1IFHL

A detailed analysis of the free and bound conformation of an antibody: x-ray structures of anti-peptide fab 17(slash)9 and three different fab-peptide complexes
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
217
structure length
217
Chain Sequence
b'DIVMTQSPSSLTVTAGEKVTMSCTSSQSLFNSGKQKNYLTWYQQKPGQPPKVLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSNPLTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 17/9 FAB (LIGHT CHAIN)
molecule tags Immunoglobulin
source organism Mus musculus
publication title Detailed analysis of the free and bound conformations of an antibody. X-ray structures of Fab 17/9 and three different Fab-peptide complexes.
pubmed doi rcsb
total genus 51
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1993-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ifhL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ifhL01
3U7WH 1CFVL 2DQIL 4GOSA 4P4KB 5C2BH 4ZNCD 4Z8FH 2ED9A 3O3DA 5SWSA 1KOAA 2R29L 4B0MM 4HKZB 3UTZB 4OM0H 4I18B 1WAAF 3VXOB 4ZPVB 3T1WA 4L4VA 3F7QA 4UB0L 4YHIB 2QKIA 4CL7A 4P5MA 3HPLA 4HD9A 2ADJA 1DSFH 4GW4A 3SDYH 5SV4A 5DJXA 3KPOA 4X7FC 2XXMB 4XVJH 2VOTA 4OF3A 5L6YL 1NCAH 1VDGA 2EYSB 5E99H 3ECBA 1S3KH 3GSVB 3X13A 4UT6L 3OMZA 2E8YA 4KTEL 4X6DB 2N1KA 5GGUB 4F8TA 1U42A 1M1SA 3GSUA 3SGDI 3BHBB 1S7WA 2WUBH 4NQSB 4HS6A 5J9PB 3OJ2C 2R0ZH 3RNQB 4QNPF 1P7QA 3VFNB 1IQDA 4MZ3A 1U6AL 4FNLL 4MB4A 2EDKA 3D39B 4NRZB 4ZD3L 4DFHA 4KZDH 3L5XH 1IFHH 4OD1H 3GMNB 4M9OA 4QRPA 3FFCE 5TFSL 4QOKD 3GI9L 3MRKA 3GSNL 5JO5A 1GIGL 4WHYG 5F9DC 5I9QB 1BOGB 5I30L 3HE6C 1CLZH 4P2RB 5JLZA 4NQXB 4W81A 5B8CA 2EICA 2A83A 4KRPB 3AM8C 4ZUSA 4POZC 5D1QD 1YMMD 1XH3B 4CVXA 4OKVA 4ERSL 4ZFZA 3HZVA 2UY6A 3LHPL 3FQNA 4I8DA 1AO7A 1CDGA 5HDLA 1L7TL 1JK8B 5F96L 5GGTA 3FRPA 5I76B 4PV9A 3SOBL 4FQQA 4FQXD 4XNXL 1BM3L 1IGCL 2HVJA 4GBXC 1GHFH 3D39D 5GS2D 1P9MC 5CIPH 2DYPB 4OGZA 1RURH 5IW6B 2RB8A 4QOKB 3X17A 4F15C 3BFOA 5F7YC 5TF1L 1YEDA 4Z7QE 2H8PA 3IU3A 3P73A 3ZKQD 2F54D 2VABA 1OOAA 2G2RB 1YMME 5E95B 3ZMRA 1RU9H 4ZPTB 3ROOA 4XXCA 2BNRA 4MQTB 1NGYA 3C5SA 3EDFA 1W0WB 3FMGH 1UB5A 1UACL 3IFLL 1NBVL 3C5ZC 2Z93A 3JWOC 2P24A 5ADOH 4PB9L 4H26B 4DAGH 5L2JA 4FQXB 5HD8D 4PUBL 4X4XB 5C0BA 3UJTL 1IC1A 3KYNB 1G0YR 5E56A 1ADQH 2YRLA 3HB3D 1T1ZB 2PR4H 4PJIA 1T7VA 1P4BL 2WWMC 3VXPB 3ILPA 4K2UH 1JGUH 5IB2B 4U6YA 4G7VL 4HKBB 1FZKA 3UROR 4JZJA 3P4OB 4EUPB 4GUPB 5EOQH 1QRKA 3IDIB 3WUWA 1BOYA 2J8UE 1ZTXL 2ZUUA 4UUJB 1R5VB 3GNMH 1P7KB 3SDAD 4CW1A 2ZOLA 5EULV 4IBLT 1LO3H 2GIYA 5IB2A 2G75A 3O4OB 1IC7L 3T4AA 1PVHA 1BVZA 4WWKA 2D03H 4PJXE 5FA4B 5I1CL 4NKIL 4S0TD 2KKQA 3WHXB 1IC7H 1G6VK 2W65A 2VZTA 2ZJSH 3N50A 2ZNWA 1BWWA 5KANI 3L5JA 1I7ZB 4Z7OE 2HT4C 3KPSB 5T1DH 2R2BB 4QTIL 1FVCB 3QEHB 4O2CA 3FN9A 3CUPA 1JZ4A 5HGDB 5E6IA 3EHBC 1MRDL 5DVNA 2B1AH 2E6PA 1DDHA 4DGIH 4NZTH 4QRQB 3V5DA 2F58H 3EIFA 2HWZL 5AD0B 1S9XA 4P2OC 3F7RA 5FM8A 5ALCL 5DHYA 5F1IA 3H9HA 3RZCC 1JVKA 4NO5B 3MRKB 1KACB 5F7EL 5GGQL 3QQ4A 2J8UF 2XTJB 4QY8A 5DD0L 2I60L 4PREA 4JRXB 4YXKL 1AD0B 5JUEH 5EZLA 2JB5L 2FR4A 3GSVA 4R7DB 3GHEL 5B39G 2ZCHH 1BEYL 3FONA 4Y89A 2Q8BH 3HE7D 1QYGL 5FXCH 1LWRA 1J5OL 5CJBA 1K8DB 1P84J 1CD1B 2B8OT 3MZGB 4PJEE 3TM6A 4ONFH 1AXTL 1UKSA 1T1WB 5L2KB 1OQXA 1QBMH 1G6RB 1VGEL 1MWAL 4NUGH 5HI4D 3WNLA 1KTLB 1RU9L 3CCHB 4UAOC 2OQJB 4E0RA 1S7XA 1MAML 3LKOB 3Q1SH 3PWVA 4PTUA 5ANME 3V6FA 5FB8B 5GS0L 1HKLL 2VXQH 3U0PB 3EYUH 5GXBB 3SPVA 1PGRB 4KRLB 3T08A 4NBZB 2EIEA 1Q94A 2NR6D 1PKOA 4YHPA 3UTSE 1CXLA 3MXVH 5E8OB 1U8OB 4PJ9D 3RUGF 3WSQL 4LARH 3GKWH 1AKJA 4E42A 2ICWI 2DIJA 3PJSA 1MH5B 3BZEB 3QHFL 5IMOA 1I3VA 5I1JL 4PD4K 3L7EB 2I5YL 2BNUA 3OJVC 3QPXL 2I07A 4HBCL 1FNLA 1MY5A 2V9TA 4OZIE 4DGIL 5E8OA 4OGAD 3B5GA 3GI9H 4PJAA 1HCFX 3PDOA 3MRDA 1AFVL 3IJHA 4S0SD 1M05A 3VFWB 3HZYA 2A77H 2VISB 5FECA 3O3BA 4O9HL 4NQCE 4FQ1H 4PJ9B 4MJ5A 3MV7D 4XI5D 1J10A 3TV3L 4ZNEE 2IH3A 3MUHL 3LPFA 1QQDB 4JG1H 4JRYB 4QKXB 4ZFOL 2XV6B 1C5DB 2A74B 3CH8A 4JPWH 3RDTD 4CN1A 3MFGB 4HF5L 5A40E 2HFEB 2N7BA 3TN0B 1UB6A 5IIEA 4Y16D 4A6YB 2JELH 1YEEL 4C83B 3K3QA 3KJ6H 1H3XA 1KTDA 5KSBE 4P2QE 3KLHD 2VAAA 2VLJE 4OIIL 3ARFD 3RUGB 3TWCH 4XRCB 3I6GA 4R3SB 5GS0C 1K3IA 3ZHLA 5C0IA 2AEWA 1LE5B 4JHWL 1S9XB 4XPAL 4JDZB 4J6RL 1ADQL 1UXSB 3TIDB 1U9KA 4OZIF 4LU5L 3UCRA 3WL9A 2DKMA 3O11B 4EXPX 3FAXA 1JPSH 1G7HB 1MFBH 4ONHA 4WW2B 4XCYA 1FNSL 4I48A 5FYJU 43C9A 2A38A 4M02A 2DD8H 3ALPA 4HC1A 4X5LA 2DLFH 1CE6A 3NZHH 5I18H 5K33A 1CCZA 4YC2B 3LS4L 1N4XH 5IMMA 1GOFA 5IMLB 1VADB 2CQVA 2HTKD 5HDBF 4YHIA 4R9HA 4Y8DC 3MBXL 3AC0A 5I1IH 3AUVA 1MIEL 3U79A 3HMXH 3KYAA 4Z7NE 2DL2A 1BGXH 4NO0A 2ZG2A 2IEPA 3A67H 1C08B 4XCYB 3UO1H 1DP0A 1T2JA 1LNUA 5I0ZA 5ALBH 6FABL 3RNKA 3OAUH 3CDYA 4O51A 1WWCA 2HT4D 1SEQH 3WDJA 2BOCB 1FNHA 3FQXA 1XGYH 2MCPL 5JW4N 1OW0A 1T0PB 1V7NH 5EU6A 4M62H 3VD3A 4RNRB 2OR7A 3UEZA 1OP3K 4PJ5E 4ZTOL 5GZNC 3LB6D 2OZ4L 3NCYS 3SJVA 4JQIL 4LIQE 1HILA 2IJ0C 3RZCD 3ESVF 1FCGA 1XGUA 1G9NL 4MNQE 5C0ND 1Q8MA 4HXBH 4PJ8C 4HX1A 1B0GA 3UDWA 3QEUA 2VLRA 3PWNB 3K46A 2YK1H 3KPLA 1UZ6E 4YDLB 5HI5D 3MACL 3AAZB 4EN3C 4U1MB 1UM5L 4TUKH 3KYKH 1KTLA 2GEEA 3VFUA 4E41B 1R3JA 1JP5A 1XF4B 3B2UD 3V4PH 1T0MA 2WWKT 4YNYA 4PJDB 1JFQL 4JCLA 5DRWA 2J88L 4XX1E 2WWKO 3RWGA 4BJLA 1Q72H 1EXUB 2DQCL 5H8DA 5FGSA 3BH9B 3WFBL 1KLGA 1KF9B 3QFDA 4RMRA 4XAKD 5GRVL 1PG7X 3L7FA 4KTEH 5BVPL 4AT6A 1T6VN 3GSOB 4NIKB 5E7BA 2OXGA 3ZE2F 3QQ3B 1R3LA 3V0VB 5B4MC 1F4AA 2AABL 2ZUXA 1JNNL 4EI6A 1UA6L 4CNIB 3P77A 4GRWH 4X5XB 5FUOH 5HY9B 5CLWA 1I9EA 4PJXF 3SDYL 3H0TB 5A3IC 4HS8L 1VGKB 1H0DB 4E41D 3QCTH 4YGAB 1ORSB 2D9CA 5BVJA 4PRHD 1U8MA 1UJ3C 1DVFC 2MHAB 1A3RL 5IHLB 2Q6WA 3ESUF 1KIUA 4K7FA 2F53A 2MWCA 1FORL 1EO5A 2WMPA 4UBDD 5SWSE 3DVGB 1KJ3L 3MLXH 3ARFA 3GJEA 4DGYL 4PJDE 3O8XA 1F5WA 4X4XA 5C0BB 1OPGL 5AAMA 1MFCH 3KLAA 4L8CB 5E8NB 1QRND 1BQHA 2CDEA 1NH6A 4M93B 1IQWL 5DUBB 2DLHA 5D7IE 4M8QA 4JM2C 2BHYA 2ZCKL 3VG0H 4ODVL 3TO4C 4OFDA 3PGDA 1CFQB 1JFQH 3KPQB 3VDCA 2BVOB 1I8MA 1AFVH 3V6OE 1CICB 5EBLA 4DK3A 1U3HD 1NDGB 1CDBA 4DZBA 4PRIB 2UZIH 4HXBL 5DEFB 4LVEA 2V5MA 1P5VA 1UEMA 2CLVA 1ZVSB 1YQ2A 2QQNL 3DMMC 4L3AA 1F2QA 4Y0GA 3QH3B 2ZUSA 4LF3B 5C08A 3FO0L 1IBGH 4S1DD 1VEPA 3FTGB 1Y18A 1CICA 5EBLB 3IJYB 4Z0XA 4PJAE 3M07A 2GSGA 2LVCA 3EJJX 1LK2A 4KUZL 3OG4B 1NLBL 1JPGB 5IHUL 3ARBA 4PR5B 4CVXB 1G84A 4IMKA 4WW2A 1RZ7L 3VXRB 4XP4L 3C6LB 3V2AR 4HT1H 3QIUC 4DCQB 1GC1H 4ZNEA 3CFCL 3WUWG 4ZFGL 5ALBL 4AYFA 1WBYB 2H32H 4N9OB 4JCMA 5TF0A 3BIKA 5E5MB 1PD6A 3TBSB 1ZAGA 1G9EA 5GGRA 5FECB 5IOPA 4I5BA 4ZFFB 3ARYA 3VG9C 1A3LL 3WLWD 1OGAD 4PJCB 4LSSH 2AEPH 1SY6H 4NQDE 2VQTA 1KENL 3CXDH 1IEHA 2D3VA 5BMFH 4AMKL 3M17A 1R24A 1MJUH 3RY5A 1N0LA 3GMMA 1QKZL 3KS0H 3VXRD 2OS7A 3B2VL 3LN5B 4MGXA 4QRRB 3PF2A 3OR7A 2H26A 2VITB 3IDIA 3WUWB 2W9EH 4IRJA 3VXQA 2GY5A 2NY3B 4BM7A 1DBKL 4MWFA 3T0WA 1AY1L 5DJXB 4LPWA 4XT1C 5B8CB 4NOBA 1Q1JL 2ITCB 1QR4A 3QQNA 3KJ6L 4U0QB 1QEWA 2Y9RT 1YUHA 3DYPA 4W6WB 5DFWH 5E1AA 2C1PA 5F6IC 4PS4L 1KN4H 1TZIB 4YNYB 4WFFD 4QCIB 1I1FA 2HFGL 3P9LB 1NGZB 4CMMB 3UYOD 2JE8A 4X6EA 2MHAA 2X05A 3AXLB 3LH2L 1NCWL 4OLUH 1BFOA 4RMVA 1JZ5A 4TSBH 4LSRL 4MDJB 2P5WD 3SE4A 4LNVA 2VXSL 5C3LD 1PYWA 3HB3C 2IPTL 4U1HB 5F88A 1X5XA 4S1QL 4ETQA 4G6KH 4N0UB 3BKJL 2PCPA 3KPRD 3GHBL 2EDBA 3GUTA 3P30L 4JY6B 1A14H 3FONB 4LLQB 1OM3L 2X9YA 5J7CC 3FN3A 3OKLA 4YHOH 4GG6E 3LSOB 1V7MH 1GVIA 3QNXA 5IT2L 4G3YH 3FQNB 1QR1A 1IC4L 5C70A 5B4MD 1GRWA 3QEHA 2VIRB 4HFUL 4JM2D 3M8OL 4YHOL 5CZKA 3PWPE 3QWRA 4DVRH 1IGJA 1A4KA 5I1JH 2ZSWA 2DTML 4K3DH 2BZDA 4EIZC 3WSQH 4FXLA 3DX7B 4Q6IC 3QYCA 2P5WB 1MCHA 3W5NA 5GZOD 2YMXH 2HG5A 1CU4H 3LSOA 3OPZL 4MZ2A 5AYUH 1LK2B 4LSRH 4WNQB 3FO2A 4GQPH 3IFLH 4M1GH 4ODBD 4NM8L 4P23D 1B3JA 3LH2H 3KLSA 4BQ6A 4EN3D 5BJTA 3ULUH 4HWBL 4NQVA 1IM9D 1QSFB 4WO4B 3D39A 4KJPD 5DJYA 4GS7B 2GK0B 4N0YH 5C0EB 2ICES 3CVIH 5EORH 4FG6C 4G8IB 4IOFD 2DM4A 4XI5C 1LE9B 2OX5A 3RWHA 3MROB 4P99A 4LCIL 3BP7A 3B9KC 4D0DA 3EAKA 4NP4L 2BNRE 4FMFA 2XIDA 4U1KB 1A02N 3U9PH 3M1BA 3ARGC 2XA8L 3KXFB 1ED3B 1QHOA 3QFJE 1I9RL 4AIZB 3GBMH 4AY0A 2WIIA 4HPOH 3CSGA 5DVOA 1N5YH 4HG4J 1JNHB 3HS0A 4I0PB 1VKXB 3CXHK 5E2UL 4HWEH 4DVRL 1IKFH 1KPUA 2DQFA 1OP5K 4MQ7A 1IC4H 2DL9A 3OG6B 2GFBA 3QDGA 4LCYB 2W59A 3K4DA 3H3BC 3G5YA 5HI4C 3HRZA 4L5FH 4WFHD 1FZMA 2I9LA 3GHBH 1H5BB 1T3FB 1Y0LA 4PG2A 1DN0A 2APWA 5HBBA 1NC2A 5SWZE 4CDGC 3EOTH 2CR3A 4DVBB 3OR6A 5C9JA 4CADA 2D03L 3QULA 3MLTA 4PFEA 4I0PD 3P0YL 4UQ3B 4R0LB 3F6IA 5ABDE 5I1CH 1NFDF 5KSVB 4RA0C 3T8XA 2ZOKB 5KJRL 5IHUH 4LLYA 1T3FA 4QRQA 2JLLA 3V5DB 4NWUH 5C71A 4K71B 4U7MA 5BXFB 1EBPA 2D4DA 3RPIB 4PS4H 2KUTA 1ZTXH 2G60H 4NO3B 3A6OA 4OCNC 2ITDB 3BT2L 1IBGL 3GMRB 1YJDH 4B7LA 2DQGH 5JHDE 1KC5L 4QYOA 4JZNA 4L8SA 4P4RA 3O6FD 2CKBH 4F9PA 2AXFA 3VE0B 5H94B 3ARXA 4JFZL 5IMMB 1NUGA 3GMLB 5C08B 1FSKB 1CK0H 1R5WB 3F12A 3ZYJA 2UZYB 5IB3A 2ZOLB 1U0QA 1WBXA 3O2VH 3RIAK 3NN8B 2VLME 5HYJD 1VFUA 2Y5TA 5GGUA 3U6RA 1WTGT 1UWGL 1QFOA 1RSFA 3MRBA 4MNGE 1ACYL 3EYQD 3P9MA 3MOQA 2VC2L 4OLZL 4XP5H 4CVZB 5K9JH 4G8FA 4PBWD 1TZHB 3BWAB 4JPVL 4HIIB 5HHMD 3CNKA 2AI0H 1D6VL 1MI5A 3NFPA 5TF1H 2ADFL 4XB8A 5C08D 4ZFGH 5ADPL 4Z0BH 3P4NB 2ZZUT 3E3QE 3H9HB 1QLRB 3MBEA 3MGOB 3RWJB 1MHPH 1U8KA 3K7UA 5F8RC 1BFTA 2B2XL 1I75A 5GJSL 5CIPB 1URLA 4B53A 1GPOH 1G7LA 4LAQL 2ENSA 3HG1A 25C8H 4POYA 1ONQB 1U92B 5HHME 3MA9L 1VFBB 3O81A 4XH2B 3QRGL 2F5BL 2C26A 4ELME 3IXTA 5J13B 4IRSA 5BZWA 5HHOE 5HVHC 1JJUA 4P48A 3T04D 1P7HL 5I30H 5HI5C 2OLDA 5JZ7C 4HWZB 5ICXA 2YD6A 5DVKA 1GGCH 3P0GB 1OF2A 4JFQA 5DEFA 1T7ZA 4EI5D 4AT6B 5CILH 2H2PC 3GSQA 3HE7B 5SWQA 1KT2B 5JIKA 4O2FB 2O5ZH 1HINH 4XGZB 3NABH 5DJ8A 5DHVB 1QSEB 5TJWK 3ULUF 1UB6B 3ELAT 4NQCA 3BQUC 4HGWB 3LCYA 3MA9H 4MB5A 2VDKH 3TO4D 3DUUA 1RUKL 1UWXH 4Y4FA 4OV5B 3VWKB 2OMNA 2FLRT 5I1GH 4OCXL 5TDNA 1S3KL 1G0DA 3I75B 3T2QA 1NBZB 1G9MC 3CDGB 1BIHA 5CP3H 3AS1A 1KPUB 2DQFB 5D5MF 5E2WL 3KG5A 3KS0J 4GBXB 1S9VB 4OLEA 5A3ID 1AE6L 4JREC 1IAKA 4UB0H 2XWTA 3VXUB 4U3CA 3G6JB 5D1ZB 2CK0L 1R3HA 3ARDB 3OKDB 2ENYA 4PJAB 5EZIH 5HJ3B 3EJZD 1G7PA 1UA6H 2ARJA 1ZT4A 1NCUA 1TETH 1CFVH 2NY0C 5D2LF 1KCVL 3CMOL 4AM0A 4ZSOA 3MBXH 5I1IL 3V5HB 1T83A 3VI4E 4P5KB 1JPTL 2P44B 4LEOB 4Z8FL 1KLUA 2C1OA 5C07A 3FO1B 3LRSB 1W0VB 1BJMA 5C8JA 4WV1A 2Q86B 5I18L 2YRZA 2VQUA 3BKYL 4RFNB 2EDXA 5CGMA 4FQXC 1YA5A 3CVHB 4D0CA 2ATKB 4N0RA 3ROLA 2Q8AH 3IF1A 4U1NB 5GS1B 4F33B 5LQBH 4U6XA 4L4TA 5C09A 2APFA 4G80A 1QVOB 2F53E 2OP4H 3TT1L 4JHWH 4OAWB 3BUYA 3L5WB 4I77L 3WLWC 4X6BB 1K4DA 2VUOA 1IAIH 5FKAB 3BDYL 3DIFB 4BH7B 4XCEB 1BLNB 3GSNB 3MNZA 4K8RH 4WTZA 3SDDA 3MREA 3RDTB 3V8CA 2FHFA 2BNQE 4Y88A 4K7PH 4D94A 3CPLB 4ODUB 2X10A 2P5EB 5CZXD 1A6ZB 2XY2A 2X4TB 4M1CD 3G04B 1NEUA 4CNIA 2W0PA 1JF1B 1RUKH 4Q9QL 3SO5A 3QH3A 3T2NL 4PGBB 3MUGA 4OKDA 3KNBA 1S9KC 3MRJB 4LSPL 1BJ8A 3TNNA 4NHCL 4JFDA 4P3WA 1EPFA 4OZGE 5DF0A 4GW4B 5I16A 3MLVH 2AEQH 2EZ0C 4AH2A 1HINL 2BXZA 5EIVA 5J4MA 2P5EA 2IF7A 3BAEH 2V17H 4X6FA 5D71L 2WBJA 5I8CA 5IFHL 2HMID 2VLRD 4U1GB 2GK2A 5JR1H 4PLKC 4V1DD 4X9IA 3DX8B 1KULA 2X2YA 1QBLL 2A1WH 3VXTB 2FX8H 2PF6A 3QI9B 5C1MB 1AI1H 4DUXA 3QXWA 2H1PL 2NQCA 4GAYB 1KBGL 5IJVB 4J4PA 5MEOA 3LZFL 3VRIB 3G08B 1JWSB 1QSEE 4HC1H 2X1PA 3IDGA 1JPSL 1MFBL 1LMKA 4ORGB 1JL8A 1MCBA 1RZIB 1X4ZA 4HH8A 3X3GH 1A6WL 4FQPA 1K8IB 2NY4D 2XKUA 4XHJC 3CLEH 4MNHA 5J1SC 3BP5A 2Y06L 1I8IA 2AP2A 3NPZB 4MLIA 2IBBA 4QOKE 1MHPL 1HDMA 3VU2A 3F6LA 3TT3H 5DRNB 3U36A 2NY1D 3MZTA 4H25B 4U3XA 3D1MC 4GW5B 2H26B 2VITA 4FQCL 5IHZB 5TDOB 2AQ3A 1CXHA 1CD0A 1MLCB 4V1DB 1EV2E 4MX7A 1IGFL 2E27L 4EBQL 2HRLA 1K8IA 1QZ1A 3KPMA 4WY7H 4NNPH 3SPVB 2VC2H 2NY2B 2XRAH 3N1PC 1QEWB 1XIWD 4F7PA 1RVFH 4UTBL 5EIIA 1D5IH 1KIQA 2QBWA 1LEGB 3MLSL 3G5XA 4XBPA 2AQ1A 2R0KH 2J6EH 5HYSA 1CI5A 1P2CB 3BX7C 3IT8D 2CGRH 2BK8A 1G9ML 2DIBA 2DTMH 5SX4I 3VWJD 1B90A 5JUEL 2J8OA 2R56L 1B9ZA 3D6GA 3P4NA 1FC2D 1CD9B 2FBJL 1H3GA 4HWNA 5C86A 3FQWA 3EDEA 1EEZB 1HNFA 1N6QH 4I3GA 4NQDD 4WI2A 5ACZA 2VYRE 4OQ1A 5F1KC 3MLRH 4LIQL 2FEEI 5C6WH 4AL8L 5IVXB 1KIPA 5C0EA 2Y25A 4EOWH 3SDDD 3BUTA 3QEGH 1QSVA 4XVSL 3RI5K 4GG6A 2IALB 2HT2D 3VWJB 2J1KA 3AFLA 3RVXC 4OT1H 2P48B 4M7KL 2RIKA 5HYFA 4F33A 5LJYH 4ZAKB 3G5ZB 2R69L 3OZ9L 4N9GA 1ZEAH 4G80B 4M1CC 4MJ6A 2PYED 5M94B 4BUHA 3PGFH 5CGYD 1TCMA 1A6TB 5INCB 5BW7C 1A6UL 3VI3F 4HEME 1GYAA 5C0FB 4IM8A 3FOLB 3CFEB 3ZT7A 5IGXL 4RAHA 1QLFB 1YEGL 1EO8H 2WBJD 5E08L 1PYWB 3QCUL 2IGFL 4HUKB 3WL9B 3BOVA 2W9EL 3BP7B 2GT9B 5IM7A 4N68A 4JZJB 1SMOA 3S35H 2GJ6B 4R8WL 4H88H 3KDMA 1PY9A 4YGVB 4JO4L 5K9QI 2I60H 4KVCH 4PGZA 1J8HD 2V5RA 1MFAH 1DL7H 3QIWA 4M5YH 3IJSA 5HYSG 4HZAA 1N0XL 4R7DA 3GSRB 3MCLH 1MCRA 4PB9H 2FO1A 1A3LH 3AM8A 1UACH 1TLKA 1XFPA 3D0VB 4NFDA 4UV7H 5EA0H 1I8KA 4YC2C 2B1AL 4UQ2B 3CSYA 2CLRA 2C3WA 4HK0A 4O4YL 5EPMB 1I1YA 4UV4L 5FYKD 1XCTB 4MMZC 3HPLB 2AJYH 4YBQD 5CINH 4H1LH 1UM6L 4OB5H 3EDDA 1UH4A 5C09E 5I19H 2IPUG 5J1AB 5DRWB 3AS2A 2B4CL 1QO3A 2XKNB 4N0FB 2MOVA 1QFWM 1RZ7H 1MHHB 1OAQL 2PYFA 3DXAA 5EU7C 3BGFC 1BWMA 2YPKA 4OIAA 5CJOL 5EWIL 1L4IA 3IDMA 1X5YA 3C09B 5GGSY 5EPMA 3NA9L 1KXVC 5I6XC 2VN7A 3DX9B 2HYMA 3BN9D 3L1OL 3W9DA 1EFXD 2NX5D 5ILTL 1BD2D 4LLDB 1NEZG 4KKCD 1QSFE 3CDFA 5I8KH 5TH2B 5IWLA 4OD3L 5J11B 2OSLA 5IT2H 5EC1A 3RFZC 4KROD 4JFDE 5EFIA 5IEHB 1YEJL 3RWGB 1MH5A 5IHZA 2DIAA 1FJ1B 1NGQH 3P4MB 4RIRB 5CD5D 4POUB 1ZLSL 2NCMA 3B83A 2XTJE 2FNBA 2P5EE 2Y4SA 3LQZA 4X80H 1A1MB 4R97B 4CMMA 4M7JH 5J6HB 5I8EA 1ADQA 2ZUYA 3B9VA 4HUMB 3UTTB 2Q87A 4Y4HA 2DJ4A 3QXDA 4K9EC 3BRFA 1AGEB 3D0LA 1JBJA 1PFCA 5D7SL 1OPGH 5ETUB 2FZ3B 4Y1AA 1BD2B 4LRIC 1GZQA 1WK0A 1QFUL 4KROB 3N06B 2PUQT 4QT5A 3F7PC 1IGIL 3QG7L 1F4XL 2Y7QB 2EH8L 4N0CC 1IAII 5J8OA 2JJSC 1X5FA 1NSNL 4L3CA 4I0CC 3NFNB 3QNXB 3ZKXB 4OZHB 5JXED 1JNJA 4QXTB 5DRZA 1SYSB 1EEZA 2PO6A 4Y19B 3O2WL 4YBLB 3NH7H 2SEBA 5A2IH 4GSDL 3O3AB 3RWFA 4I3SL 4YEEA 2VLKE 1N6UA 4NT6A 4APQC 5I8OL 5GGSA 2EC9U 4H5SB 4G9FD 2QQLH 1MJUL 1MCEA 1X9QA 4L3EB 5DJZA 4QYOB 1HYSD 3GFUA 5CIPA 4WI6A 8FABB 1CTOA 5ID0B 1AGDB 2P4AB 4JM2B 5DS8B 5FDWB 4FTVE 1OAYH 4UIMB 1ND0A 1QQDA 4JRYA 1S5HA 2K3TA 4N8PA 3HPJA 4KZDL 4JHZA 1A9BA 4HJGA 5I1LA 3D0VA 2AJXH 1UZ8B 3JV5A 4X5XA 5TQ2H 3BP6A 4Z0XB 4YO0B 1FYTB 1K4CA 1AHWA 2FO4A 2VDQL 5HDQL 1DEEB 3S34L 2X4RB 5IF0B 4XP4H 4UBDC 2PO6C 4L1DA 3T0EC 1XGPA 1EGJH 5K59E 4LCWB 4IDJH 3MNVA 4ZSOB 5DLMH 5CHNA 2BDNL 2B7DT 1JHKH 3PQYD 4RA3A 4Y2DD 5FKPB 5IBTH 1P1ZA 3V4VH 3VW3H 3QXUA 1SEQL 5A2LH 2GITB 2GY7B 4ZTPH 4U6YB 2QQNH 2YUXA 1F4YL 4WGVB 5HVGB 1NUDA 1JGDA 1MWAA 2OI9C 4Z7VB 1W72L 1T1YB 3C8KB 3IFOB 3WN5C 3NTCH 4P3CL 3HMXL 2ZCLH 5CZXC 1FYTD 5JHDA 3CSYB 4M7LH 3W9EB 1CE6B 1OAUL 3FQRB 2CKBA 1J1OH 3HC3L 2QV2A 1SVCP 4CU8A 3VG0L 3PWVB 3O2DH 4WFFE 1RIVH 3C8KA 3E8UL 4G6AD 5EUOB 5AUMB 1MWAB 3OKMA 2NZ9C 5JOEA 2FH6A 4OFIA 1S9WA 4IRJB 3MRCA 2P1YA 1HI6A 2HN7B 4UT9H 4OQTH 1JIBA 5T33L 4JHAH 4D9LL 5EU3B 4NFBA 4Y1AD 5I1KL 1SJHA 4OIIH 1FFNB 3KNBB 5FA3B 2J5LC 3WIIH 5IJKC 1DJSA 2CSPA 4JRXA 4Z7QF 3MJ7B 1VFBA 3DO3A 3G6JE 4JN2B 1A4KB 3LIZH 3GJFA 4DN3L 1T83C 2ICWB 1FHGA 5JXEA 5HYSB 3O2DL 1U8QA 4L4TE 3C60C 4PJ7A 4JO3H 2A6DB 4P46B 3HZMA 2AK1L 1LDPH 4OI7A 4BA8A 3H42L 1RZKL 3Q6FB 3MO1A 5TE6L 4NQXA 1KXTB 2ZCLL 3TVMB 3GMOA 1U93B 5CEZL 1FZJB 1U95B 1HOCB 2IG2L 5J1TC 4U1IA 5JOFB 4QHKJ 3ULSB 3VJ6A 1BHGA 1NFDB 3QWOB 3MRLA 2CLZB 4ZTPL 3VFTB 5HXMA 2X7LB 1AQKL 2ERJC 4LEOA 4YDIL 3E6FA 3MACH 3TJHC 5TGBA 1IQDB 1DBJL 3VCLB 2ICEB 2WLZA 4MA7H 3SGKA 4P9MH 3V6ZB 1A7NL 5HDOA 2LU4A 2HT3D 4HS6B 3RIFK 4OZHA 1JF6A 1X5AA 3FJTA 3C2SA 2NY6D 3SBWA 2WIMA 1PDKA 1A3QA 4HIJB 4R6UA 4YDVB 4QNPE 3KYOB 5LCVL 2APTA 3VJ6B 2AGJL 4ELMB 2XWBA 1DQJA 1H3UA 5EN2B 4BYHA 3E2HC 4YHKL 1JWMA 3VRIA 5HHMB 5FCUL 4FHBD 4KI5F 2R1YA 3DYMA 2BCKA 5F6HI 1ZA3A 2A6KA 5DK0A 5SX4H 4MJ4A 1KCUL 1UWEL 1AGCA 3MMEA 3CCHA 2VXQL 2AW2A 5IG7B 3KWWB 2XQBH 1YEHH 1RQ5A 3QHTC 3SJVD 1JMZA 1V3MA 3NIFE 3F58H 5JPMB 1RIUH 2DRUA 4C57C 4OLZH 4G43B 3PWUB 3H7LA 3AU1A 4LPCA 2YZ1A 2GTWB 1O0VA 4WU5A 4KI1A 2DM2A 4XPGH 1ACYH 2R2EA 1QNZL 4WHYH 2D0FA 1EMTL 2BY2A 2BNRB 1V05A 1QD0A 5AEAA 3OKKA 4UQ3A 4UU9B 4NKDA 3RTQA 5HHQB 4RZCA 1WV7T 4M00A 3LEXB 3TBSA 5KVEL 3TFKD 2Q8BL 1TTUA 2W0FB 3DV4B 1E28A 4DKEL 1X7QB 5KBNC 1BZ7B 3GSNA 1H15A 4XBGB 2DLEA 5JIHA 2I9LB 4KVNL 3GGWB 3HRZB 2E7HA 3AS0A 4G6FB 3Q48A 1QSED 4UMGA 2HP4A 3VFMA 5HYQA 4L8BB 4L8DB 5ANMA 4YUEH 2YPVH 1PQZA 3DSFH 1NMBH 3FCTB 2F19H 1HSBB 2FEDD 3RVUD 3FT4A 2K7QA 3QEQD 5I73B 2VNCA 4OFYA 3SGJA 1NC4D 4LDLB 3H9SD 4JHBA 2EEDA 2Y5EA 1SHMA 4WUUE 4YH6A 4OCSH 3ALWA 4Z18A 1ZHKB 3MLPA 2BNQA 3QCVL 4Z78A 5HPMB 4JPWL 1DBMH 2MCG1 3QDJA 4X80L 4JM4H 1DQML 4Y16A 3F7YA 3QJHB 1B4JH 1KELH 3UTPE 3SE4C 2OL3B 3K8KA 2UVEA 2MPAH 4JKMA 3LKSB 4MX7B 1P4IH 1KIPB 2VWEC 3OGCA 5ESVB 1FL6B 4N0UE 2HN7A 2ZG1A 3L3DB 4G6FD 2D7PA 4QXUL 1BFOB 2GJJA 5FYJH 1T80A 5FEBA 3QEQE 4Y16B 3CX2A 4N90E 3AXLA 4JPKH 1FO0A 4NO0B 5J6GB 1D9KB 4OKVB 3INUL 4N1CA 4NJ9L 4YR6A 1TQBB 4QRPD 1WLHA 4HUNB 3QPXH 1JF5A 2OL3A 3TZVC 4NNXB 3SKJL 1QLRA 3MBEB 4JKKA 3RY6A 5IB3B 4G9FA 4LLVB 2V5TA 1QRNB 3RA7L 1HHJB 4GRWE 1WAAA 2DLIA 2EH7H 3RGVD 1IGML 4WFGE 2J3SA 4C4KT 2W38A 2GITA 4HUUB 4YHNB 4Z76B 4P57B 5F9OH 1EVTC 1SEBA 1TMCB 4F7TA 4KUCD 3U4BH 5FYLL 4NO0D 3DGGB 5IUSA 2X70A 1MCWW 4EI6B 1KB9J 4RMQA 3SY0B 5HHVH 3CVIL 3BPOB 1YEIL 5E4IA 1FZOA 5ICXB 1IM3B 3DOSA 3TIEA 3QO0A 2F8XC 5C0AD 2IMNA 1VGEH 4NM8H 5LGJA 5SX5H 4R8WH 1ZOXA 4MA1B 1OSPH 3QFDB 5AYUL 3NBNA 1ITBB 2AJUH 1RMFL 2Z35B 5CBAA 4HEPG 3MLZH 3PQYA 4Y2DA 2IBZY 2P7TA 3IFPB 3ZE2E 4GKSA 3GRWA 3SO3B 4G7YH 4R90L 4M3KB 1CVSC 1HIML 3LN4A 5IQ9B 5IVXF 2J4WL 4NM4L 4ZUTB 2C9AA 2J6EA 1T4KA 2R4SL 5E2JA 1CXIA 2VLRB 3L5IA 5GS3A 4PR5A 3LS5L 2UV3A 1QHPA 2AK4A 1HHKB 2YBRA 1I1AA 2WIIB 5FM5M 1RUPH 1TDQA 1IGYB 2HWZH 1U2CA 4ZUVA 1A14L 2VABB 4NNYB 4ZS6C 5HVHB 3M1BB 1I1AC 5E70A 5F21B 1X4XA 1G6RL 3HC0A 5IBLD 1DQMH 4JM4L 1OGAE 1FE8H 1MHCB 1J88A 1MCLA 2QSTA 4Q97A 4NQCD 4XTRC 5MERA 1YPZF 1CT8A 1LEKB 3DECA 3VGAC 4QRRD 1YNKH 3DVNB 1FZMB 2Y36H 4YX2H 2AXHA 1B0RA 2IANE 1CG9B 3BQUB 4F7MB 5M95B 4H20L 4I1NB 5EO0A 1CIUA 4I2XB 2FJGA 5INCA 4M7ZB 4FN0A 5ID1A 4KJYA 2ZWLT 4IHOA 3RVUC 1U8KB 4MS8D 1ITCA 3NZ8B 3W11D 1QFWL 3LEYL 1NAKH 4KKCC 4L4JA 2AVGA 2C7UA 1YYML 1WTLA 4GAFB 4M5ZH 3JWNC 3VFMB 1DTUA 5FV2A 3KHOA 4ZS7H 3VFSB 3TFKC 3C9NB 5ID0A 1HHHB 2AXGA 3Q2CA 1P4BH 4Y1AE 1RMFH 5A1AA 5E6ID 1NDMA 2HJKA 5ISZB 5C2BL 3MRMA 1AIFA 2NY7H 3OKOA 1E4JA 2Y72A 1RZJL 4K9EL 2CKNA 3IF1B 4O2FA 4Z7UB 3RWFB 2VAAB 2G75B 1LGVA 1FG2A 4XZUA 3UJJH 5T3XL 2HH0L 4IMLA 2IPUK 3DTXA 1I9JH 3BMVA 1SJEA 3MNWA 1U8LA 2KH2B 2Q7YA 3LD8C 3O6ML 4OM1H 2QQKL 1WT5A 3HZKB 4MHHI 3EO0A 4LKXA 5DJCB 5HGDA 1MPAL 4P23C 2PYFB 3DXAB 1OQOA 2EO9A 3PHQB 1Z9MA 2Y06H 3DYOA 4KXZH 4YK4C 3QRFM 5EZOL 3NIGF 4LLWA 1FGNH 2I25N 3RKPA 2BY0A 1MEXH 3V52H 5GRVK 1DE4A 2PNDA 4PRPA 1OAZL 3P9WB 5KVDL 3WNNA 4BFEA 1T1YA 4F2MA 1BF2A 3LHPH 3S88L 3QDHA 3WE6A 1Z9LA 2VDMH 3VXSA 2YD4A 4PJEB 3B9KD 4P5TB 5EOTB 4YFLI 1IGTB 3QIWB 2B4CC 5HGGS 3MGTB 3SDDC 3W0WE 1NJ9A 4J3UA 2Q86A 4WV1B 1GL4B 2N7AA 1HNGA 1OAKL 1GGBH 2I9TB 2FEDC 4RFOH 2CR6A 1RZKH 3BW9A 3OSKA 3EFFA 3SKMA 3STLA 3HUJB 3WXWH 2V5SA 3IFNH 4OLVH 1NGZA 2ZCKH 3TCLA 3DX6A 2XZCH 3ARRA 1A1NA 1DLFH 4P3DA 1FFOB 3GIZL 4PB0H 4APQA 4RWHA 2DLGA 4AIOA 3V6FB 5FB8A 4ZUWB 1MJ7H 3S96A 4C83A 3R0MA 5D93C 1RFDH 3BESR 1KYOJ 4U6TA 3D9AL 2LQRA 3CFBB 1A4JB 3O4LA 5C0GA 4YDKH 3VH8B 5E9DE 4PLJD 3O0RH 3O6KH 1JYNA 2DI7A 3LKNB 4G9FE 5CUSL 3KYMA 4OZ4B 3Q5OA 4HV8A 1A3RH 1F4WH 4DK6A 2PXYB 4NO2B 4X98A 1SBSH 2AJVL 1G6RA 4ONGL 4LGRB 3ZE1F 3D2UB 4DKEH 5C0RH 1IMHC 1SM3H 1J18A 1TNMA 4OCRL 3HC4H 3TCXA 2XPGA 1MAJA 4X6CB 1QA9B 1NL0L 3PDOB 3IKKA 2C4FT 4G8GA 5D1XB 3IS0X 1NFIB 4DKFH 1D6EA 1MCCA 3MLUL 3T0EE 4YWGL 3SDCD 5B3JE 4DW2H 3MJ9L 1YY8A 1EEQA 2PW2A 4S11A 4PJEF 3VFNA 2CDFA 4O58L 4NKDB 1OT1A 3V5KA 1I8MB 5KW9L 2J7LA 1JPTH 2O5YL 5FM5O 5ESQA 5JMRA 4FQLH 2HJKB 1CGSH 4FXGA 2HVJB 5DMIH 5ISZA 5KTEH 1S5HB 4P3CH 4XCNA 2FL5B 2PXYD 5CSZB 5E7FA 2E9IA 4ZMAT 12E8H 4EDWH 4ZFZB 5T5FH 1KIRB 5DD5L 5AG9A 2YD1A 5L0QB 4Y5XC 4HKJB 4PG9A 5IBTL 2O5XH 2YK1L 3JWDL 4WUKL 1UXWA 3CVHA 1UVQB 4H1LB 4D0CB 4JAMA 4YXHH 4L8CA 4Q0XH 4D8PA 4JRYE 1EAJA 2D7TL 1ZVYA 3KLDA 4L8SB 4Z7OF 2NW2A 2DQDL 1AP2A 1BZ9A 2YEZB 5DQJA 2K1MA 2OJZL 4I4WB 3L3OB 1TJHL 1ETZA 1AGFA 4M8VA 4JM2F 4X7SH 3U0TA 1UXSA 3MXWH 1WICA 1JRHI 2VZ3A 3JTTA 4W4NA 1FDLH 1NGWA 2ARJQ 1EJ6A 4LCWA 1R5IA 5D70H 3MUZ1 4JQVC 1S7UB 3HLAA 3QUZA 4LVNC 1N3NB 4UTAH 4FZEH 4PIRF 3DTXB 3ILPB 4JFHD 3VXSD 2Q7NA 4LVOC 5IB1A 3VWJC 5KSAB 1FG2B 1ZV5A 3QXTA 4OZHE 4Y5VC 4KK5C 1FO0L 1AXSB 2E7MA 1T1ZA 3BEVB 3QDMA 4JFOB 2P46B 3KYNA 4YHZH 1F90H 5H94A 4WEBL 7FABH 5FYKU 2XICA 3NCYP 1FIGH 1ZWIB 3IRZA 1MF2L 5JPMA 1CBVL 1BVLB 4M6NH 5F93C 4PGEB 4WU7B 4GXUM 4L8DA 4OAWA 5ANMB 2DQHH 3FN0L 2AV1B 1ZXQA 3T8XB 1J8HE 1WZLA 3I2CH 4LSTH 2W9DH 3PGCB 5CEXA 3ARBC 3MNVB 5GSRB 1NSNH 5F1NB 5I74C 4L9LB 2YPLD 1D5MA 5I0DA 4GMSH 1YY9C 1J8KA 1UG9A 3LEXA 1XGUB 3OHXA 4BQBA 3VXQB 1JF1A 3FKUS 5EU3A 4LRNL 1ZHBA 3EHBD 4OI9A 5BZWB 5BQ7B 2Z8VC 1BQLH 5F1NA 4B41A 3STLB 4NO5A 3IYLW 2NR6C 2CXGA 15C8L 4AEIH 5DRNA 3U36B 3U2SA 5HGAB 1NFKA 1VEMA 2NXZB 2YA1A 1MVUB 4JANA 4JRXE 4PY7A 4KTYA 5CJ8A 2VDOL 4CU6A 2A6KB 4ODHL 4XBEL 3RL1A 3TV3H 5JOFA 1T0NA 4IJ3B 4ZO8A 3SQOL 2FLBT 3O6LH 3EJZC 1YNLL 1VPOL 5E1AB 4NNXA 5JO5B 4HXAL 4Q9BA 1MJ8L 4AEFA 5C07D 1M7DB 5HTSA 2AKRA 3QNYB 4Z5RB 1ZSDB 4O02H 4JR9H 4TVPE 4U4BA 3TBWA 1H3TA 1MCPL 3X3FH 1BX2B 4HIXL 1GOHA 1FL6A 1DBBH 4IOSD 4M48L 2VXUH 1IE5A 5T1LA 2EDEA 1ZLVH 2PTUA 4EZMA 3BJ91 5TGBB 3VCLA 5FF6A 4MSWA 3ZSSA 2AAVA 2JF1A 1DUYB 3HE7A 1HCVA 3LV3A 4P2OA 2EKSB 4LNRB 4OZIB 5BJTB 1ZT4B 5EZOH 2DMBA 3GUTB 3T0XA 5CEZE 1NBYB 3HAEH 4N0UA 4J3SA 4RCAA 1F6FB 3RJDA 5E8EB 1UM6H 4OB5L 5JXAH 2ATPA 3BIBX 5KOVC 2BFVH 5E8NA 3R4DA 5E00A 4Y1AB 5F70A 1A2YB 3IXTB 3DLQR 5F7MC 3CX5K 5FF6B 2ZKHL 3W2DH 4F15B 1RULL 3CVHL 4X7EC 4XNUH 2EDWA 1MAMH 3Q1SL 5CP3A 1DQTA 4LCUB 1VFAB 3QUZD 3BZ4A 4M6OH 1IAMA 1CLYL 4UOW0 3AMKA 3RWIA 3TESA 2WSKA 3SKNA 3C9NA 1WAAE 5KG9B 1S7TA 2VISA 5F6HJ 3RI5F 1BOGA 4QWWC 3HFMH 4LCUA 3PE9A 1E6OL 1FFRA 2L7UA 4Q74A 2PKDA 1N7MH 4O5LH 1VFMA 2HMIC 3S36H 2LFGA 1JGEA 1WCBA 3U7YH 1I9RH 1I8LA 3ARED 3WKNA 1S8DA 3DRTB 5KZCD 2FATH 2V7NB 1LO5B 3K4AA 3GHEH 3NIFF 4UI2A 1ZK9A 1BQUA 1Y0LB 2RAMA 5E8DL 5AZ2H 1JYWA 1NC2B 3RBSA 3JTTB 3G6DH 5CWSB 3ZO0A 3JV4A 1GGIL 4DQOH 1Z2KA 4XP9H 4JRYD 4NZTL 1RHHB 5IWLC 3BXNA 1E6JL 2I26N 3OKDA 3QUMA 5DXWA 3G5VA 5F9WC 2AEIT 5C0CE 2LAAA 1DEEA 4NC1E 3CVHH 1Q0YL 5JHDB 5BS0D 5BV7B 4JG0H 3STBA 2FWOA 3OPZH 2Z8RA 3FB7A 3NGBC 1EAPB 1IEAA 2WUCH 3QI9A 4DN4H 4GQ9L 4UT7L 2YKLL 5D7JD 1LO0L 3BE1L 3BXNB 4OFYD 3KPSD 1LQSR 4BKLA 4JO2L 4TOYL 5E24E 5CSZA 2D0GA 5SX5K 2EYRA 5F1SA 4PJIE 3UC0H 3QDJE 3GNML 1P4LB 1R24B 2NY1B 4TPRH 4N5ED 1LE5A 3P11H 2ZUQB 1I7RB 4N8CH 3BZDA 3LEVL 1BZ7A 2NY5C 3CH1B 3OR7B 4HX1B 1T1XB 1CDCA 2R4SH 3HMXA 5LGKA 5KSVA 3PL6C 3U4AA 1E4WH 4ODXA 5IW3A 1UJ3B 1FNAA 4ELMF 1JGUL 1OY3B 1CDJA 2E6JA 3OHXB 1WFNA 4X9BA 5DT1H 2NY4C 1RUML 3K74B 3ARUA 4DGVL 4XZUB 3I6KB 5FUCC 4Y5YB 5L7XH 4ZOAA 1YQVL 1KELL 2F74B 1C1EL 1OARL 4P2OD 3VD5A 1L9NA 4GRWB 2X70B 2V6HA 4ZO7A 2BVUA 5DZLA 4FQ2H 5JHLL 1XR9B 2X40A 1HSAB 1B2WH 1LILA 3G5XB 4XBPB 4G9DB 4AEIL 2C4FU 5FYKL 5EA0L 4R4FH 4JFEA 3FT2B 3DUSB 4HMCA 5B22A 1I7ZA 4GMSL 4GAGL 4EUPG 2W91A 1AO7E 1SJHB 4JJ5A 4TUJB 3QEQB 5ELIA 4ETQB 3RVXD 4K7PY 1ED3A 4YR6B 1KGCE 1ODAA 2LTQC 4KDTA 4HULB 3NCCB 5I1AB 4Z7WF 3HCVB 3ZTNL 4M6NL 1KCSH 4NFCA 3GB7A 3SKJH 4H1LG 3VA6A 2DQHL 3FN0H 3LV3B 1L7TH 5IGXH 3MOAL 4WUUB 4XPTL 1I3RB 2Z91B 4RAUA 1KG0A 3MRNB 1TPXB 4NGHH 1P53A 1D9KD 5IFHH 4M8QB 5CSGA 1WZKA 5F7UA 1T89A 1U93A 4FP8H 1T5WA 4EI5C 3L6FB 1CE1L 3M45A 5I8EB 3EFDH 2AJSH 1X6LA 4DFIA 3RHWF 4I9WD 5C7XL 2W1NA 3FHQA 1S7VA 5LWYH 4Y4HB 1HKFA 3ZDYF 3RP1A 3RHWK 2DI9A 3B8YA 1X5GA 4BELD 3U2SB 3VWKA 1WF5A 2WP3O 3C5JB 2VIRA 4F7MA 3L3JA 1WBZA 3DHMA 4HKZA 1N59B 4TSCL 4FQHB 4DWHA 1IT9L 2GYSA 2W60B 4YAQB 3FFCB 2F19L 3BW9B 5DC9B 1YDPB 2W92A 1E27A 5IV2B 2FX7H 2DLTA 2OXHA 4OUUA 1FVDB 1MJJB 2EXWC 5LXGH 4DOHB 1SY6A 5SWQB 4TQEH 4WUKH 1MCPH 3X3FL 2IANA 4KVNH 3IVKB 3CLFL 4CRPA 4DUVA 2PW1B 4QHMB 4YGVA 3A0OA 4JFXB 1DQDL 5I1EH 2LVEA 3SBWC 2Z9TA 4ONOA 1II4E 5T5FL 1IZJA 1VPOH 1CYGA 2E5EA 3VXUE 4OJFL 3I6LD 3G5YB 3Q6GL 4G43A 2J6EL 3MRGA 2VZUA 3BRGC 5DJZB 1MCOL 1Z0NA 3HHRB 3UBXI 4WGWB 3C5SB 4FFYL 1CGSL 4GMTH 4Z7VE 3ARSA 4LVHC 3CGTA 4HLZH 4DW2L 4KAQH 3EYFA 2E7CA 4JAMB 5F72S 4UNUA 3HI1B 1G7MB 5CJQH 2YSSA 4LEXL 4KMLB 2BJMH 4ZUUB 2FRGP 5JQ6L 4QOKA 3R8QA 1MVFA 2D7NA 1M6OA 2X41A 4C4KO 2XZAH 4Z7UA 2VLMD 2YHGA 4FQIL 3EYOA 3GSWB 4P5KA 5ESVA 3VGHA 2QTEA 2GSIB 5FGBC 5KSBA 1KFAL 4O51B 4XCNB 3U30C 4JLRB 2MJWA 4M61B 3RTQC 3WFCH 2DF3A 3I02B 5IJKA 3AREC 4ZDHB 5EUOA 5AUMA 3UDWC 3UJIL 5LXGL 4JY4A 1FBIH 4XMKL 1UCBL 4MCYB 4X0KA 5F9AC 3LKRA 4I18C 2QHLA 5GGRY 3KLHC 3F7YB 3QJHA 4M1DH 1OAXH 2ARWA 4ODSH 4L4VB 2CIIB 1KYOK 1Q94B 1BIIA 3WKMH 1IILE 3MNZB 3ETBF 3OX8A 4F58L 3D2UA 3MV8B 5FUZH 4G9DA 4X0KB 1VACA 5AZEH 3DIFA 3EO9L 2HA1A 3WXWL 4PRDA 3KYKL 4GG6F 1BZQK 4MNQB 2YA0A 1QRNE 5FCSH 1D9KA 3UYRH 2Y07L 2VDLL 3QHZH 5AZEL 1KTKE 1W8OA 3P9MB 4BSWA 1BQHG 4LGSB 1F4YH 1HYSC 4RBPK 3VDAA 4MAYC 4MXWH 2B0SL 5LGHL 1I4FA 2UYLB 3WS6A 2WM0A 3RWCB 4FFVC 1QBBA 2BDNH 5IQ7L 5KS9A 1MLBB 2HAZA 1D5MB 2H45A 3VXPA 1C7TA 4ZYKA 4XWGL 4YQXL 3T0AA 2WK2A 2J8UA 3DMMA 5DO2C 1HXMB 1OGTB 3T2OA 4JFYB 1X44A 5CD3A 4L1HA 3PABB 5CGYC 2E8ZA 4YAQA 2AJZB 2L7JA 4Z76A 4XVUD 3UJIH 3FCTA 5E6IC 4IRZL 1Q0XH 5EZJA 4K3EH 3UZVB 1OP9A 1ZLWH 1G7IB 1T4KB 3O4LE 2OP4L 2EDLA 5F7KC 3FAWA 5DR5H 5EIIB 4PP2B 2QQKH 1HEZB 1T5WB 2DMKA 4L9DA 3UYPA 1HE7A 2ZG3A 2AJZA 4WENB 1TENA 5D7JA 5EFIB 3G6AB 1H3PH 3LQZB 2XNAA 5IW6A 2OBGA 1E4XH 2X09A 5KSUA 4P5TD 4CVUA 4H25A 1CGVA 3RVTC 4GKSB 3Q6GH 2BRRL 4M93C 1JTOA 3THML 3IDJA 4JFZH 5IV2A 1W72H 1S78C 4NC0B 4DGVH 5DVLA 4X6CF 1F00I 5JIPA 5I1EL 1CFTB 3UAJC 3N1GC 3V0VA 3SEPA 5JW3L 3KVQA 3LVEA 1YMHB 3UXFA 1UJTA 2RFXB 1AP2B 1BZ9B 4OI8A 4P2RD 2WBJC 3MJGX 4OGYH 4G42B 4TQEL 3ARZA 4PG9B 5EC2B 4D9RD 1N6VA 1IM9B 1QSFD 4PGJA 2Z31A 4PJFA 4QHNB 3ULVC 3MFFB 5KAQF 4PB0L 4Q7DA 2GUOB 2G9HA 3OBAA 1JGVL 2D7QA 1FNEA 5MENA 4CGTA 1KCLA 1XCQB 4FQ1L 5ESQB 3VFVB 2DAVA 1M7IA 2NTFA 2JK5B 2DYPD 4LFHG 3UTTD 1MHEA 4L5FL 4LP5A 3EYOB 4HCRH 1JPFA 4M7ZC 5DMGC 3X12A 5EU5A 4FP8L 1AC0A 4HWUA 1ZHKA 1T04A 1AC6A 2VXTH 1YZZA 2K9UA 5ILTH 4RISH 5D7IF 3SJVE 2JB6A 3UTSB 4QGYA 3BD3A 5KVFL 5E2TL 3GKWL 4S2SA 2GTZA 1A6VL 1T0MB 3G9VA 5EWIH 4MQXC 3O2DA 5DJ6A 4PJFF 4M4RA 4ZQKB 1ZWIA 5DJ0B 4NP4H 35C8H 3EYQC 4TULL 1UADC 1BJ1H 2ITCA 5GS0H 5I17A 1IAOA 1XF2B 3HZYB 5J57B 1R0AL 4NCDA 4LLQA 2AI0L 4J4PD 1E4KA 2FIKA 4JGMA 5CP7A 5IVZA 5L2KE 4G9FB 4LLVA 4Y8AA 4NDMA 3OQ3B 5HHVL 4PJCF 3GO1L 3QA3A 4Z95H 5CAYB 1DZBA 1U8NA 3IS1X 4BZ2L 3B4NA 3ZE0F 3BKMH 4JANB 1H8NA 3MRIA 3QUYA 3BDXA 5KVFH 2VDPH 4ZXBA 1AXTH 4X7DC 2DJSA 3SDAB 1F6AA 4M7JL 3ES6A 4S1SH 5KAQG 4TTDC 5F71A 3EYVB 4KK8D 3NFSH 3TNMB 2FIRT 3ME0A 4R96B 1AR2A 5IB5A 4F80A 2H6PB 3SE8H 2IAND 3VXSB 2X44D 4K3JL 4GW1B 2DBLH 2FHBA 5MEOB 1FZOB 1AXIB 5TQ0H 4E0RB 3TYGL 1PAMA 3F8UB 1EFQA 3MA7B 2ESVA 5TDPA 3MV9A 5D7IB 2MQ0A 4F9LA 4M03A 3BT2H 2VDNH 3A6BH 3ZHKA 3BRDA 1G7IA 2OJEB 3O6FA 4C54A 1F97A 4C55A 3VFRA 1ZHLA 3QG6B 4N0FA 2P7TB 3IFPA 5F7FA 2R69H 4U1KA 5ACLA 3WV0A 3AAZA 5H35B 4FG6D 5B3JF 2ZJSL 3MV9B 5D7IA 2YPLE 4P2RA 5JLZB 1LO0H 4Y2DC 5E4EB 2BERA 1F42A 4JDTH 4EXKA 1ZVSA 1NMCB 3VGBA 4WFED 3RY4A 2O93L 1PEZA 4WO4A 1MI5B 3NFPB 2HFGH 3ZE1E 3FTGA 2YXFA 3BMWA 3D25A 5IW1B 2OTWA 4NOFA 5EOCL 3TO2B 3OKKB 3H7BA 1KPRB 4U31A 3H9SA 3WIHA 1N2RB 2VWEE 3VFVA 2MSPA 4HHAA 4LDOB 4Q2ZA 1MFAL 3D48R 1JPST 4RMUA 1VHPA 4OSUH 4YFDB 1L6XA 5HDBE 3SCMD 1O5DT 4RRPA 2ID5A 2X4QA 3TBWB 5DHXB 2FD6H 4TULH 4JN2A 2H2PD 5CZVL 2FATL 1XF5B 1GZPA 3VI4F 4IHOB 4HIIA 3N1MC 5DR5L 3MLSH 4EVNB 1MNUL 4AEHL 3REWB 3DVGA 4DAGL 2DQJH 4O5LL 2ZSWB 5C07B 1FIGL 2RR3A 1ORQB 1DQJB 1S7WB 3LN9A 4NQSA 2X4QB 1MCQA 3HNVL 1CLOH 4NN5C 4KV5E 3ARGD 1JHTB 3GMMB 4RDQG 4WTWA 1CLYH 4LHJB 3WJLA 3ZT6A 4HUXA 4WEUD 1PSKL 1E28B 5JOPE 3Q0HA 2ILLA 2CK2A 2DB8A 4XNUL 5F9OL 5BZDA 4R0LA 1MCIA 3FZUD 1R5WA 3HNSL 5I9QC 3S37H 1C8PA 2MQCA 4P2YA 2HKFH 2Z0BA 4NPYA 1T66D 4AL8H 1IGMH 1NLBH 3C8HA 3QUMH 4HUWB 2DBJA 1YUHB 4MXWL 1N64H 2APXA 2IQAA 4K3EL 4UIMA 3WMSA 4X7SL 1KGCD 5BS0A 3IXAA 2V9QA 5FDWA 4KRMB 5JDSA 5IBLC 4HGKC 4HC1L 4U0RC 4XP1H 5IROC 2XWJB 5DJ6B 1U3HC 3VGEA 3WLBB 3PHQA 5SWSB 5F3HA 1MCWM 5IEHA 1TTFA 1ZVHA 3WNOA 4GXVL 4NQTA 5GS1A 5I1HH 4PD4J 2BVQA 2IQ9L 5D8JL 1YEDB 3MRPA 4KTDH 2NY6C 3QWQB 4PLKD 2ESVB 1UKQA 1YC8A 3BJLA 4OBRA 4KI5D 1NAMH 1OTSD 5CMAA 4WCYH 2JJTC 3HMWL 1XZ0B 3G5VB 3E3QC 1YNLH 1OT2A 3SJVB 4GRLB 4QHKI 5DMIL 4TSBL 1H5BA 2JJWA 1I7TB 2V5YA 5D96B 3KPQA 5CEYB 3E6HA 2DMCA 1KB5B 15C8H 2XQYK 5TE4L 1H3PL 2RJMA 4FQIH 2QADB 5HGBB 2PETA 4ZFOA 4FZ8H 4UINL 2X1WL 1HHJA 1UGNA 2DWDA 1U8OA 4J12A 5IROA 1NANH 3BDYH 4NWTL 4JHAL 1R6VA 5DEGB 4IS6A 5LG1A 3RRQA 1HEZA 4ISVA 4Y4KD 4FABH 3CFJA 1ERNA 1V3KA 3EUUA 5JW4Q 4ODWB 5ERWB 4NWTH 5T33H 1NQBA 3ABZA 1T21A 3DX8A 3PWJB 2VB5A 4BFBD 5CUSH 3W11C 4NQCB 3P4MA 1L0QA 1EBAA 2GTZB 32C2A 3GSUB 3I2CL 4LRIA 4LSTL 5MEND 3ZDYE 4EKXA 5J9PA 1U3ZA 3K2UL 4JLRA 3CXDL 3BDBA 1IKNA 1NBQA 4XCFL 3C2AH 4Z7UE 2V2WB 1DQDH 1QP1A 3IDYC 1WBXB 5CBEB 2OL3L 3KPOB 1FFQA 2OTWB 1T2XA 2M1KA 1T2QL 2P47B 2DS4A 2HLAA 2XQBL 4B5EA 3WJJA 4TNWK 1N64L 4G8GB 5D1XA 3H3PL 1A1OA 2YBRB 2EDQA 1IC5L 1RK1B 1G9NH 2CRIA 3MO1B 5T1LD 5E2WH 3FFDB 5IIEB 3KAAA 3MXWL 5DLML 5EBGA 5TPWL 3HNSH 5EUKB 2NYYC 4M1DL 1WFTA 3IGAA 3EFDL 4FXGB 3VWKD 3IJHB 4AQ1B 1C5BL 4HUWA 4ALAH 4QHMA 3S4SG 2X4NB 3OAZH 5IK3B 3ROLB 4YXHL 3MLTB 3JXAA 3P73B 3JWDC 3EJYD 4JB9H 4WRLA 5SWZA 4ZYKB 4OD2A 4U05A 3I6LE 3MLWH 4G6JH 3VXUD 1AQKH 4YDIH 3JWOL 4NCC2 1NFIA 5DUMH 1XIWB 5EO0B 4PRPD 3ARDD 4NN6C 3KPMB 4PRAA 3MOAH 4GRMB 3ZYOA 3BISA 2R2EB 1MOEA 2FGWL 2NW3A 5EU6D 4EDWL 5GQBA 5I76A 4KHXH 3V5HA 4MNHB 5GZOC 4KUCF 1VEOA 2K7PA 3EYSH 5D2NC 1HH6A 5F9JB 2H32B 3VH8G 1XIWA 2QSVA 4MAYA 5C0FA 2F5BH 3OKMB 3EDKA 3HI5H 4KAQL 2VR5A 1HHGB 5C6TH 3MV8A 1SJVA 3NACL 2NY7L 2V2XA 3MCKA 1AR1C 1FLRH 3PWPA 4L3EE 1TVBB 4XPFH 2DJUA 3SHSA 3ARQA 1AXSA 4GSDH 2EXYC 1SM3L 4I48B 4XVUC 4NQEA 3VWJA 3DUUB 4PJ7F 3O8XC 4Q2ZB 1V8HA 5FKPA 4HMDA 5EU6B 5I15L 1IGIH 4GLRH 2D31B 1ZT1A 4KRPC 4FFZH 5J11C 1JTPA 1JN6A 1MRFH 1BBJB 4NQDA 3QIBD 5HHOB 4V2BA 4Y4KA 3HZKA 3PP3H 4L4TD 2BHZA 2VR4A 4XWOC 1CF8L 4QWWD 4PREB 4EUPH 1M7XA 2IQ9H 4OZFB 4PJ9C 5D8JH 4DVBA 3PQYE 5B8CC 1JPFB 3UBXG 3IFNL 4LMQI 2J88H 3QO1B 4U1JA 2P8LA 1OLLA 2VL5A 3TYGH 2YS4A 3OL2A 3P11L 3Q5TA 4OLVL 3UZQA 5FK9B 3OF6A 2FEEL 5C7XH 1CK0L 4QHLB 1A7QL 1BREA 5FHBH 5HYQB 3I9GL 1Z6JT 4LHUG 3TBTA 2V2TA 4JY5H 5C0GB 1ROWA 1MCDA 1YEJH 1FNGA 5ENWA 1TJGH 4U1NA 3BPNB 2GJ6D 3EO0B 1QRNA 3MSPA 1EERB 5GRJL 4MHHG 4U1JB 5DEGA 2C3XA 2EE6A 4Z9KB 3S88H 1RUQH 4QHUB 5D1XD 2VZOA 3TLRA 2W65B 1Q0YH 1FFNA 4CJ0A 4B50A 2J4WH 4NM4H 4WI7A 3SDCB 4XMPH 3P0VL 2EDHA 4MAUL 3OAZK 5AWNH 3IU4L 3EFFB 3SKMB 3SDXF 3WFDH 4U1HA 2CD0A 1U2HA 1HH9B 3ARGA 5CJOH 4GW5A 4U33A 4DQOL 5KS9E 3STZB 3CPLA 4ODUA 2NMSA 4HS3B 1D6VH 2NY3D 4S1SL 4QRUA 3Q3GA 1IGTA 4KI5E 4U2ZA 2VDPL 3KLAB 1PY4A 2VUYA 3QQ3A 3IDXL 3NCJL 4OM1L 4UV7L 1QSZA 4LHQB 2HH0H 3LMJL 3U1SH 1IAOB 4AK1A 1XF2A 2M8XA 3V8OA 2B1HH 3LOWA 3GBNL 3O9WC 2CDGA 4WHTB 5FYLH 2BRQA 3GMLA 2G5RA 4OLWH 3MA7A 3GKZA 5D7KD 2DQEH 3DUHA 4AZ8A 2DD8L 3TJEH 2EZ0D 3O41A 4PG2C 2NPLX 1J5OH 4LHUD 5CD5C 3GMQA 4N1EA 5FO8B 1CQKA 3DXAD 4P3DB 5E8DH 3UZEA 3VFRB 2P45B 5J6HA 3QR2A 5FOBB 1SJXA 2OJEA 4XB7A 1U8PA 4RFEB 4YXKH 5EC1B 2BNUB 4QXGH 5E08H 4MNQD 4KGJA 2JJTA 3KPNA 1RUMH 2CKBL 3ES6B 3U7YL 3D39E 3IU3B 4RGNC 2A6IA 4IIQA 5DFVC 2FD6L 1TTGA 4MQSB 4Y4KC 2HT2C 3QO0B 1NAKL 1MRDH 1W72A 1EGJA 1JZ2A 3PV7A 4X8JA 1DQQB 4PJ8B 4R26L 4JKWA 3IDMB 5DQDH 1OF2B 4JFQB 4UOW1 1YPZE 4D9QD 5H2BB 3S37X 4X99A 1J05A 1F58L 4C59B 1D5BB 4LHUB 5I1LB 5DQDL 4XMPL 1CFBA 2CUMA 2Y36L 4F9PC 1KNOA 1H3VA 1EK3A 3AU1B 2A83B 1YC7A 2IH1B 4LCYA 3C6SB 3K2MC 5DD3L 1UB5B 5DZOA 2AS5M 1A5FH 4PJFE 4O9HH 3QDGB 5CGTA 1Y6KR 5EBMB 3QDGE 1Y18B 5T1KA 1E4KC 2YPVL 4UAOB 1UKTA 1E6JH 1NANI 1UM4L 2HLAB 3QDJD 4ZAKC 1EJOH 1MQ8A 1EH9A 1OCWH 3TNNB 3DROA 1GH7A 3RAJL 2DYPA 3ARTA 1EX0A 5ACMA 1NKOA 2C4XA 1IKFL 1JUFA 1HXYB 5A16A 4ZXBC 3ARWA 5IB5B 5HHOA 1YMMB 1ZT7B 2J5LB 4L3ED 4HPOL 4XH2A 5FHAH 4QGTA 3B9DA 5HJ3A 5TQ0L 4Z7WA 2GJ6A 1U8HB 2XA8H 5C0CD 3QUXB 3KXFD 5FGCB 3THMH 1RZGA 4JFFE 3OJDB 3GMPB 3MPCA 5HHPA 3B5TA 4K8RC 3VGDA 5IMLA 3E1F1 2R2BA 5MEPB 5EO9A 3JVGA 3QDJB 2C7UB 4U1LA 4EBQH 2NTFB 1A9BB 3GJFH 2F54B 3RVVD 3KJ4C 5I17B 2M26A 1D5ZB 3ULUL 2D2OA 1BD2E 1MSPA 3T4AB 1MWAH 1O7VA 3ISWA 5GRWA 1YEHL 4RGMC 3ZKND 1K4DB 4CDHA 1FGVL 1XR9A 3OTTA 1UC6A 2APBA 2OM5A 1FNFA 4AIXA 4ONHB 4M43H 2ADGB 1WIPA 5JXAL 4YIQA 5C0CB 3S5LB 1W2KT 2CO6B 1XGTB 4PRNB 3T0EA 4N5UA 3EYSL 4JY5L 2R8SH 4HK3J 2BVYA 4OFVA 1K8DA 1MLBA 2Y07H 3C60D 4MNGA 5CMAB 1RZJC 3MNWB 4RQQB 4YHYC 3EOBB 4ZSOE 3S3PA 4Z78B 4XWGH 5HPMA 3MRJA 3EGSB 1KCRL 2AEPL 2NX5B 5HHXH 3B3IB 1XGTA 3BP6B 3VFPA 1QBLH 2A1WL 4Y7MA 1F4HA 2BHUA 1OM3H 4JPKL 3BO8A 4TVSa 3MRRB 3VXOA 5C92A 3UTSD 1CF8H 2XWJA 1MHCA 2XZZA 1G0XA 1C5BH 1VA9A 5IVNA 2LU7A 1NUNB 2XA3A 1AKJD 3MLVL 3OB0K 1ZHLB 1EFXA 4UQ2A 5GSVA 4HK0B 4DKDC 4JVUA 1UH2A 4AG4L 2BY1A 3GMQB 2VDOH 4UDTB 3BO8B 2O5XL 2EDTA 5IKCA 1KFAH 1DQLL 2Z92A 4R96A 4ODSL 3DSFL 2UWEF 4D0DB 4OZGB 1ES0B 3SE9L 2HRPH 4LCWE 1TJHH 4GKZA 1NC2D 1NMBL 1HDMB 4K8RL 4YHML 3AB0C 4FQLL 3BP5B 5GRUH 4HJJH 4F7TB 4KJQD 2EYSA 2GI7A 4NQUA 4Y19D 3AY4C 4P4KC 4RGOL 4UIKH 3PJSB 4GKZB 2X6MA 1QG3A 2NNAA 2NYYD 3TT1H 4JRXD 3VRLF 3REWA 5B38A 4GKNB 2R4RL 5DMJB 4LSQL 4E41E 1BFVL 4URTB 1WWBX 4ZUVB 1NCBH 4DJMA 1U95A 2VH5L 3B43A 2YD8A 4I18A 3BD5A 1NBVH 3HZVB 4XPHL 1OVZA 4NRZA 3KXFA 2PO6D 5DS8A 4X6FB 5KW9H 5L2KD 4YHMH 4KJWC 8FABA 3MRQA 3OJDA 4LOUD 4HZLB 4D9QE 5EO1B 5FYLE 4HJJL 5BO1H 3VRLE 1WEJH 4EQ2A 5BVJB 1MCOH 2FJFA 2FX7L 3LN4B 4YWGH 5DI8B 2KPNA 2EDFA 2HRPL 1RJZB 2DQTL 4I2XE 1GXEA 2LU3A 2EIZB 4UINH 5DUPH 3V5KB 1KN2L 1TVDA 4Y5XA 1TXKA 4DTGH 3NZ8A 1DQLH 1HXYA 3ZDXE 3MLWL 4HWBA 4ONGH 4M7LT 2DTSA 3WS6C 3V4VL 1FDLL 4RRPG 3TZVB 2AABH 1DN0B 1UQSB 2UWEE 1CGTA 3MJ8B 3RX8A 1RJZA 1UJ3A 1FNEB 1CE1H 1SYSA 2PO6B 1NAML 5KSBB 1P9MA 3NIDE 1AO7D 2QR0A 3Q5YA 3ARBD 5I71B 2BVOA 4KJPC 2XKNA 3T0ED 2D7TH 3DV6A 2UZIL 3NABL 4HKXA 1QVOA 3UTTE 4GXVH 3EJYC 4BH7A 1GSMA 5HHXL 3U9UB 1Z0MA 2V2XB 2V7HA 1H15B 3GSXA 4UDUB 4MJ6B 2ZOKA 2BNRD 1TFHA 2F54A 2VE6A 2UZXB 2UUDH 4FNLH 2R15A 4RMTA 3QUMB 1FFOA 2WW8A 4RBPH 4CN4A 2BSRA 4W68A 3MV7B 4ODXB 4AQOA 1H9VA 1E4XI 5FUZL 1AR1D 2O5YH 4YDJA 3RUGE 3RVVC 1CL7L 3LIZL 3C2AL 1SQ2N 1S9WB 1HH9A 3ARGB 1X7QA 25C8L 43CAB 3ULVD 4JFPA 2Z8SA 2MCPH 2EEBA 3E6HB 1I9JL 3WIIL 5JQ6H 4KK6C 5IOPB 3WEXA 2BSRB 2GJ6E 4RQQA 5CJXA 1HOCA 4M6ML 1Q9WA 3NN8A 4HAGA 3RWCA 5CP7B 4XNZC 4FABL 5K9KB 1OW0C 5BRZE 1C7SA 2MTPA 4PJGE 3MRPB 2VH5H 1UWXK 3N85L 1TITA 1QFUH 4PGEA 2R4RH 1JWUA 4MWFB 2OR9L 5KVGH 2IALA 4HIJA 1Q38A 1S7VB 3PABA 1Q9OB 2FL5A 3ZDZE 5EZJB 4N8CL 1OCWL 2KZ1B 3HCVA 3VMOA 3ZL4L 3CMOH 4TUKL 1YNTB 4QRPB 1FQ9C 4X7TB 2ESVD 4CBPA 1IJ9A 3ULSA 3SE9H 3VMPA 1KG0B 3BSZL 3SDCA 4YBQC 5HPOA 2F53D 3O8XD 4MSWB 5BV7L 3FL7A 4ZS7L 4KZEH 1M4KA 4KTDL 5DI8A 2LV4A 3C5ZB 3VG9B 3VGGA 3H8NA 1IL1B 3IDNB 4WU5B 3RIAF 3L1OH 2Q3ZA 4YIQB 3IAPA 3S5LA 4JM2A 4OCXH 5C0CA 1AGBB 4TRPL 2IAMD 1I3UA 3WNMA 4I3RH 3CZFB 3U0TB 2AKRB 1K3ZA 3LKQA 1HK6A 4NWUL 1FIEA 2CDEB 1WJ3A 4KJQC 3BN9C 1XF5A 1F58H 1GOGA 4Z5RA 1OAQH 1AGCB 4K7FB 5TQ2L 3HNVH 1T6WA 3RY6C 2RFXA 3JV0A 2VDNL 3A6BL 1CGYA 1QACA 4LP4A 3E2HB 1F8TL 4XXCC 3ARFB 3GJEB 2X4PA 3WN5A 4RMSA 1IGJB 3C5ZD 3FO1A 4JQXA 2WBKA 3UTOA 4PPTA 3D18A 5LWYL 4LNRA 3QAZB 5CHNB 3DBXA 1WGOA 2OSLB 3CDCA 3MLZL 4S10A 3P77B 2XT1B 3RNQA 5HVFB 5A16B 1E6OH 5T3XD 2IAMB 1CFQA 1NGXA 1LEIA 2QQLL 2I5YH 3OB0H 4BZ1L 2HTLC 1CLOL 2D9QB 4KVCL 4HLZG 3FO9A 2BC4B 3KR3H 3E6FB 1RZKC 2NY2D 3TJEL 2EDDA 4PJIF 3W82A 1D6EB 4J3XA 1W72B 4H0GA 3LMJH 2PN5A 4MCZA 4NC2B 4UILH 3U1SL 2VZSA 4LSDA 4WW1B 5ICYB 3GBNH 2GKIA 3PIQA 3QXDB 3QBTB 4Y5VA 3W2DL 5CZVH 3CFKA 3MRMB 4Z95L 3MV8E 3ZTNH 5DJ2A 3MV8D 1ZT1B 1DUZB 3X14B 2AJUL 4PP1D 2DI8A 4LKCA 1PBYA 2XZQL 3CJJA 5BRZB 1JPGA 1FP5A 4NQEE 2BVTA 1B6UA 1QFWH 3LEYH 3R0NA 1C1EH 4Q58C 2EECA 2IH1A 5K9JL 1ZANL 5ICYA 3NMEA 2FDBP 2P42B 3TYFA 1F11A 1VKXA 5D7SH 5T3XE 1QFWI 2H8PB 3BEVA 1FPTL 4YX2L 4HJ0D 5KS9F 4Y4HD 4GT7A 2A9NL 2UYLA 5DD6B 4KMTH 2GTWA 4D9RE 4LK4A 1LP9F 3DRQB 4OUUB 5GS2H 4HUUA 4YHNA 3A6CL 1A7QH 2JB5H 3S7GA 1K2DA 2AV1A 5T5NG 4N8VA 3I9GH 4HBCH 1FFPB 4Q9CA 1MCNA 4ZG1A 2WAHA 1GGTA 5DD3H 4BFIA 3WUZA 2F58L 2PYEB 1HHIA 1S9VA 2GAZA 1JGVH 5T1MB 4U7KA 1F3JA 2CMRL 3BGFB 3GMOB 5EIQA 3EZJB 3WO4B 1TQBC 3ARDC 4H5SA 4NZRH 5GGTH 1GJIA 3EW3B 4PP2A 5DK3A 5DRXB 5I6XB 1HQRB 3KPRA 3VXTA 1CXEA 4LLWB 5FDYA 2OZ4A 4TOYH 1AH1A 5DTFA 4PJHB 5GGVH 1MRFL 2CRZA 3CU7A 4Q6IB 4R26H 4ACPA 5DWUH 3NFSL 3SGDH 3DV6B 1UT9A 2R1XA 4F7EA 2V2WA 3BH8A 3CC5B 4QF1A 4LQ1A 2XRAL 2WINA 3RUGA 3DO7A 1QSFA 4JG0L 4JVPA 4NNPL 4LKXB 5DJCA 2ZP0T 2BVEA 3ET9F 3RNKB 2QADC 3GSWA 3PV6B 4NBXB 5C0IB 3BPLC 1OHQA 1BQLL 4WWKC 4BZ2H 4WO4C 1CBVH 4OTXH 2VQ1B 1FL5A 4YUEL 4MNGB 3OXSB 4ONFL 1JHLL 4JFFA 4G6AC 3RVTD 1WWAX 3NACH 1MHHA 2DWEB 2H41A 1ZGLA 3B9KB 1WT5C 4XAWH 1R3JB 1HSAA 4MVBD 1J0YA 3MREB 1EUTA 3PG2A 3TN0C 4ENEC 2R9HD 4HMEA 3IKCA 3MJ7A 1I1FB 3LAFA 2EDJA 1MVUA 2Y1VA 1WWWX 5GGQH 4HGWA 4KRNA 1NGYB 4PJ5D 4KDTC 3GJFB 4KWUA 4PJFB 4QHNA 5E2TH 3SGEH 1K9TA 7FABL 3FRUA 3WFZA 4Q6YA 3AREA 3PGFL 2JIXB 5C0JA 5H37H 4FFWD 4X6DE 1YECH 5KVGL 5EB9A 3VD7A 4MAUH 1VGKA 1WISA 1L9MA 4M7KH 4M48H 3GJFK 1MREL 3VXNB 4RMWA 1S7QB 1JHTA 1A21A 1I1AD 3DVIA 1NEZA 2M2DA 2YOCA 1DBML 1GHFL 2Y6SD 4E5XB 5D72L 5LAXB 1ORQA 1R3KB 5IMOB 5HVWA 5FFLA 2YEZA 5DQJB 5F96H 1ULVA 3QUYD 4MQ7B 4R0LC 3IDGB 1GZQB 3H3KA 4KZEL 3O4LD 4JZOA 1J11A 2QHRH 3PWJA 5ESAB 5I1DA 1IAKB 4K94L 5JW4M 4YHPB 4F3FB 4H0IA 3CFKB 4IRSC 3H42H 2R1YB 1WEJL 2Q76B 4RGNE 5T3ZD 1K85A 1DBBL 2CIKA 3TA3C 4AIZA 1YN7A 5T1KD 1DLHB 4P9ML 1CGWA 4NKMA 5INDB 4JR9L 3IETA 4EDXB 1OAXL 1RZGB 3KPPB 5JDSB 5M7QA 4K55A 1FBIL 1MUJB 4R4NC 4XMKH 4LRNH 3N85H 4G8IA 1S7SB 4JFXA 1I8KB 4WTXA 4OBSA 3NCMA 5KANG 3QUYB 3SQOH 4I5BB 5GIRB 4LF3A 2IANB 4RGOH 4OFPA 4UIKL 3IVKA 3L3OA 4Y4FC 1JGEB 1WCBB 3G04A 4H8WC 4PJCA 1MFCL 4WY7L 5C9JB 4IMLB 5J13C 2IBGA 5GRUL 3ULVH 3WIFB 1WCQA 4O2EA 1X5KA 4DZBB 1KN4L 4D8PB 1ND0B 1DEDA 2JJVA 4NCC1 4DCQA 2BMKA 1FAIL 5FV1L 3DBXB 3MV7E 1U3HA 1RURL 3LD8B 1T22A 1N8ZB 2HTLD 4LBEA 3E8UH 2CPCA 5D2LA 2GFBB 2W9LA 2XZCL 1AJ7L 2LABA 2PYEE 4L9LC 4PGCB 1NCNA 1OTUD 3C87A 4YHKH 3RWJA 5BXFA 5D1QA 4AG4H 3QQ9D 2VMFA 5I1GL 4OCLC 4K3HA 5LCVH 2QJDA 1CICC 2E9JA 3D9AH 4JFDB 2VDKL 1MI5D 1KIRA 2GHWB 1CWVA 5IR1A 3RL2B 4FA8A 1R5VA 5HI3D 4LCWD 3TNMA 5IBUG 5FUCE 1KUMA 4CVZA 3EDJA 1UZ6F 5EUOF 1AI1L 2G5BA 1QTYT 2ZUWA 3UTQB 1OSZB 4M61A 3LPWA 1I7RA 4ENED 1CL7I 1T21B 3PXHA 1TVHA 4A6YL 2Y5TB 2VDLH 5CEZD 4K94H 3SCMB 4LSVH 5JDJA 3TEUA 3RL2A 4RWYL 2C1PB 4NQEB 1JZ7A 5LVEA 5J0BA 3BPNC 3DARA 5C3TA 4ELKB 1D7FA 1I7UB 5IEKA 2X1QA 3Q6FA 3VW3L 1J9CT 1J0HA 1KN2H 2BSED 3TVMC 5E99L 2A6DA 4P46A 1HQ4A 3SDXE 2YXMA 5DUPL 5MHSE 1QFHA 1MREH 3SDCC 4QRSB 2FSEA 4NJAH 5E6YA 5I8CB 4U3HA 5LAXA 1EGJL 5CJQL 5BO1L 3UTZA 3V52L 2C3GA 2VLKB 3W39B 4IRJD 3GRWH 2IADA 2BP3A 1MQKL 3JUYA 4WUUA 1CGUA 4ORZC 5HY9A 4C56D 3ULVL 5IBUB 1OD9A 1RZJH 3CX5J 3DMMB 3JWDH 2PXYC 1H0DA 5I8OH 2HFTA 4D9LH 1MNUH 3DHJA 1NCBL 4G5ZL 4JREB 2PCPB 4XGZA 4JPVH 3MGTA 2BSTA 2NY5H 3QDAA 5LQBL 2O26U 12E8L 2J8UB 5DMKA 3HR5A 3HC4L 5D1XC 2BJML 1D3CA 4HWZA 3TIEB 5CSBA 4YPGB 3TA3D 3AS3A 1QO3B 1HYRC 3GEWB 3HPJB 5MEQB 3VFUB 2UY7A 4E41A 3QG7H 4J1UA 1KJ3H 1HHHA 4FFYH 2ORBH 4EEEA 3FFCA 3C5JA 4WWID 3UBXA 2DOCA 4MXQD 4FQHA 5KSBF 4RFNC 3NIGE 3MTRA 3C08L 4G42A 1QR1B 3NH7L 5L2KA 3REVA 1C16B 4OCRH 1A22B 1WC7A 1DLFL 3T4YA 3MJ8A 3BKCH 1KEMH 5B3NA 1AE6H 1HHGA 1LD9B 1X5HA 3AMLA 4JFOA 4LLUB 5DA4A 1CLCA 5GZND 1F4WL 3X11A 2EDOA 5DWUL 3PP3K 2VLJB 4U49A 4R2GC 3BGMB 3O0RL 3O6KL 4MQXD 3IDJB 4H20H 1X4YA 1IL1A 2ICCA 5D2NA 5GJTH 2X42A 2BSSA 3DNKA 4R97C 1LNUB 3FB6B 2A6JA 1JE6A 2R1WB 3P0YH 4TNVF 4Z7VF 5DJYB 3QXAA 3HE6A 4JFHE 2CMRH 1LO5A 1A6AB 3LPGA 2AERT 3BGMA 4DEPC 4BKLB 3UPAA 2Z31B 5F6IB 1MRCL 5EC2A 1I85A 3CFIC 2PTTB 2R0LL 4OCYL 1G6RH 5TDNB 1PQZB 4JPIA 3BE1H 5C0AA 5I75C 1OAKH 1XCQA 1DN2A 1RUPL 2P24B 3SE8L 4JGJA 2R8SL 2ITDA 1KB9K 1FH5L 4K23L 4J3OC 4E9LA 1YEKL 3VFSA 4P2RE 1FGVH 3BUYB 1JHLH 2F15A 4HWEL 5FK9A 4BUGA 4Z7WB 5FOJA 3MRGB 5CCKH 1K5NB 4R4FL 2FB4H 3LB6C 3LDBC 3DV4A 5GJSH 1J12A 3OGCB 4KKAD 3NA9H 1PZ5A 3MQIA 1I7TA 3QDMD 4XBGA 3ARVA 2JB6B 3BYTA 2BVPA 3O2WH 4HKBA 4Z0BL 5LBSH 1FVEA 2I24N 5ID1B 3ARPA 1PLGH 4LAJH 5C8JB 2MFNA 5AZ2L 2XYCA 4PP1C 3ZE0E 1R0AH 1OARH 4NN7B 3MUGB 5GGRB 5I2IB 3L7FB 2XN9D 4X9GA 1FAKT 2ADFH 3L95A 5IMKA 4AEHH 2B5IB 4PJCE 1T1XA 3W0WD 35C8L 4NRYB 5T1LB 3KJ4B 4HV8B 1Q9KB 5MI0C 5BRZA 1MUJA 4PRDB 4HPYH 4PJGA 2R23B 1U36A 1CXKA 4WDIB 4F7CA 2EYRB 2FB4L 3LY6A 3P9LA 2NXZD 3BWUC 3ZDZF 1P4LA 3MV7A 3JVGC 3J8F7 3FOMA 3QA3B 5AG8A 4KXZI 3N1FC 3RAJH 1BECA 3FFDA 5BW7A 3QDMB 3IXAB 4NDMB 3R1GL 2YWYA 3SE3C 3KPSA 1EJOL 1BBDL 3RX5A 4NZDA 3WFEH 1BEYH 2WQRA 4F37F 4R4BA 5F89B 5IFJB 1HQ4B 4WVRA 3VFPB 4K3DL 4GAYA 3WS3B 4PYGA 5L7XL 5IVXE 2EYTB 4U1SB 1MRCH 4HQQH 4FRWA 3CMGA 4M4PA 1HZHL 1V7ML 1VSCA 4MA1C 2ZNXA 1MFNA 4P2OB 3FB5B 1I8IB 2WINB 1JZ8A 4JDTL 4QTHB 4BSWB 2BX5A 4HDIB 3TO4B 1U8PB 4RFEA 1C08A 5KJRH 4HS3A 2I9TA 1G7JA 2C3VB 4KU1A 3DRTA 4HJ0C 2X7LA 2QSQA 4Y4HC 1UVQA 3FT2A 3CIQA 3MV11 2HG5B 3G6AA 3MGOA 4HSQA 5L8JB 4PJIB 3RGVB 4J3WA 5HHNB 2IBZX 1U92A 3JTSA 2JJUA 1OTSC 4WHDA 2X4UB 1OP3H 3QWRD 5EO1A 4PRPE 1XH3A 3LKPB 4CN6A 5HYIA 2QADD 4PGDB 3S36L