1ZD 4HK0A 3BDBA 5BV7C 3HAEA 4V1DB 5I66A 1U6AL 2Q76A 1D5ZA 3K3QA 4HGWA 3QDMD 1HEZA 4XB8A 3KPRA 1ND0A 4XB7A 3I02B 2VDPL 3HB3C 2CJUL 1DP0A 5D2LB 3V6OC 1NBVH 1J1OH 1F2XK 4P57A 3MV01 2W0FB 2YC1A 1RZFH 3D85B 3WIFA 5JW4N 3GMPB 3O4LE 3V0VA 4X6CB 3QQ4A 5IEKB 2PR4L 2X7LA 1PZ5A 4WU5B 3DUUA 3FO2A 3LD8B 1QSFB 43C9A 4N8VA 1JGVH 3H42H 2BVQA 3L3JA 5EU6D 2AAVA 3ULUH 3W5MA 3AAZB 3CU1A 3UC0L 3T09A 5BMFH 1JCKA 4PJFE 3NTCL 4Y4HD 1AIFA 2Q3AA 4HMEA 1ZT4A 3JV6A 3U9PH 3VXQB 1OSZA 4JHAH 5E9DD 4KUCD 2AXHA 4KVCH 4LSRH 1K85A 1JZ7A 1AC0A 3ZO0A 4J3TA 1SJHA 4G3YH 5E2WL 4PJ5A 4OFVA 2WP3O 3S4SB 4OIIH 4YDVA 4F7MA 1QACA 1AR2A 3BKMH 3MODL 2Z93B 3GSRB 4JQVA 4X7SH 4JFOA 4MA1C 5I9QB 2EDTA 5FEBA 4IIQB 4M8QA 3T1FB 1FV1B 2EDBA 2HJKB 3PQYB 4JJ5A 2I07B 4JREB 1KN2H 1SBSL 4F3FB 2R4SL 2C5DC 5F8RC 3LQAH 5DJ2B 1T22B 4Y16A 4YNYA 4YBLC 3LAFA 4XC1H 3MGAA 1FL3B 1GH7A 4NFBA 5DK0B 5B39A 4LCWA 5T5NG 4ONHA 2R0ZL 5E8DH 3C6SB 3PP4L 5HYSB 3EFFA 3EIFA 4HH8A 1A5FH 1ITBB 4JQIH 4M6ML 4XNZB 4PGJA 2BRQA 4MJIA 4M48L 4Y16B 2EYSB 2OL3L 5EU5A 1I3GH 3HC0B 3QEHA 2P4AB 4EOWH 2E9BA 2ZSVA 4KPHH 3GNML 5DRWA 5HVFB 1RVFH 2HLFD 3WD5L 1MJ7L 1TVHB 3KPLA 5GGSB 5L2JA 4N0CD 1RZKH 4GG8B 1IGYA 3KYNA 1EX0A 2OX5A 4DAGL 4S1RL 1HILB 2X4UB 3MLPA 4XC1L 1KEML 2V2XA 5M7QA 2MJWA 1KJMA 1QD0A 1AO7A 1BECA 4NQXA 5E7FA 1MCHA 2I27N 4KKCC 3DGGA 2DQTH 2YA2A 1EHAA 5CHNB 5KS9A 4KXZH 1J1PL 4OGYH 4Z0BH 1S9WA 1KJVA 2JB6A 3JTSA 4GXUN 3RGVD 5BZWB 2AJYH 4OZHF 4UIMA 2MQCA 4HFWB 3H7BA 4ISVA 1B0RB 2GTWB 4LLWA 3QDAA 1IGML 3OKEA 3U4EA 4MA8H 2X4QB 1CXIA 1CGYA 1DSFH 3MV9B 2YMXL 1GHFL 4M61A 1MLCB 4WENB 4HCRA 5E0QA 1F42A 3JTSB 4L8DA 4I18C 4WY7L 3HI1A 1I7UA 3OX8B 3NCJH 4JY5L 5C0CA 4R4FH 3QFJE 4XT1C 3RNQB 1DQJB 3QO1B 4PJHF 5ILTH 4MQXC 2F5AL 3RWJA 4BK4A