1IFHL

A detailed analysis of the free and bound conformation of an antibody: x-ray structures of anti-peptide fab 17(slash)9 and three different fab-peptide complexes
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
217
structure length
217
Chain Sequence
b'DIVMTQSPSSLTVTAGEKVTMSCTSSQSLFNSGKQKNYLTWYQQKPGQPPKVLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSNPLTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 17/9 FAB (LIGHT CHAIN)
publication title Detailed analysis of the free and bound conformations of an antibody. X-ray structures of Fab 17/9 and three different Fab-peptide complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 51
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1993-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ifhL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ifhL01
4XPTL 1OGTB 4PV9B 5KS9B 5EU7C 3N1FC 3V52H 1S9XA 5I71C 1H0DA 4AEHH 3GBML 1IZKA 4PJCE 2Q8AL 1X5GA 2DWEA 4FZEL 5IBLD 5TDNA 4X6CE 4JKPL 2KZ1B 2HFFA 1FFPA 4HKJB 2C3XA 2R1YA 1WAAA 3T65B 4APQA 3NMEA 4D8PB 3HAEA 3MV11 1P69B 3KYKL 1CLCA 3B5HA 2R0WH 1E4XI 5DUBA 1CXEA 2X1PA 4Z77B 5E08H 2JELL 3C9NA 3PWLA 5I2IA 2VN7A 4UT7H 3KYOB 3MJ9A 2V2XB 3K2UH 4YR6B 2R8SL 1F4YH 3BEVB 3DX8B 3UTSA 1YC7A 1U95A 3MREB 4DWHA 4EUPA 3DVIA 1BVKB 5FKAA 1W0YT 2WK2A 5SWSB 3HUJA 4XCYB 4KKBD 1N3NA 4X7TA 4ZG1A 4G43B 5BMFH 2NY4D 3RZWA 4MHHI 3DNKA 3GSVB 5IWLC 3ZKXB 3ZTNL 5ID0B 4FQHA 3M17A 3RHWF 4OLUH 5JNYA 3BWUC 1I8KA 5E7FA 2F53D 2C7UB 3FQXB 4OV5A 2P24B 1RV6X 1YZZA 5J89A 4JAMA 1YQVH 4HLZH 2Q76A 3MZTA 1EVUA 1AGBA 3SKOA 4ONFH 1OF2B 1SYSB 2DRUA 3NN8A 2C26A 3RFZC 3HZVA 1I85A 5GSRA 1E6JH 1QLEL 4GO6B 1ZOXA 4KZEH 3RHWK 4ZFGH 2R1WB 1JPFA 4NKDB 1OAXL 4S1RH 5IW1A 1CFVL 4Y19B 5E8EB 4TNVK 5FUOL 4CN6A 4QXGL 4PJHF 5E70A 3KPOA 3SE8H 4N0FB 4OSUH 5TQ2H 3JUYA 4WFEE 1I9RL 3T77A 4AH2A 5EC2A 2BNQA 5FCUL 4P2QE 3TYGH 3VG9C 5GGVL 3QIWD 4X7EC 4X99B 1AXSA 1T1WB 1C5CL 1S78D 3CFBB 4MB5A 1NBZA 3GRWL 4WO4C 5I74B 1UM6H 4JM2D 1VENA 4BJLA 1LE5B 4NO3A 5C9KA 2IGFL 1UEYA 4LLQA 3VH8A 1GZQB 1JF1B 2FX9L 2IANE 4YLQT 1U8HB 1MUJB 5KSBF 1BP3B 3MO1A 3EGSB 3GSWA 4U33A 4HBCH 1AGDA 4MAYD 5AWNH 2DM7A 4OFYD 3CMOH 4GRWB 1E27A 1QSEE 5J11B 3TJHD 1JNNH 2QSCL 1MY5A 2MFNA 4UTAL 3IDNB 1U6AH 4QCIB 3RVWC 1TVBA 5CD5D 5DK3A 5JHDA 1JPTL 4XBGA 1LE9A 5K9OB 1OSPL 1KPUB 4R6UA 5I8OH 3LEVL 3O11A 4GBXD 3T8XB 1BF2A 3S8WA 3GB7A 5E2TL 3WSQL 5JXED 5D7JC 2Q7NA 1NL0H 3G08A 4LLMA 2NTSP 2XWBB 4DAGL 3U7WL 2GY5A 3VDAA 5INDB 2IFFH 5HYSA 2OXGA 4IS6A 1NUGA 5D6DA 5AUMB 1SMAA 4F7MA 1NFKA 5IMLB 4FFYL 4HAFA 2G9HB 1JYVA 1ZGLA 4R9HA 1A02N 4A6YA 5F1IA 1AGCB 1KCKA 3S7GA 1A64A 1I8MB 1JPST 5JW3L 5GS2H 4OI7A 4Y4HC 1JZ7A 2DL9A 2QQLH 1NMCB 2XA3A 5HVHB 1GGTA 2DQIH 3E0GA 2BSSB 2FJGA 3HI1A 3T0EC 1KC5L 2GIYA 3AREA 1S7SA 3N9GL 4ZO7A 1G7PB 5C3TA 4L9LC 2EICA 3H7LA 4LPWA 1PZUB 4P46C 5KAQF 1KCUH 4HUNB 1PVHA 3KPNB 4M1DL 4UDTA 2L7UA 4L5FL 3QNXB 4J6RL 3SY0B 1OOAA 4ZSOE 3S37L 1HEZB 5E6IC 5DMJB 1A9BA 3GFUA 1SEBB 4XRCA 4JFPA 3TT3H 1KUMA 2F15A 4M1GH 1LEIB 2VDPL 2VZVA 4MCYB 4P2CG 3RJDA 3ROLB 4WJ5A 4XVTL 4RAUB 5DZOA 1C16B 2EYSA 5LGJB 1CLYL 4B41A 4P4RA 3E3QE 3P0YL 2ZJSH 3B4NA 4N0UA 4QRQB 2X4NB 1MWAA 4P4KD 4X5LA 1JK8A 4MJIE 1DE4A 1S5HB 2Z31D 2OMNA 2OTPA 3KLHC 1ACZA 4MNHA 3D0VB 4LCWA 3OZ9L 4PRAB 2IMNA 2DLFL 2N56A 3HNVH 4YPJA 4FQPA 4P2RA 3CC5B 1FL5A 5EULV 3KDMB 1A1NA 1F4WL 1QP1A 1IFHL 4Z7WF 3LHPH 3QIUD 3VW3H 5I8EB 2OTUA 2HJLB 1LNUA 3PIQB 3TPUB 1CTNA 1HQ4B 5DQJB 5K9QG 3TPKA 1JBJA 2QADD 4JFQA 1C12A 5I17A 5IUSA 3SDCC 4QNPF 1KLGA 2NZ9C 3X3GH 4GAFB 4OGAD 1SM3L 2B4CH 2IAND 4X6DB 3TH3T 4KPHL 1NBVL 5BS0D 3RA7H 5IT2L 4LLAA 4GSDH 1WAAE 3ARBA 3E6FA 1H8SA 5CGMA 4KTEL 5DD6A 4NUJB 2OSLB 4WGWB 4NZUH 3C5ZC 5EOTB 3FQTA 4YDLC 3O3UN 5DRXA 1QSED 3SDDC 3TYFA 1I8IB 5IOPA 3Q6GH 1A5FL 5M95B 2UZXB 5GGTH 1S7UB 3V0WH 3QRGH 1ZE3C 1IM9A 3SGJA 3MPCA 3VCLB 5TE7H 3UTSE 1JGDB 4L4VE 4QOKA 5I76B 3SKJL 4HMCA 3PUCA 1JYXA 1JJUA 4I13B 1I7ZB 1IRAY 4JKLA 5DMGC 3ILQC 4YBQD 1KTLA 3QG6A 2YD9A 4PLKD 1CS6A 5JTWA 3WFDH 3WL9B 5FF6B 43C9A 5A2KH 5C0ND 2GTZB 2HFEA 3GEWB 4RGNE 4K3EL 4OLXH 4Y16B 4WWKB 5E8PA 3QH3A 4ODVL 5L7XL 4OKVA 4YUEH 2ICEA 1V7ML 3LPGA 2R56L 3JBG7 3VRLF 1M71A 3QO0B 3OB8A 3V0AC 5CWSA 4H8WC 3MCKB 1T66C 4XP9H 4X5XA 4OM1L 1S7VB 5GS1B 3T2QA 2I24N 5H37H 3QUZA 1ZT7B 4PRPA 4MS8C 3MRKA 1Y0LB 4Z7UF 2NXYC 2VWEE 1FNEB 3H9YA 1BFOB 1MHPL 1MQKL 3KLAA 5GGUB 5F7UA 4ONOA 2A1WH 1JI1A 1MCKA 3QUYC 2W07A 3IS1X 5I71B 3GMPB 3VH8G 3UZEA 2VABB 1T20A 5ALBL 1T3FB 1QLFA 2BNQE 4Y8AA 1D9KA 4LSPL 3HZMB 3RY6C 1C7SA 1B4JH 3UPAA 5LG1A 1OGAA 1KGCE 3LKPA 4KY1L 3GIZL 5E8OA 1DBBL 3E6HB 4MJID 5GPRA 4IIQC 3HMXH 3UCRA 4HG4J 1TZGL 3LVEA 3V0VA 4RDQG 2Q3AA 1YJDL 2VITA 2WBJC 2YRZA 3IXTA 4KKCD 4OTXL 1I1FB 1BFVH 2LAGB 1T6WA 1A7RH 3NBNA 4WTXA 1XGUA 4M00A 3CMGA 2VERN 5HHPB 2J4WH 5CGYD 5F7DA 1HHHB 3KPSB 1TZIA 5C0IB 1ZAGA 1CF8H 1FG9C 4KRLB 1PLGL 2AV7B 5FUZH 2CR3A 2IPKB 2APVA 3KYNB 4NIKB 4LCIH 5EO1A 1FNHA 4M4RA 2EDDA 4JDZA 4KVCH 4YHZH 4R97B 1QFPA 2OZ4A 4OCSL 2AJ3A 2YMXL 3HE6C 5DJXB 1ZHBB 2IALA 4PJ7B 3C09C 5HI4C 2PW2B 4L9LA 4NO0A 7CGTA 2W9LA 4APQD 2DQGH 1A6TB 1LEKA 4MB4A 3RUGF 1RUPH 1DQLL 1E4WH 1H8NA 5LCVL 4ZD3H 2PR4L 2AJVL 1CDJA 2O5YL 3MRPA 5CFHA 4NRYA 2ENYA 4P2OC 4PJIF 3O6LL 1MCOL 4JY4B 2J88L 4LBEB 3T2NH 1J1OH 1G7IA 4U6YB 5DJ0A 2EZ0C 4XPHL 3UTSD 3BJLA 5HHQB 5FK9B 1A7OL 2FLBT 3W0WA 5IW6A 4M93B 3OKMA 3ARPA 2E7BA 2H32A 1H5BC 1U8OA 1KLUB 5H2BA 2VXUH 3L5JA 4PJXF 3VA2C 4TOYL 3V6ZA 5BVPH 2L4OA 1HOCB 3H0TA 25C8H 3MMEB 1S9WA 1SBBA 4RGND 4WO4B 1VKXB 2FBJL 3S36L 3SGDI 4F9PC 3TNMA 1ORQB 3AMLA 5FOBA 1WICA 3IF1A 3L5XL 5FOJA 2OQJA 5F7LB 3TCXA 4DN3H 5GRZA 1ZHLA 2CRZA 5TE6H 3WDHA 1YC8A 3GSNB 4JFZH 2AXFA 4N0UE 1T1ZA 2XA8L 3HI6H 1AD9A 1UWEL 3QJFA 1KIRB 1PZ5B 3U9PH 2FIKB 3ARSA 3QXDA 4KJWC 4JZJA 4LCWE 1X5AA 2DD8H 4J3SA 1SVZA 3U36B 3FB6A 1G9ML 4GLRI 1XGRB 2AGJL 3QDGA 5DVOA 4P2RE 3CCHB 1ZV5A 2BNQD 3V5KB 2I25N 5IJVA 3OKNA 3SCMC 1P6FA 1T4KB 4NJ9L 4KRMB 2OJEB 1KGCD 3KJ6L 2I07A 1KSRA 5B38A 4PJEB 2HKFH 2R1XA 4L8SB 2V17H 4GG8B 3GSNH 4M3KB 4NC1E 1AP2B 1JFQH 4GKSB 1A1OA 2ZUUA 1MQ8A 2EEDA 4HUWA 4TQEH 1W72B 2DLGA 1IAIL 1LILA 4JDTH 4PJ5A 4NRXB 4Y4HB 5DDHB 1EZVX 5IGXH 5AD0B 2P5WA 4F9LA 3T0EB 3UAJD 3AB0C 4RGOL 3BZFB 4KAQL 4ELMB 1MJUL 3HS0A 4ZYKA 4TVSa 2QHRL 2VLJA 4HG4K 2HTKC 4MYWB 3IFLL 4C83A 1WZLA 3IU4H 4PRHA 4DGIL 4X6FA 3G6JE 4Y4KA 3UTTB 2FX7L 4OGXH 4XVSH 1KCRH 2CMRH 4H1LA 5DYOB 3VGDA 1QD0A 3LH2L 3VDCA 1XR8A 2PF6A 3RPKA 5C6TL 5JHDD 4GAJL 1DLHA 3O6MH 2COQA 2HN7A 4QOKE 4FQ2L 1FGVL 3WNOA 5ALCL 5DC0A 1KJ3H 1I1AC 2JK5A 4LRIC 3VXSB 2NY0B 3CZJA 4K8RC 1S8DB 1FZOA 3GBNH 1A7NL 5LWYL 3UZVB 3ZKNC 2BJML 4PIRF 2ARJQ 4O5LL 6FABL 4KK5C 1RJLA 3WNNA 2P5EB 5DEFA 5KSAC 1AO7E 3EYOB 3O2DA 5C0RL 5IJKC 3OBAA 4QT5B 5DFVC 5DO2D 4BH7B 4YHKL 1QFWH 1R3JA 3A67H 5ANMB 2OK0L 2OMBA 1CGWA 1SJHA 5D2LB 3ARED 5F7MC 3GO1H 4O02H 1NC4A 3DYOA 1UXWB 4IIQA 3H3PL 5E94B 3DTXA 5F9DC 5LGHH 3DSNA 1UKTA 3L3JB 5J0BA 1HHIB 3QBTB 4IOIB 1OB1A 4XVUD 1MCHA 3MYJB 43CAA 5FGBA 5D7LB 1PQZB 2AJSL 2HRLA 3SDCB 4TTDC 3T0AA 3OR7A 1RIHH 2O61B 3C87A 3ZSSA 2WWKO 4L4TA 4N9GA 4HHAB 1AI1H 2ADFL 1BD2A 1Q9OB 2WWMC 2A9ML 4FQXA 4H0IA 1KG0A 5KVGH 1OGAE 2YPVL 3AM8C 1NCCL 2J5LC 1A3RL 1IC4H 5DJCB 1MREL 3FB7A 5BV7H 3P0GB 1N0XL 1Z0MA 2VLLB 4LCWD 1XGQA 1FDLH 4G5ZL 1T7YA 1IGTA 3DBXA 4H5SB 1F4XL 3ULVD 3VXQA 1RZGA 5AG9A 1LD9B 5FYLE 1NMAL 4P2RD 2BNRB 3AS0A 3ARTA 4G6ML 4PV8B 3BKJL 3UBXB 4HS3B 1RZ7L 3BW9A 4OLWL 1AJ7L 1M7DA 2EXYD 4GQ9L 5DURB 2XKNB 3S4SA 3BX7C 4QHNA 4KK8D 4BSWA 3RWGA 4HXAH 4O2FB 4HQQH 1JHLL 1B4RA 3LEYL 5DI8B 2GSIB 2IAMC 2AJXH 1F6LL 4CDGC 4DVRL 2R4RH 3ARBD 4JJ5A 3G5ZA 4E5XA 3MLVH 3FFCB 4CDHA 5BZWA 3VXUB 1PG7X 3FOMA 2R69L 3IVKA 1I1YB 1BVLB 1U58B 3RTQC 3PL6A 2NYYD 3QEGH 5DR5H 2NXYB 3TO4B 4U1MB 5DMIL 4ZTOH 2LVCA 3BI9X 1IM9D 2VSCA 3GSXA 3QUYB 1C5DB 3IDMA 4AY0A 4G8GA 4QOKD 1KJVA 4PJFB 5BVJA 1E6OL 4JB9H 3BAEL 1HQRA 1G0XA 4M6NL 3A6BL 2SEBA 4K71C 1A6PA 3JWDL 2X4UB 3CU1A 3QPXL 1CGSH 5DHYB 4LEOA 3NA9L 2WSKA 3DRTB 3Q1SL 1W0VA 1ES0B 2C1OA 2NR6D 2HTLD 2YD7A 4GRLB 1U3JA 3GMMA 1P7KB 2EH8H 3CU7A 2QR0B 1YYLL 4PG2A 1OARH 4ZDHA 3DVFA 1TJHH 4FNLL 1H3PH 3FT4A 4LLDA 1DUYA 3IGAA 1FLRL 2AKRB 3BPOB 4DCQA 3QUZD 2HJKA 4PRPD 2I26N 4U1GB 5DRNA 1ONQA 2XXCB 3LKQA 4Y5VA 5EUOA 5B38G 4R7DB 4K7PX 2R0WL 3CH1B 4CADB 5CCKH 4M1CC 5FA3B 1QPPA 2W9DH 4KMTH 5IHBA 5CJOH 2Y06H 1FORL 3LMJL 3RL2A 1HH6B 3HE6B 1MCWW 4X6CF 2VB5A 3TNNB 1VACA 3MCLL 5HI3D 1CU4H 1D9KD 1AGFA 4PGZA 4K7FB 4L8CB 1HE7A 2IF7A 1OGAD 3C8HA 2A6DB 1NFDF 5IFHL 4YX2H 4G9FA 2R2EB 1Q94A 3SPVA 4F57H 1FSKC 1R3KB 4P2OB 2F74B 4Z78B 5DRZB 1FJ1B 3OR6A 4PJ5E 1TJGL 4FFWC 5E99H 5FYLD 4X9IA 3V6BR 2Y9RT 4QRRA 2P5WE 3RY4A 4EDXB 1Z9SA 4CAGA 3P0VL 1MRFL 4J3WA 2VLJE 1B90A 1H5BB 4WHTA 3GI9L 3OXSA 4S1SH 3IDGA 3VGEA 4E41A 4PRHE 5F6IC 2R23B 1FVDA 4X6BB 2Z92A 4GKZB 3OX8B 3WN5A 2XV6B 1E6JL 3UC0H 4YFLI 3RGVC 4I48A 5BRZE 2QL1A 4LP5A 2HG5A 3D3VA 5L2KA 4YIQB 2PW1A 1RIVH 2UZYB 3RL1B 4NO0D 1KTRL 3CVHB 4WVRA 4N0RA 5I16B 5TQ2L 4J4PC 3UJTL 2J6EH 5HGBB 4N8VB 2PTTA 5D70L 4YO0A 3TYGL 5CEYB 3TV3H 2BHYA 3B9VA 5F1NB 1MHCB 2HRPL 2NY1C 4DW2L 4H88H 1CIDA 1A6VL 3A0OA 4DEPC 4BK4A 4HUUA 3BD5A 1HYRC 5IEHB 2FJFA 4TUJA 4KMLB 3HLAA 3L95A 4MNGA 3LS5H 1X5JA 1U2CA 3QWOB 3CK0H 2XIDA 3W0WD 4XXCA 1MFNA 4LVNB 4TULH 4ENED 5FYKH 1TCRB 4PS4H 3VXNB 3EO9L 4DK3A 4KZDH 1G7QB 3DWTA 4JN2A 4YHIB 3ULUE 5HVGB 3CVHH 1FN4A 4OLYH 2XI9A 1M4KA 2NY4B 4IRJD 3TBSA 5IEKA 5TGBB 3S5LA 1ITCA 3VD4A 3IDJA 5D2NA 4L4TE 5C70A 4F7EA 1BD2E 4BKLB 5T5NG 1VPOH 1L4IA 3LV3B 4RMSA 2F53B 1MF2L 3LKOA 1X6NA 3LB6D 1QVOA 5CJBA 1UXSA 3TBTB 2RBLA 1QR4A 3GGWA 3FQRB 4NJAH 2ID5A 4N5UA 2RGSA 4Z7VB 1CL7H 5CBAA 4FABL 3MJGX 1ZT4A 2IAMA 4JPIA 4HUVB 1TETL 1N6QL 3BH8A 3TT1L 3I3BA 4PBXA 1KNOB 2Z93A 3QDGD 1G6RH 1BBDH 4XVJL 5B8CA 4WW2F 4LAQH 4M7LH 1K6QH 1N7MH 2ZG2A 4XNYH 4YDVB 5F9OH 4PG9A 5GS0L 5GZOC 2R9HD 4PRBA 1T5WA 2OL3A 1FNGA 2YUWA 4PJ8C 4X9BA 4OF3A 1MJJB 1GOFA 5EOCL 5M94B 4JQIH 4FFVD 4XPGL 2E3VA 2RFXA 3ARDA 4XCFL 3V7AG 1R5IA 3QIWB 3ZHKA 5E24E 5GRYA 3FN0H 3LKNB 2PUQT 2D9QB 1UB6A 4PJ5D 4QYOB 4EZMA 2CIKB 4JM2B 3MBXH 1NUDA 1FFOB 2P5WD 4LSRL 4JHWL 3D0LB 1Q38A 4NKIH 4TUOA 3VFRA 1O0VA 2WIIA 3H9SB 4FXGA 1HHJB 2HT2D 2VLJD 4KHTL 4PJDA 1CGVA 4PRHD 1NUNB 1JCKA 3SE4C 4Y4KD 1J12A 2W65A 4LLYA 2XXMB 3UPCA 4XNMB 5C0JB 2FBOJ 4R4NC 1P4IH 5I1DA 4CVXB 1P2CA 2OI9B 3U0PA 4O2EA 4G8GE 2F5AH 3V8OA 1TJIH 1G0YR 4PJCB 5HDBE 3QQ9D 4GBXB 4L29B 2ZNXA 4GXVH 5DS8B 1D6EB 3PXJA 4PLOB 2IQ9H 2J5LB 4LDLB 1UCBH 3LHPL 4N1CA 5C8JB 5E1HB 3VW3L 2R15A 2DQHH 4JRYA 2D0FA 1J10A 2DOCA 4AIOA 1F11B 3LD8C 5AAMA 4JANB 5FHAL 3TVMD 3IFOB 4GKOA 4GMSL 5B3NA 1KIUA 2AVGA 3QWQB 1U8NB 2GJZA 5EBLB 1YPZB 2B4CL 1CVRA 4O9HH 3TZVA 1NC4D 4EQ3A 3IU3B 4TUKL 3RKDD 3RWJB 3SBWC 5L2JA 4MDJB 4KHXH 3EYSH 3QFJB 5D5MA 2XZAH 2VC2L 1CFNB 4K3JL 4NZUL 4YDKL 2GK2A 3JV4B 4G8IB 5F6HJ 1RVFH 2YRPA 5FO8B 1WWBX 4PTUB 5B22A 3WXVL 3R06A 3ZDYF 1QBAA 1QKZL 5ADPH 2W0KA 4ORGA 1FFNA 4L4TD 5FV1L 5GRVL 1BD2D 4WIQA 1T03L 1IGMH 1WAAF 4FQXD 4HFWB 2FCBA 5TE7L 3BP5A 2BRRH 4LASH 4PGBB 4LNRB 4R2GC 5CGTA 4UV4L 3F6IA 4NKOA 2Q87A 1P4LA 5EZLB 3TJEH 3DSFH 4U1SB 1BX2B 1Q9LB 4LSQL 3P40A 4OJFH 1LO0H 2ZZUT 5I75B 3C8DA 2Z31B 3DURB 1NGYB 4A2MA 1OAQH 4P9ML 5DJ6B 2CSPA 4UTBL 4WHYH 1TFHA 4HWEH 4R3SA 4JG0H 2DI7A 1U42A 3HUJF 4X4XA 2Q6WA 1OHQA 1CIUA 4E41E 1DLFH 4XP9L 3ZE1F 3MLTB 2FATL 2X4SA 4P2QB 1KYOJ 4CNIA 4HPYH 4LDEB 3V6OC 3QIUB 1CLZL 2ATKB 3MRRA 1ZVSA 4PYGA 3BE1H 3MRIB 4F2MA 1XCQB 5JLZA 1QHPA 3HTLX 3D3VE 3X3FH 2QADB 4TRPH 5L2KE 3BZEA 4DGYL 1AH1A 3SKNA 3LS4L 3WNMA 1QNZH 1AD0A 1BLNA 5KOVC 1FZMB 3PGCA 2AXGA 4JPVL 4TN9A 2VISB 2IANB 5ESVA 2XY1A 4HXBL 1UWGH 4L3CB 1OPGH 1XF4A 1P53A 3KAAA 3PL6D 1Q0YH 4NQUA 2FNBA 2QLVB 4CUCA 3SJVE 4PTTA 3ME0A 3L3GB 2WLYA 3QUKB 1QSEB 5EZJB 2VLKA 3WXWH 5HDQL 3WFCH 4G8GD 4KRNA 3V79C 2XKSA 3S5LG 4TVPL 1BFVL 3MFFA 3O9WC 1A7RL 2EDJA 4UIKH 1IT9L 1FL3A 1UKSA 1YUHB 3PP4L 3ULSB 4PGCB 2EDQA 1JF5A 3OAYK 4OF7A 3IKKA 2GITB 3JUZA 1PY9A 2YD1A 1OTUD 4HJGA 1MCBA 5GXBB 1NC2A 1UJ3A 3G6AA 3G5VB 5HDLA 4HPOL 4JFXB 4OFPA 4PR5A 5D2NE 3VFOB 1G0DA 3Q0HA 4NC1C 3MRBB 2Z9TA 2EIDA 2MKLC 3KNBB 3TM6A 3UYOD 1CG9A 1GL4B 2BX5A 1HCFX 1MHEA 2DQGL 3M1BB 2BOCB 4RDQF 5EG6C 4FG6D 1J5OH 5FHBL 1T7ZA 3CZFB 5F6IB 1JNHA 4R90L 4NT6A 1E4WL 5CHNB 5DD3H 3V5DA 5B4MC 3ZE2F 1MJ8H 1IC5H 3RGVB 5F7KC 2BSTB 3ZO0A 3T2NL 3EOBB 5C9JA 1OWWA 1FVCA 4ZSOB 1GXEA 5EIVA 4GQPH 1MCPH 3O3EA 1YNLH 1HHKB 1PJ9A 3SE4A 4M5YH 5I1GL 3OKLA 5JQHC 2CPCA 3CXHK 4KXZH 5TQ0L 3SO5A 3MJ6A 1IM3A 1QA9A 3TO2B 3CLEL 3STBA 1UYWL 1NGXA 3BQUC 3QHZL 5FM8A 4K55A 3TA3C 1IQWH 3BD3A 1U8LA 5J6HB 3ARVA 4NQVA 5LGKA 3QNYA 4OB5H 3LN4B 5E00A 3FO2A 1GYAA 3U4AA 3QAZC 3C6SA 4JDVB 1JWMA 2YA1A 4ACPA 1N2RA 2FECI 1U8QB 4QEGA 3H9HB 5D72L 3SDXE 4YHNA 4DN3L 4E41D 3Q48A 1JUFA 4JFZL 2AK4A 2ICCA 3WCYA 4JZOB 1BGXL 2W38A 4DGVH 5C2BH 3RNKA 4PJBF 3HI6L 2AJYL 4QRTA 1KEGL 4XHJC 5I6XC 4YWGH 3U9PL 3ARUA 3VRJA 4NN5C 3D3VD 4ISVA 5L2KD 5HD8D 4WTWA 2DD8L 4FFZH 1MAML 2Q86A 4FQIL 1S9XB 1H0DB 3L1OH 2FR4B 3WKML 1KYOK 4W4NA 5D1QC 2NY5C 5TDNB 3G5XA 4OUUB 4PJAF 2YZ8A 1NGQH 2A74A 2HFFB 4CJ1A 1FFPB 4ZPTA 4OIBA 2ARJB 1L6ZA 4APQB 5LXGL 3HAEB 4JRYE 3V9FA 5TE4H 3N1QC 2WWKT 2UUDK 1SQ2N 4PP2A 4PLJD 3ULVF 3MLWH 2V17L 1B0RA 2AQ2A 4HUXA 1OW0A 2FJHB 1JGUL 3PWLB 5HGAA 4NHUA 1S7TB 2DQFA 2DBLL 3QB7C 4KK6D 3UTSB 1S9VA 4L4VB 5D5ME 5D7IA 1U95B 3D9AH 5ESAA 3U1SH 4IDJL 4ZNCD 1YN6A 4EUPB 4MD4A 2RJMA 4WI6A 1PFCA 2CH8A 5KSUA 5FKAB 1OT2A 1JMZA 4X7TB 1N3NB 3B2UD 1SMOA 3U83A 4GUPA 5DWUH 1BREA 4OGXL 3HAEH 1F6AB 5L9DL 4RGNB 4FQHB 3M17B 1RUQH 2H8PA 4YNYB 3T0VA 1ZS8B 2D03L 5JNYB 2MMXA 1I8KB 3ES6A 2Y07H 3U7YL 1WK0A 1C5BL 1LDPH 2EE9A 4P3WA 1E28A 1AGBB 1D7FA 2XFXA 3MCG1 1W72L 3MJ9H 3O4OC 5FB8A 1F02I 3NN8B 4MMZC 1EEZB 3GBNL 5GSRB 4XI5D 4HZLA 1KF9B 2WAHA 4EUPH 5GQBA 1T2XA 4X8JA 5IW1B 5C7XL 4OBSA 4TSAH 5D7KE 2RCSL 3VRIB 4BQ8A 2F5BH 2VZ3A 3KPOB 1NCAH 2DLTA 4ETQA 3GJFA 4XT1C 3BP6A 2ESVA 3M07A 4YXLL 1NCUA 2XACC 4AH2B 3T1WA 3IJYA 2BNQB 4Y2DA 3RWCA 2W9EL 3ARDD 4NNXA 2WBWB 1AXSB 3BYYA 5F7YC 3B6SA 2Y1VA 1NBZB 3FL7A 5EZIH 1CFBA 4N9OB 1XEDA 3LD8B 3MBEA 4LLQB 4IRJC 2BVQB 3QQ3A 4NGHH 1JWUA 3VH8B 4YZFE 3OB0K 1F8TH 5GJTL 2W91A 1AI1L 3KPTA 3PXHA 4DUXA 4WENB 2ZUWA 3O2VL 3OAYH 3FN3A 1NBYA 1QHOA 2GUOA 5IM7A 3MO1B 3GSWB 1JN6A 4MJ5A 4LCCA 5IQ9A 3LDBB 2VR4A 2FHBA 1E27B 2EKJA 2PO6C 1RULL 1Q0XH 1FDLL 1EMTH 1TVBB 3I9GH 4M9OA 5IB1A 1F5WA 3HR5A 4XBGB 1O5DT 1LE9B 4YE4L 3GB7B 1BJ1J 5JUEH 4QHMA 1CK0H 1Y6MR 5DK0A 4LLMB 2KQMA 4IM8A 4C4KO 4I3RL 4ODWB 2MHAA 4JRYD 4F7PA 4I5BA 4M7KH 1BHGA 5HYSB 1F3JA 4IS6B 4F7TA 2AXJA 1YQ2A 4N5ED 1T2QH 1QFWM 3WJJC 4A6YB 5IVXE 4NQDA 4LSUH 3TZVD 4GMTL 1HINH 4JFDA 3CFJA 3QHFH 1TZHA 5BO1H 3BQUA 3HI1B 3E1F1 2R4RL 3WHXA 3AREB 4KTDH 1S7SB 2X4TA 4X0KA 4NPYA 3WO3B 3UMTA 4KJQC 1RZIA 4PY8I 1KBGH 3DGGA 4UDTB 5JW4Q 2NXZD 5DR5L 2YN3A 1A9BB 5HGDB 4JFPB 3IFNL 3FONA 2PTVA 2BERA 5D1XC 2ICWI 4A6YH 3FQWA 5DJDA 5GIRB 2D7PA 1NDMB 3EYUL 4P4RB 4BFGA 2NY7L 4N0UB 1MWAB 1ACYL 1JK8B 2HLAA 3PGFL 2E5EA 4H8WL 1DUZA 2B1AH 4DTGH 4MNHB 4BQ6A 4D3CH 4PLNC 4LCWB 2CDFB 5D7KD 1GOHA 4P99A 1NSNH 3TVMC 5IG7A 4EXKA 5EU6A 3K8MA 3BKCH 1OARL 5J57B 5IKCB 2WUBH 5B39A 3W11C 4P2RB 1FL5B 4GRMB 4TPRL 4JO3H 1A1NB 2AK4E 3PWVA 4X7SL 4HIHA 4KQ4H 3LQAH 3ULUC 5KVDL 4ZOEA 1LNUB 2UUDH 1OP3H 2BY3A 4F37K 3MUJA 1WT5C 5CEXA 4M8VA 3THMH 2W9DL 4F3FA 1KLGB 3KHOA 3WUZA 2P7TA 2Y06L 1MWAH 2P8PA 3BUTA 4ZUWB 1KTDA 4UT6L 4JJHA 3T4YA 1OP9A 2VDML 3LZFL 2R0ZL 3O45B 3T0BA 4BZYA 3ARBB 4F15C 3ULVH 3LY6A 1A7PH 3UTZB 3VD3A 2HFGL 4Z76A 3CXDH 4D94A 3FQTB 5DRXB 3TYFB 1P5UA 2VLKD 5CKGA 1HHGA 1EK3A 3U4EA 3G6JB 2N1KA 4ORZC 2Q7YA 2HJFA 5CP7A 4EN3C 1JTPA 2K7PA 2NTFA 4G6KH 3MGOA 5CZXD 3TFKC 3GK8L 3SDAA 3F7YA 4QOKB 1NGZB 2FD6L 2FEEI 3U9UA 5EIIB 5I30L 2OXHA 3S97C 4QWWD 5GISH 3ALPA 5JA9A 1NC2D 5A40E 4QTHA 1HILB 4IMKA 1OL0A 43C9B 2PYFA 3N1MC 5T3ZH 2HFEB 1OSZA 3WDIA 5ESQB 3RNQA 4ZAKD 2VAJA 4UINL 2VXVH 5E8PB 5E9DA 1AO7B 1QYGL 1DL7L 4OKVB 4DVBA 1U3HA 2ICEB 2CLRA 2X70A 5D93B 1BIIA 5JZ7C 1X9QA 3L5WB 5CWSB 4FZ8H 4M9PA 5F7EH 2XG4A 1BZQK 2DMKA 4Q6IA 2O5XL 3IKCA 1OT1A 5AEAA 2FWOA 2YPKB 1PG7H 5IESH 1CE1H 2NCMA 4B7IA 1CXHA 2ESVE 2Z4QA 3CK0L 3OB0H 3HZYB 5D96B 1DBJH 3S6CA 5HBBA 1D9KB 4TULL 3VWJD 2XOTA 1NDGA 4NP4H 5CAYB 1WFNA 3BEWB 3MRJB 3P4MA 3LKPB 1RD6A 3CDYA 4OD1L 4X6EB 4CJ0A 1UT9A 1CTOA 4AM0A 3JWOH 2ZUXA 2HMIC 3V0VB 3H42L 1FCCA 1FPTL 4RWYH 1L7TL 1I9IH 4KROC 3GMQB 3EFDH 1FE8H 3D18A 5TPWH 1CXLA 5HPMB 1VPOL 5F7DB 1KIQB 2AK4D 1ADQL 3BOVA 3MRNA 1GOGA 1F13A 2ZSWA 1QR1A 4PRNA 5KBNC 5EO1B 2RB8A 1INDL 4JREC 3EDFA 3JVGC 4JDZB 5CEZD 2FIRT 1MCSA 1P7QA 3X11A 1WIUA 3CVIL 3BZ4A 4OZHA 2B5IC 4X80L 2AJ3B 3DVNB 4K7PH 3VD5A 3MUGA 4PJ9C 2IALB 3OKKB 1XMWA 1NAKH 5IVZB 4Q2ZB 4NO0B 3KJ4B 4XNYL 1EJOL 4UBDC 4YDJB 1LEKB 2XNAB 3ESUF 3O4OB 4P9HH 2EH7H 4LARH 1AXIB 5FYLH 3MLXH 1MIEH 1GGYA 5DMKB 3MRPB 4NRYB 4JQIL 3QRFM 4AMKH 5T5NF 2XWTB 3MOAH 4RQQA 1G7IB 1IAOB 3OWEA 2XKUA 1WGOA 5HI5C 1U3YA 3MRHA 4U4BA 3NFPA 4RMUA 1GHFH 35C8H 3VXOA 5IW6B 2OZ4H 3U0TB 1BPVA 3P30H 2D7QA 4ZUTB 1AE6H 5EU4A 5H2BB 1QFWI 1EJ6A 2NY6D 3V6ZB 3RWDA 2Q8BH 1ZHNA 2FX8H 4PGEA 4HIEA 4BK5A 1D5IH 1S9WB 5MEOA 4R26H 4K8RL 4YEEA 1NCNA 1MFCL 4IRJB 3MNVA 3TGXA 1CBVL 4L1DA 3S9DB 3VFGH 3B5TA 3IF1B 1OAZH 4WY7H 4U2ZA 4Z95L 2N7BA 1KTKE 5F1OB 1ZHLB 2OYPA 1BECA 5EUKA 3CFCL 2AEWA 2AXFB 3DIFA 5T1DH 3FT3A 4GXUN 2A77L 3QJFB 1QRKA 4XPFL 1ZT1A 2H32H 1E4XH 3B3IB 2PO6B 4LU5L 4ZFOB 4JZJB 3P9MA 5AG8A 4PLJC 4RAVA 4QXUH 1WZKA 3I84A 5J3HC 2V7HA 3FB6B 1C1EL 2ESVD 2OR9L 5I19H 3EYQC 1CQKA 3P4NA 4Y2DD 2KUTA 5IJVB 1DBMH 3OKNB 5LBSL 5SV3A 2BNUA 2EDNA 3SHSA 5FIEA 1EHAA 1LP9A 4H20L 5H8DA 4ELKB 1X4YA 2I07B 2JJSC 3NIDF 4HSQA 4ODUA 2R1XB 5EORL 1WJ3A 4O4YH 3MBED 1T0NA 2PYEA 1RVFL 1A1OB 5BQ7B 3P9LA 4HUWB 4PJ5B 5ADPL 3O0RH 4XPBH 5FKPA 3C60C 1UWXK 5C0BA 2R2HB 3EFFB 4HKXA 3ZL4H 1A6AA 5EUOF 1YMHA 4LASL 9CGTA 1M1SA 3G9VA 4MCZA 4UNVA 2VLJB 2B8OT 3IDYB 4DZBA 4JPKH 1MAJA 4C83B 4Y4KB 3CPLA 4H1LB 3ZSTA 3NFSH 1XR8B 3INUH 5IVNA 5BRZB 3BP4A 4B7LA 1DQML 1HIMH 5MHSE 5D1XB 1FZKA 5DLML 2JK5B 5IQ7L 1I7RA 1GGIH 5BXFA 4ODSL 5GZNC 4F58L 5A16A 2R0KL 3IFPA 4ERSH 5HHNA 2VDQL 5GRJH 2EYRA 1RZJL 4EQ2A 1W8NA 2ZCKL 4RNRA 2MTPA 2NY2D 2B2XH 3HPLB 2XTLA 4N8CL 4NQDD 5I8KL 1A0QL 4D2NA 2D7TH 1HSBA 4K94H 4XNUH 5DEFB 5E9DE 2ZCHH 3EDEA 4HH9A 4CL7A 4JFDD 4IRSA 3TVMB 3WDJA 1R3JB 2BY1A 4H1LH 5KSVA 1KACB 1SJHB 4JN1L 3C6LA 5IHZA 5FGCE 1CICA 1QEWB 2DQEL 1JWSA 4I0CC 2CIIA 1OPGL 4EOWL 3E2HB 3HNSH 2AJZA 3PQYA 2X4OA 2IPTH 43CAB 2A6KA 2I60L 4RFOH 2OCFD 2Z8SA 3OR7B 1MCWM 2APXA 4D9LH 5IFAL 1URLA 3ZT5A 4NM8H 5DK2B 1GC1H 1VEPA 4N9GB 5JDJA 2DJUA 2ZSVA 4HEPG 1BD2B 1JNLH 5JPMA 3O2DH 5JIKA 5K9JL 4FQXB 3MUHL 1KG0B 4JRWA 3JVGA 3ZHLA 3HPJB 5HHXL 3K1KC 1MLCA 4OQTL 5FGSA 5A3IC 1VFMA 1RU9L 1XGQB 3P73A 1IGTB 3DBXB 5EOQH 3KR3H 4JQVC 1FV1A 3VXQB 4EN3B 2AQ3A 2NPLX 4UT9H 4OCYL 3BW9B 4DN4H 4OGYL 1OAYH 3S4SB 3MV7A 1U91A 1J0YA 1SEQL 2ZKHL 4QHNB 4XBPB 3VGHA 4BSWB 4HULB 3RWGB 3IT8D 1BFSA 1NEUA 2QSTA 4NQCB 5I1CL 3S35X 4Z18A 1PSKL 5HYQA 1TTGA 1R0AH 4P48A 8FABA 3AAZA 2DTMH 7FABL 5FYJH 2V2WA 4KRPD 2VDOL 1YNLL 1FVEA 4I0PA 4YGVB 3G5ZB 1AQKH 4E5XB 4YXHH 1UM5H 5E2WL 4KFZC 3O3AA 4DFIA 5BZWB 3FOMB 3WO4B 4ESKA 3IVKB 1YEEH 1S7WA 2FYYA 3B9KC 2P44B 5DD1H 3PL6B 3RWEA 1RUMH 4ONHA 3KPRE 1IKFL 1CD0A 3OJDA 4OD2B 2MPAH 1F3DJ 4U6VL 3GSXB 1FG2A 3SDAD 3IDMB 5MHSD 1XGTA 2PETA 1KJVB 1H8OA 4TNWF 4P57A 1HQRB 3GMOB 3V5HA 2DDQH 2F58H 1AHWC 2MSPA 3F58L 5EBWA 3EOAA 4WU7B 3I3DA 2MQCA 4RRPA 4LEOB 3HNTH 4FQ1H 3EJZC 2P45B 1W2KT 1TPXC 4GOSA 1ITBB 4TNWK 1PYWB 1GZPB 4NN7B 3H7BA 5E9DD 1BFTA 1WTLA 1U3HD 4WV1A 4IRZL 4CMMB 3D2UA 4PJDF 4PREA 4XB8A 4OZIF 3FT4B 3L1OL 3NCCB 3X12B 3NFNB 3RY5A 1FH5H 5ECJE 1N0LA 3V6FB 2FGWH 4DCQB 1MJ7L 1NGQL 3OAZK 4NZDA 4OCWH 4OT1L 1GRWA 2C3WA 4IJ3B 4KV5E 1ONQB 3LKQB 4K9EC 2MCPH 4Y5VB 1AXTH 3G9AB 4JREB 2H45A 3KG5A 2GJ6A 2PCPA 4P5TC 3BGMB 4HGWA 4XP1H 3F7VB 1DSFH 3WFEH 1CL7I 1UWXH 4UZGA 3TCLA 3WD5L 5J6GA 2E6PA 3DRQA 1AGFB 5DEZA 1F4AA 5GGSY 1FNFA 4E42B 1LP9E 5EN2A 4J2XA 1EH9A 3HC3H 3GRWA 4Q0XH 3SPVB 4AG4H 2DJSA 3HI5L 2VXTH 3NZ8A 4NZTH 2PYEE 2V9TA 3NACH 3OR6B 1I3UA 4NQXA 2IH3A 3SQBA 3QG7H 4KKLD 4ALAH 3U6RA 4JVPA 4UDUA 3N06B 3SE3C 3MC0A 5C0BE 3MOBH 4HC1L 5LVEA 2Z0BA 2XWJB 3HMWH 4I3SH 1ZLUH 2IBBA 4Z7WA 4HFUH 1MSPA 3OXSB 3IDGB 5C07A 3U4BH 1FVDB 2Z92B 1FNAA 1G1CA 5FUCC 1YNKL 3WFBL 1DN0A 1YY9D 4GAGH 1P7QD 4HWNA 3WV0A 1S9YA 1SJXA 4YDIL 1T22A 2YS4A 4I48B 4KUCF 3K4AA 4AYFA 3MRLA 3I50L 1KIPB 2KZWA 4Y4FC 3D3VB 3T08A 5L2KB 2ITDA 2FO4A 3H2WA 2PW1B 4HWUA 5D4QA 4OZFA 2I9LB 5DA0B 3HG1A 5TDOA 1A1MB 3T4AA 5I1LA 3HC0A 2PTTB 2HH0H 1CDBA 4PFEA 3AXLA 4KKAC 5F96L 4Y7MA 2CJUH 3SJVB 4HUUB 1QLRA 1XF2A 4A2LA 2FJFB 1VDGA 2NX5A 3U30C 2BVTA 3D25A 4NGHL 5CZKA 1OCWL 3GMRB 5JHLH 1CCZA 2Z91A 1XF3A 1A4KA 1KELH 3AGVA 1XF5B 1V05A 3K46A 2DM3A 5HPOA 3ZDZF 3R1GH 2DQJH 4NYLB 3PQYE 1MCEA 1VFUA 4BZ1L 3RI5F 4RMRA 4YQXH 5F8QC 4HAGA 3MLZL 3REWA 3TBSB 5IEKB 3HC4H 1Y18A 3RWIA 3S5LB 3IDJB 1CD1B 2RHEA 5D2NB 2BFVH 4I9WD 3HRPA 3QCVH 4MA8H 5BW7C 2GT9A 1XGYL 3MNZB 5C0DB 3LKOB 5JUEL 3RVTC 3RI5K 1HKFA 3GGWB 3KHQA 3PJSA 3EO0A 5I15H 5CBAB 4Z7UA 2VQUA 1ZT4B 4JPIB 4PJHE 4JRXE 2ZG1A 3BH8B 4WU5A 1JPSH 1NCWH 1T2QL 1WVZA 3S96B 3B2VL 3U2SA 3WIIL 3VD7A 1G7LA 2VDRH 3BPLC 1BMGA 1KULA 5ACZA 4G80A 1Q9KB 1NGWA 3D39A 1ZEAH 4PG9B 3MV7E 2JB5H 4G7YL 4OM0L 4PRBB 4XPAH 2OL3B 3RZCA 2D31A 2Z8WC 3QJHA 1VESA 3RDTA 4NUGH 2RFXB 2PYED 3ARDB 2BVPA 3X13B 5CMAA 2CLVB 1R5WA 4YHMH 4CMHB 2AV1A 4NZRL 2VOTA 1UB6B 3O3DA 4BFBD 3FO0H 3NGBB 5KG9B 5C0BD 2IH1B 5DJAA 2AI0L 1Z3GL 3QUML 2EO9A 5KSBE 4Z5RA 3EOTH 1WV7T 1U8MA 1GAFH 4LP4A 1Q72L 3VFRB 2WIIB 4FXGB 1E0OB 2H1PH 2CGRH 4C57C 4ZNEA 2D7NA 2F54A 3SDXB 4OGZA 2QBWA 4MGXA 3UEZA 4BSJA 3W39A 2VN4A 4LLYB 2E7CA 4RRPG 3LEXB 3K0WA 1I9JL 2OL3H 3WNLA 5I1DB 2AABH 1MLBB 4O2EB 4D3CL 4ZFFA 1U8IA 4LQFH 2XRAH 4LL9A 1NLDH 4GLRH 1J87A 3BKCL 3RUGA 4OZGF 4R4FH 4JO3L 1T21A 5GGQL 3DI2B 4XC1H 3OAZH 4XAWH 1F4HA 3GNMH 3TN0C 4P5TA 5SV4A 2YKLL 3LQAL 5BCAA 4JRYB 3OTTA 4ZFZA 5IB2A 1U2HA 4MVBC 3EJYD 4IRSD 4AK1A 4FP8L 4QRPE 4YPGA 1WISA 4EDWL 3NCJL 1EHXA 1UADC 2ZNWA 1MWAL 1OD9A 3M45A 3QCUL 3I75A 3C6LD 3TZVB 1CICD 3QPQD 4M5ZL 3VXTB 5L2JB 3VGAB 5ISZE 4PJXA 5D5MB 1YEDA 4HIJB 3SO3C 4BQ9A 4AT6B 3PQYD 5IROC 4XP6L 4UQ2A 3CXDL 3QR2A 4QHKJ 2Y6SD 3W2DL 3EDJA 2C9AA 4DOHE 3K4DA 4ORGB 1FFNB 2NXZB 1ZGLM 15C8H 1UACH 5FGRA 4MX7A 3BPNC 1OQOA 1INQB 1MPAL 3MJ7B 4FTVA 4MJ6A 2VH5H 4LLVA 5TFSH 4XMPH 3MXWL 1MNUL 1YEFL 1G7JB 3H6JA 3WIHL 2Q20A 5F3HA 3O41A 1JGVL 1P4LB 4G6AD 3V4PL 3KPQA 3B9KB 4R0LA 3X17A 4GW4A 5IFJB 4RFEA 4KXZI 4JRXD 4ODXB 5BZDA 2A9NH 3QFDB 1RHFA 1S7XA 5C86A 5D7IF 5A2FA 5JMRA 5FAAA 4Z7WE 4OZFG 1B2WH 5GRUH 4OAWB 3MV7D 2Q6WB 2VZOA 2C3GA 5C07E 2X4SB 2VDKH 3MA7A 3O6FC 4CNIB 1HNGA 5J9PA 3RX8A 5SWZA 4QNPE 4U1NB 1ZVSB 4YHYC 1TPXB 3D85D 2IQAA 3Q3GA 1J9CT 5JLZB 4FN0A 3BZEB 1WBYB 2UWEF 5FFLA 1WCBA 4GG6F 3SKNB 4EEEA 1AKJA 1V5JA 5DA4A 2DMBA 1AD0B 4LIQH 1BLNB 4I0PD 5FECB 3PGCB 4TTGA 1YN7B 2AXGB 4JKMA 1QFUL 1S7QA 4JE4B 3MR9B 4CVZA 4KWUA 2FO1A 3F12B 2E9JA 3OKDA 1XF4B 4Q97A 3UJJH 2H41A 1J8KA 3NABL 1I8LA 3OGCA 5JW5A 3ARGC 5CUSL 1P5VA 2CRMA 1EAPA 3EZ8A 4WRLA 2YSSA 1NAMB 3BP7A 1BBJA 4NDMA 3RGHA 4YXKL 2NX5E 1EEYB 2EDHA 4LQ1A 2LU3A 4LLUB 2GY7B 3BYTA 4L3AA 3MFFB 2X4PA 4DZ8B 3KS0J 2YC1A 4F33A 5C6WH 4X9HA 4LRNH 3E8UH 3UROR 1YA5A 3AS2A 3QDJB 2PXYC 4XCNB 3NCYS 1PBYA 1NC2B 4GJTB 1UJ3B 2NY5L 3G6AB 4MXQD 1EUTA 3DYPA 5MERA 3BSZL 4GW1A 3KPPA 4PR5B 3O2WH 4QRPD 3VRLE 3D2UD 4MA7L 4HK0A 3QQNA 4ZAKB 2IPUG 3QUXC 4OCMC 5IVXB 4HWBA 3BKYL 3F65A 3HRZA 3VFNA 5KVEH 4JY5H 5K9QI 1CDHA 4WEBL 3JWDC 5CJQH 1GIGL 4Z7UE 3LKSA 1RUAH 3G6DH 5FDWA 4JO2L 5FYLL 3MLXL 4QGYA 1QTYT 3KPMA 2GJ6D 3V5DB 2WINA 4ZMAT 5HY9A 5DJ8A 1WEJL 1ZANL 4N1HB 3O6KL 4Y1AA 3QZWB 1E4KC 3VDBA 1FVCB 1UZ8B 1YMMA 3GSQB 1R3HB 2QQQA 3KWWA 3D39E 1EERB 3OKLB 3VXMA 5I66A 5TF0A 2CDGA 2QQKL 3MLSL 5L6YL 4JVUA 1TDQA 3VWJB 4D0BA 1QA9B 2V9QA 1L0YA 2DQTH 5H94B 1NGXB 3PABB 3ZYOA 2Y7QA 3CFIC 4JFEA 2DN7A 4MLIA 3U46B 2V5SA 1LWRA 1AY1H 3P4OA 1D5IL 1MCLA 1ZLSL 4NQVB 4ZS6D 4NFBA 3QNYB 5EA0L 5IR1A 2X4RA 3TBVA 5E00B 3HE7A 3C6SB 3RVVC 1HXMA 1I3RA 1N2RB 5DC4B 1G6RA 4K23L 1K4DB 4ZNEE 2F54E 2A0LD 3IDIB 5C07D 3AS3A 1DBKL 4JHZA 1K85A 2LU7A 3MA9H 2AK4B 3W9DB 5CLTA 4RFNC 2XZQH 4FQQA 1BOGA 5SX4H 4QRTB 1T1XA 1Q1JL 1E4XL 3RU8H 4ISVB 5ID1A 2LTQC 2LABA 3QT2A 5T1MA 1BAFL 3FJTA 4XWOD 2D9CA 2VNCA 3ZT6A 5HHVH 5I19L 3RUGE 4LSVH 3W81A 1CZ8L 1UGNA 5BOPA 2A74B 1DBML 4Y5YA 4PJIE 4ZPTB 1YEKH 1L7IH 1NJ9A 4UU9B 4J3VA 5IBTH 3MV8A 1M7IA 3S37X 3V4UH 1I4FA 4O4YL 5I9QB 2ADJA 2ATPA 5MENA 1B0RB 1LQSR 2NX5D 1MI5A 4HUXB 4U1JA 3TBYA 4J3XA 2EDEA 3C5SA 5HGAB 4NHUB 3NAAL 1OTTD 4CGTA 2DQFB 5C0FA 4QTIL 1GGUA 4QKXB 4ZFOL 4UILH 4CN4A 4PB9H 5CEZH 4PJXE 1S3KL 1PAMA 3DROA 3FRUA 3K74B 4ODTL 5ESAB 1OLZA 3T2PA 1YN6B 5D71H 5E2UH 1PKQA 5KSUB 2NY6B 3MODH 4GUPB 3GSOB 5F6HI 4M7JH 5CD3A 4AIZA 1QBLL 1WFTA 3OKEA 1CFSA 4U2YA 2OP4L 3N1PC 5E6YA 3NIFF 4NO2A 5I8CB 1AQDB 1WWAX 4JR9L 3W5MA 5LQBH 1I3GL 1E28B 5FB8B 3NVQA 4I4WA 1J11A 1VSCA 4DK6A 1SY6L 5JXAL 1CGTA 1UCTA 2VDNH 5E2VL 4FQLH 4L3EE 5C3LD 5KANG 3MV01 2WNGA 1IC7L 2EC8A 1IGFL 5JW4N 1DVFA 2E6JA 4MJ2A 4B5EA 4U1LA 2B2XL 4X8JB 5IB4B 2E27L 2Y5TA 3P11L 5I18H 3D39D 4ETQB 1RZ8B 3GJFB 4ZUSB 2VIRA 3BP6B 1NQBA 2MKWA 2YD3A 3O3BA 1NFDA 5D1ZA 5ITBL 5E8NA 1DJSA 5I74C 3RZCD 1XGPA 2YPLA 2EDWA 5C0CA 4Y2DB 3RDTD 3FO1A 5HHME 3RWCB 5CINL 3RP1A 4C55A 3I2CL 5SWZE 4MXVF 5GJSH 5GS3A 2V7NA 4LVEA 3PGDA 3LQMA 1X5XA 1DR9A 5KZCD 3PV7A 2ZCLL 3HFMH 3MBEB 2JLLA 4RFOL 5DSCA 1JWUB 4DQOH 2FSEA 1QBMH 2FZ3B 3LN5A 2P47B 3DUUA 5DUPH 3K7UA 4PGDA 2AERT 5IHLB 3MACH 2F54D 5M7QA 2YOCA 5E1AB 1NBYB 3FTGB 4I18A 1QSFA 2GUOB 4IDLA 3MUY1 5IM7B 4XBEH 1QQDA 3W5NA 3GJFH 4P3CH 4MJ5B 4ZS7H 4LCCB 2HKHH 4U6HA 2DWDB 3EYFB 4D9QE 4PBWD 1T5XA 1IEHA 2BSRB 4LKCB 5IB1B 5AYUL 3ULUL 3HR5B 2BC4A 1OAKL 3DHMA 4NRZA 5CIPB 4QHMB 4M62L 5DK0B 1OAYL 3ZLQC 2EE2A 2HT3C 2H2PC 2MHAB 4F7PB 3T0XA 2R29H 4KH2A 3BGAA 1FYTA 1F3JB 1NMCC 4UUJA 4YBLC 4HJJH 1IGIL 3DUSA 3WYRA 5HVHC 4GKNA 5SX5H 3UDWA 1GGCL 2NY2B 4EI5A 1EFQA 1M05A 2Y72A 3OJMB 1NEZA 4B0MM 3OHXA 3BHBA 5IMKA 1UG9A 3CFJB 2V5TA 2GFBB 5EIQA 5E5MB 3WHXB 2Z8VC 3X14A 3UYRH 2AJUH 2IBZX 1RUKL 2VDLL 3EAKA 4OZHF 3MRCB 1RZIB 3NIGF 2APWA 5DD1L 2F19H 3DGGB 4CKVX 2GW5A 4Y1AE 2JIXA 2GCYA 3CSBA 1BWWA 3QXTA 4M48H 1YMME 4LSSH 1JGEA 2MPAL 4JFFB 4PV9A 5ELIA 5IMMA 4UV7L 5KS9A 4XMKL 1BM3L 2WUCH 4MQ7B 1B6UA 2UZIH 2B4CC 4TSCH 1FIGL 4M6OH 1JRHH 3FQWB 5IHUL 1XR9A 3SE9L 4JFEE 4L1HA 4HKJA 1BQHG 3L3KB 4L3ED 3T65A 1SJEA 4G8FA 2EIEA 1CR9H 3BFOA 3MLRH 4FQ1L 2HLAB 1DUZB 1UQSB 1LDSA 3QCTH 2AEQH 4Z77A 4WW2A 5I1HH 4RBPK 5IG7B 4QRSA 4K2UH 2NY3D 1QRNA 5B39B 2V2XA 2E7MA 3C5JB 3BT2L 4YR6A 5HHMD 3DX8A 2A6JA 5SWZD 2JF1A 3MREA 3ZKQD 3L3OA 4UB0H 1BVKA 4JFOB 3PWNA 2MCPL 5CJ5A 1G7HA 1JHTA 2M1KA 2BDNH 4G43A 1AKJD 2XQYG 4F3FB 3OPZH 4WCYH 4Y2OA 3GSVA 4P3DA 2P7TB 3I02B 3RVUD 2P8PB 3FZUD 4XP1L 1KTDB 4EVNB 3T4YB 4XHQA 4WI2A 3UO1H 4KRPB 4RAHA 5C2UB 4AL8L 2XZCH 4KGJA 4OIIL 4XWGH 2R0LH 3MV8E 4Z76B 2XYCA 4JO4L 4D9QD 3QXWA 4I2XA 2NLJA 1RJCA 5MENE 1MI5E 4NZTL 3F6LA 1HHGB 4HJ0C 1EPFA 2AK1H 3U4EB 4DKEH 2Q7YB 2EDBA 1FAIL 5CP7B 4UIMB 2YUVA 4NKDA 3MGOB 3ARFC 1CDCA 3F7YB 1LP9F 4R8WH 1CDUA 1FNSL 4HCRL 4N0FA 4LSTH 3FRPG 4S1DC 1KCSL 3ZKMC 1ZVHA 5ICZA 4Y16C 4WWKC 5MI0B 5ACLA 3SGEH 4XP5H 3LKRB 4AEIL 1J86A 4QTHB 3GKWH 3IB4A 4BFIA 2PYFB 1QBBA 4X99A 1DBAH 4KQ3H 3CFBA 4LSDA 3RNQB 4LKXA 5E9DB 3VFWA 1F45A 4DVBB 2X70B 1BIIB 1NLBH 3MV9E 1F42A 1JF1A 1DFBH 4JLRA 3EHBD 3K3QA 5FGCB 4NCC1 4U7MA 3HR6A 1D5MA 1MUJA 4BM7A 4RFNB 3EGSA 4Q6IB 3O8XC 2FWOB 2C4FU 4Y1AD 4IOFC 4U1IB 2CJUL 1LO3H 2VXQL 4P23C 4PB0L 1YMMD 2LTQB 2D4DA 2ILLA 1KENH 2MQ0A 2BVOB 3VXMD 2Z4QB 1B88A 5A43C 1NFDE 2HWZL 2CK0H 2YPLE 5K9OA 1KPUA 4ZXBD 1NDGB 2FEDD 4JFYA 4JFED 3P4MB 1U8JA 4MAUL 2M8XA 2YEZA 1A3LH 5INDA 4AM0B 4YQXL 3P9WB 5AUMA 1IKNA 3AY4C 4MSWB 3HC4L 3HE7D 4W4OC 2G9HA 1UM4L 2ADIB 4CU8A 2YXFA 3H3BC 5GGSB 1XCTB 3OKOB 1QSFE 1K4CA 1YYML 3DX6B 4MWFB 4R97C 3MRNB 4M6ML 1BQLH 3BIAX 1MHHA 2ZSWB 4PRNB 4UQ3B 1QR1B 5IB3A 5I15L 1M7XA 1P7QB 3X11B 4PP1C 2DKSA 3KPNA 4QRUB 4HIIA 2H2SD 4KJPC 5T3XH 4EI6A 3SY0A 3MUGB 2GTWA 2I5YL 1NEZG 1JZ8A 1UB5B 4NM4L 3SOBH 4QHLB 3DOSA 2B0SL 3K4ZA 4S1QL 1ZEAL 1FYTE 1NGPL 2VXSH 3MV8D 4MXWL 5DTFA 3K8LA 1YEIH 1C16A 5LGJA 5MEND 1MI5D 4M93C 5ENWA 3HZKA 2D0GA 3KPRB 1CFQA 2VLRB 3DX9A 5FM5M 1S5HA 3H3KA 3LAFA 2V6HA 3MRHB 1BJ8A 1V3KA 1YEJH 4G7VL 3VXOB 2BRQA 5J56B 1GAFL 2IG2H 2NZIA 3AU1B 4TSBL 3KDMA 2E7HA 5EU4B 4FQCL 2KDGA 5DQ9A 1F90L 2NW3A 2HJLA 1HZHH 2B1HH 1MFAH 5MEOB 3BRGC 5BS0E 3PIQA 4I1NB 1HQ4A 5IF0A 3DJ9A 3RVXC 2DKUA 3MNVB 2AABL 4IMLA 4RBPH 5FYKU 5JOPE 5F7FA 4JQXC 3MV9D 1TNMA 4X6DA 5FXCH 3VG0H 4LPCA 3KPLB 4X9GA 5EUKB 5E7BA 3DIFB 3MJ8A 3A6OA 3ARZA 4Z8FL 1RZFL 5T5FL 3FT3B 2VUYA 4DKFL 1DVFD 3K8KA 3MTRA 2G60H 5I1KL 5EOTA 4N0CD 5DUMH 1ZTXH 5JW4M 3TIEA 4RAVB 1I8IA 1K2DB 5GHWH 2V7HB 4LOUD 4MQXC 5K59F 1QRNE 1S7UA 4L8SC 5D1ZD 3MRDA 4YHLL 2YPLD 3P4NB 1A6UH 4NBZB 5E03A 4NWTL 3CFEB 3DGCR 1JGDA 2BNUB 3UTOA 1FO0A 2OLDA 2EE6A 4KK9C 4ODHH 4X83A 4NZJA 5EO0B 3GI8H 1QO3B 4YBLB 2E8YA 3ILPA 1JGLL 1T0NB 1ZWIA 2PYEB 1LK3H 1KCLA 4PGJA 5DD0H 3U0WL 1WFUA 3ZTJG 1BZ9A 3TWCL 1CGYA 4WFFE 5DT1H 3DO7B 1KCVL 3HKFA 1A9EA 3QISA 4D0DB 4XZUA 1R3IH 1F97A 3OAUH 1I3VA 1QSFD 4HKXB 4K3HA 1P9MC 1A6AB 5IP4A 2UYLB 2BCKB 1IAMA 3MCKA 4PJBA 4XC3H 4DZBB 4NWUH 3DARA 4I2XE 1S7VA 4LEXL 5GS1A 2BOBA 1ETZB 3CPLB 1ZT7A 1T89C 5KVFH 1J0ZA 2NY0C 3QI9A 12E8L 1FNEA 4Z7QF 3BP4B 1HYSD 2C4XA 5GGUA 3J8F7 3EZJB 2VSDA 4PJAA 4XNZC 1FZKB 4JM4H 4OZ4A 5CZVL 2VUOA 1I7RB 5DJ2A 3ORJA 5BXFB 5A16B 1KOAA 1FYTD 3DI3B 4EJ1C 3HZMA 5HHNB 2EYRB 2I9TA 3UYPA 3WHE0 1G9NH 4RNRB 1D5BB 3DV4B 3E6HA 4EI5D 1KXTB 5BV7C 1HSBB 3IRZA 2GJJA 1MCCA 5L8KB 1DQDH 4IRSB 5E8DH 5KSVB 1IGJB 2PNDA 3GZKA 1MRCH 1AR1C 3EOYG 3C6LB 1CICB 3VE0A 3DMMD 5D7SH 5HHPA 3HCVB 3JTSB 1JHKL 1OTSD 2OX5A 2CIIB 3KPSA 1FC1A 3T2OA 5HYJB 5I73B 1ZXQA 3ZDYE 4P59L 1XT5A 2AJZB 5DVLA 2CXGA 2IPKA 3PQYB 5EPMB 3KYNA 5JQ6H 2A6KB 1DDHA 4AENA 5IWLA 4YK4C 1YEGH 1TXKA 1ZA6B 5JOPD 4CVUA 2NNAB 2W0FA 1IZJA 3NZHH 4U6TA 5IVOA 4LRNL 2PW2A 1EEQA 1MLCB 2WBKA 3PWPA 5BOZG 3M8OH 2ZPKH 1NMBH 1KEMH 3P73B 2QQNL 3BDXA 4ONGH 4PJHB 4JRXB 2ICWB 3SKUD 3BN3B 4LBEA 1KN2H 4G6JH 3HUJE 4M43L 1QRND 4K9EL 5JPNA 1RMFL 3ARFB 3ZE1E 1NAML 2H26A 2VTFA 5IBUB 1LO4H 4HIXH 5HTSA 3MV7B 3HB3C 1U91B 1ND0A 5EWIH 3KYAA 3VI3F 3WBDA 1KN4H 1DTUA 2EKSA 4JPWH 2EE3A 1NCDH 1P84J 4OD3H 1HOCA 3JTTA 3D85B 1GPOL 3MMEA 5HYQB 2Y36H 2VZSA 4WO4A 2OJZH 5TF1L 5T33H 8FABB 1V7NL 4WFFD 3EO1A 3FMGL 1ORQA 4Q9QL 1FVEB 4E0RA 5KSBB 3VWKD 1EO8L 3VXPB 3TO4C 1SVCP 3O3AB 1BVZA 1S7WB 3QSKB 3MLYH 1OM3H 2FYYB 1XIWC 3RWEB 3QA3B 3O8XB 4NNPH 2AEPH 4JHBA 4ONHB 3MXVH 4KJYB 4WFHE 1SBSL 4P23B 2VRAA 4XPTH 3BJ91 2CUIA 1FG2B 3RX5A 1CYGA 1XGTB 3U36A 4P57B 3GBMH 3V5HB 5F7HA 1ODAA 1Z9OA 4HUKB 5EBWB 3QIBC 4FZEH 2Q8AH 1J05A 3EOAB 2IPUK 3CCHA 5JIIA 3V5KA 4GRLC 5D7JA 5I1EL 1RZKL 1SHMA 3VFPA 4S11A 2XZQL 3DETC 3CNKA 1UA6L 4PJEA 2R2BA 3VI4F 2JELH 1D6VL 3BPOC 2YD8A 2YK1L 4U3XA 4WV1B 5EDXA 2HFTA 4JCMA 4QRPB 4U1GC 3FT2B 3D2UB 1D5XA 4PREB 1JTTA 1W72A 1J1PL 2XTJE 5HHVL 1JI2A 1MEXH 2QEJA 4Y4HA 5DDHA 2R8SH 1DQQB 4OLZL 3T0EA 5H37G 5JHDE 5ISZB 3ZE2E 4NQEB 4WW1B 4XP4L 3JXAA 5KW9H 1M6OA 4AQOA 1Z5LB 3PDOA 3V4UL 2PCPB 1MH5B 1TITA 4P46A 5GS0D 3ZTNH 4DOHB 3CD4A 4HGWB 3TCLB 5E6IA 4HV8B 5F3BB 3JWNC 1YECL 1I1RA 4POZC 5EN2B 5D71L 3VXSA 4LCUA 4BUGA 1S8DA 2LV4A 3NZ8B 2H3NB 1K8DA 1QLEH 3MNWA 3CH8A 4NQXB 2IH3B 1NBQA 1DEDA 3UTPE 3ARXA 4OLEA 1OAXH 3U6RB 4UDUB 3B9AA 2PKDA 1CFVH 2P5EA 3EYOA 5FUOH 4QXGH 1CN4A 4KI5C 3PV6B 5ANMA 4MZ3A 4Z7WB 5F1SA 1I9RH 4PJBE 5LQBL 4LDOB 2BK8A 4GW5A 5FCUH 1UXWA 2LVEA 4XX1G 5DXWA 5C07B 2ARWA 3QQ4A 4ZUUA 1DN0B 4J8RB 3L3JA 1C5CH 3WLWD 5KN5A 1T83C 3O4LA 1CD8A 2G75A 3GRWH 5IBLC 4YHOL 3BO8A 3L3DA 1PQZA 5D7LA 5EZOL 3SDCA 2IGFH 2FO4B 4PJAE 5LAXB 5EU7E 2O61A 3BMVA 5I18L 1UZ6E 2FX9H 3AS1A 4XTRD 1WZ1L 4AIXA 3ROOB 2IFGA 4XX1E 3PNWB 1Q9OA 3T4AB 4XGZA 3HC0B 4ZXBC 3ULVE 5IK3A 1AGEA 2B20A 3AXLB 4LVNC 3C5ZA 4C59B 1HKLL 4WFHD 1XF2B 3SDDA 4BFEA 3S88L 2VLLA 4UTAH 1AC0A 2NX5B 5GRWA 3FQUB 5KTEL 1JPTH 1QBML 2Z91B 4J3UA 1OSPH 1XF3B 1LD9A 5D8JL 3LEVH 5JOEA 1Q9WB 1A4KB 2LU4A 2BNRA 3UBXA 4KKBC 3WSQH 4HS3A 2NY4C 4PJGF 3KPSE 1A22B 4OZFH 1G6VK 1JL8A 2XKNA 3NTCL 3BN9D 5T3ZE 1TQBB 1EZVY 4FFYH 2YUXA 1UKQA 4KDTC 1N64L 5JW3H 2BHZA 2YZ1A 2XTJD 1CD9B 4X5WA 5DI8A 4RMVA 2FB4L 2NW2A 2HLFD 3PWPE 3PJSB 3N9GH 3VXUA 4Z7UB 5HSFA 2EXWD 4M1DH 3IAGC 4L5FH 4J6RH 5K93A 4U1MA 1INEL 1EA9C 3QUYA 5ACZB 4G80B 4XNZB 3QIWC 3D39B 4PJFA 4QGTA 1S78C 2VDPH 3RZCB 1FFRA 2D31B 4XVTH 4JM2C 2JJTC 1S5IH 3QJHB 3RY6A 3RDTB 3VFUA 1CLYH 3UYRL 3P0YH 4Q9CA 1QPXA 4JHAL 4CW1A 3DX7B 5FM5O 5I1IL 5BV7B 3MLPA 3O3DB 3UTPD 1ES0A 2J2ZA 3LSOB 4HF5L 5KZCB 3OZ9H 4M48L 3VFVB 2WBJA 4Q9BA 4PRPE 2DLFH 1P7KA 4X7CC 2QR0A 4Z5RB 1U8MB 3QXVA 2DICA 3UJIH 1ZHKB 4MAYC 4D9RE 1IEBA 1Q8MA 2E9BA 5I0ZA 4G8EA 3TJHC 2F54B 1F4WH 2OI9C 4MA3A 1P7HL 3V4VL 2AKRA 2V5MA 4S2SA 2P46B 3W39B 1FC2D 2DQDL 5CD5C 4S0SD 3N85H 4RISH 5KJRL 3MLRL 3QI9D 3F62A 4X4MA 4GBXC 5A2JH 1MRDL 5FA3A 3ZKSD 1DQJA 1G7MA 5JXEC 2CK2A 1NCBL 4YK4B 2V2TA 1U8IB 1N5YL 1EGJA 1D5ZB 1HH6A 2B7DT 3HE6A 4KPHH 3FFDA 5TH2A 3QO1A 3TNNA 1NBVH 5E4EC 3RUGB 5ICYA 5IT2H 1CWVA 4KTEH 1KB5A 4Q9RL 4PJIB 2A6DA 4U0QB 4ZFZB 1CLOL 5IB2B 3R8BB 1R3KA 4P2OA 1A5FH 2J8UF 3WS6C 3I75B 5T1LA 4N0YH 3QNZB 1EHLH 2E7LC 3SKJH 4EDXA 3KPSD 2EDRA 4PJXB 1YEDB 2C1PA 3MLUL 1H5BA 4KUZL 5F44A 1RZJC 2R23A 4X6BA 2JCCF 1RI8A 4O58L 5T3ZD 2DJ4A 1C08B 3QYCA 1ED3A 1A3QA 1VHPA 3QDHA 1TIUA 1A14L 1IBGL 4MX7B 4ODVH 1FRGL 4X7FC 5L7XH 1HYSC 4F9PA 4MJ6B 4LLVB 1V7MH 3FHAA 1P4BL 5I75C 2V5RA 4P4KC 3OL2A 5DQDH 2Z31C 3C2AL 3PWPD 4OM1H 3O41B 5F3HB 4S0TD 1B0GA 1CDYA 4LVOB 4BSVA 1XIWB 4H26A 3W0WE 4R0LB 4GW4B 3GKWL 4L3EB 5DZLA 4RFEB 1MHCA 4URTB 1MHPH 1MQKH 3BKML 3MRMA 1A21A 2XQBL 3QIUC 3GM0A 2XQYK 1ADQA 3NH7L 1KJ2L 5EBMB 3STLA 3Q6FA 1NLBL 3QIBB 4XCEA 2NY3B 5ALBH 5ILTL 2QADC 4LSPH 1TCRA 3SCMA 3DMMC 3VXNA 3MA7B 5HHMB 5F93C 4IHOB 5J9PB 3TLRA 5SWZB 4KY1H 4OGAC 3V52L 3O4LE 4AEHL 2MWCA 2IQAB 4WO4D 5D7LE 1TZGH 4NFCA 3CAFA 1YJDH 1AKJB 4OTXH 5IMOA 1FZJB 1MCNA 5SX4I 1IQDA 4D9RD 3GJEB 2W0PA 1WZMA 2ZUQC 4KMQA 3RRQA 3UBXG 3OKDB 2P4AB 2F53A 5E08L 4K7PY 1PLGH 3QDGE 3TBTA 3OGCB 4UT7L 2YSSB 3K2UL 3BP7B 1BBJB 1F4YL 4NDMB 3RVWD 4OCSH 2DQUH 2X4PB 2YC1B 4YBQC 4F33B 1PEZA 4PLKC 5BMFL 5D7JD 5C0NC 4U1KA 4YDVA 3WJLC 5K9KA 1I1AA 1EUUA 4LRIA 1DQLH 1WIPA 1BQLL 5EO9B 2PR4H 4QF1A 4OLUL 2AJVH 1MJJA 2O5YH 1HCVA 3G5YA 3O6LH 1HSAA 1MCOH 5MERB 2J88H 4GW1B 3KPPB 4QLRA 3QEUB 1CVSC 1YQVL 2CDEB 2C3VB 3GHEH 4HK0B 4ONFL 5KSAA 4YJZL 2QHLA 5IJKA 1RY7B 4JM2A 1IEAA 4Y4HD 4B50A 4XPHH 4HT1H 3QXAB 1FFOA 1F58H 4ZOAA 1A7OH 2JJWA 4V1DA 3T0ED 4KZEL 2N4IA 4ZFGL 3H9SA 3VFSA 1HHJA 2ITCB 4S1RL 4D0CA 1XF1A 3LKSB 5J12B 5IV2A 5FDYA 3KPMB 4TOYH 1PEWA 3SE8L 4P46D 4OSUL 2WINB 1UH2A 5DJ8B 4XNMA 4LPXA 5ADOH 3S3SA 4Y1AB 2FBJH 5E6ID 3S36H 3KWWB 3GIVB 3VD9A 4PJFE 1YY8A 3E3QC 3WLBB 3L5XH 3T3MF 5D6CA 4JKWA 1OLLA 3WEXA 3VXSD 3FO9B 2FECL 4PJCA 1UM6L 1FCGA 2MCG1 4HWBH 2IG2L 4D0BB 4ZXBB 4L29A 5HJ3B 1D6EA 4KKCC 3AM8A 2XA8H 4WUUA 2Y7QB 4JFEB 1UWEH 4JY6A 3KLHD 1EEUA 2P5ED 1K5NA 3NCYP 5CGYC 3B5GA 5IR1B 1F11A 4OV6F 3TBVB 3MUZ1 1G9MH 4OKDA 3ZE0F 2CKBA 4HBCL 1I3RB 5AWNL 1G6RB 4U0RB 1U8NA 1YPZA 3CMOL 1KPRB 4U31A 1JNNL 1KXQE 4NJ9H 1U6AL 1U92B 3QFJA 4FQQB 1I7TA 3KJ6H 3O4LD 1EO7A 3O81A 3WS6A 5KS9F 5I8OL 2VZUA 5D7LD 3AUVA 3JV4A 3SDCD 2NZ9D 5EOCJ 1NL0L 5F9AC 4PTUA 5T1MB 4APQC 1IAIH 5KVMC 5FYJE 4Q74A 1HDMA 1R5VA 2IFFL 4M3JA 1PX4A 1A6UL 5BJTA 3IXAA 4PGBA 4RGOH 3BIKA 4LNRA 4HWZA 4KAQH 1MJUH 2QHRH 3KLDA 1EO5A 3C5ZD 3IFLH 3MV8B 1M7IB 2YWYA 4P2YA 3SDDD 4DGIH 1SYVB 1I4FB 1Q9LA 2QQLL 3RTQA 5MENB 1RPQA 2FX7H 2DLHA 1MI5B 2DQIL 3LH2H 5C6TH 1G84A 1KJMB 4GAJH 3DURA 2Z35A 1NGYA 3R4DA 5H35B 5DJ6A 4FQ2H 1FGVH 5EC1A 5ALCH 1KCUL 3DROB 3FRUB 2P48B 4MB3A 5DURD 1VGKA 4RGNC 5CS7A 5CBEB 5DMGD 3ILQD 5C08A 5LWYH 1VFOA 4XC3L 3CDGB 3MLTA 5E2JA 4P2QA 2BJMH 4G9DB 3TT3L 4LGRB 3MGTB 4O5LH 4M1GL 6FABH 1WWCA 4OI9A 5CD3B 1XCQA 4PYHA 3WIFB 5C0RH 5KVFL 4OZIA 1CFSB 3V7AE 1CDIA 2O26U 2GQHA 1I85C 4Y89A 4YHKH 1VERA 4BQCA 4NO2B 2OK0H 2GK0A 2ZJSL 4MAYB 1FZMA 2X7LB 4OQTA 3R8QA 3MV9B 4Z7OF 1T66D 1WIOA 2VWEC 3H3PH 3S3JA 3VXUD 4I4WB 4NN6B 1R24B 2DBJA 4RX4A 3HNVL 4MS8D 1X3DA 1JRHI 2NXYD 4U1LB 1HI6B 3L3GA 3WHE1 2AJSH 4X6CB 2A83A 5EZJA 2Y5TB 3QUYD 5E8DL 4E9LA 2ADFH 3OKYA 4LGPB 3O3BB 1NFDB 5D1ZB 5E4EB 5E8NB 3VU2A 1XGPB 3NIDE 2A38A 1YUHA 5FO9A 3ULSA 2YPVH 2ERJB 4LF3B 4BH8A 3X3GL 1NCCH 3L7FA 1A3RH 2GITA 3MRFA 1MREH 2DL2A 2Y25A 1N0XH 3QEQA 1ZGLP 3RA7L 3G5VA 2WBJD 4GSDL 4JFXA 1F4XH 3LIZH 3UAJC 5DSCB 2K9UA 5CSGA 2FSEB 3LN5B 5EUOE 3LDBC 3DUUB 3PDGA 1NMAH 4PGDB 4ZOCA 3DYMA 1NPUA 4G6MH 1WF5A 4RMTA 3BKJH 2E8ZA 1RZ7H 4OLWH 1AJ7H 4I18B 1QSFB 3Q6GL 4GQ9H 1QQDB 2GKIA 4GRWF 5GGTL 4U6HB 3V0WL 3QRGL 3M1BA 2A73B 5FV2A 5C0AA 3VMOA 3PWJA 1JIBA 1JHLH 1QSZA 5K33A 1CFTA 2YXMA 4G9FE 4J3OC 3RGVA 2BSTA 3LEYH 2BC4B 3F7QA 5F9WC 1BJMA 5FYJD 4UOW1 4NRZB 5HI4D 5D6DC 3B8SA 3CX2A 4K07A 3WFDL 1CXIA 1HHKA 3C08H 4P4KB 2DYPA 1LO4L 4XNQA 4G3YH 4F8QA 4OLXL 2R69H 4QRRE 1DANT 4J4PA 1FYTB 2P8MA 4UUJB 5DO2C 4P2OD 4YUEL 4N90D 1NUFA 3RPIA 3DUSB 4GKNB 2VL4A 3SGEI 4EI5B 3AREC 5IB5A 1M05B 2Y36L 3GUTA 5T1LD 3OV6A 3OHXB 3REVA 2EZ0D 5IMKB 3LN4A 4V1DE 4OFDA 3BAEH 3D69B 4JDVA 3L6FA 4M6NH 4XVUC 2E9IA 2CQVA 3H9HA 3JWDH 3DMMB 3X14B 1YDPA 2A1WL 3QPXH 5F1KC 3NA9H 3LQAC 4JZOA 3Q1SH 3ZYZA 1JZ2A 4NNPL 2AEPL 3MXVL 5BS0B 3IJHA 1ZA3A 5IMMB 1B4JL 1YYLH 1RHHB 4FNLH 5HHOA 2FR4A 2ZUQB 4LPYA 4WI9A 1I7UA 3HMXL 3NPSC 2BXYA 4MNGE 3BH9B 3NOIA 1FLRH 4OUUA 3CSYB 1XR9B 4WUUE 3S34H 3ULVC 1SJEB 4Y0GA 2ARJA 4G8FB 4R7NB 2LAAA 4KJWD 4NKQB 4HC1A 1IAKA 3STZA 1LEGB 3T3PF 4I77H 2J4WL 5L0QB 4WHYG 4WW2B 4HBQA 1FORH 3CGTA 3LMJH 1CF8L 2EXYC 2FJHA 4QRSB 5FUZL 4KK8C 1YPZE 4HKZA 3MCLH 1QRNB 1S7TA 2HVKA 4LCIL 5FO7B 2NMSA 1A6ZB 1MEXL 3SCMD 5J1SC 4KVCL 4Y5XB 4L4VA 1WTGT 3QFJE 2A6JB 4YHZL 5IFHH 3WUWA 3L3OB 2V9RA 4PJ8A 4HX1B 3RAJH 3PWNB 1QFHA 1G7HB 1JHTB 1TQCC 5KW9L 4P49A 3ARBC 2P49B 1XAUA 4X6DF 4P3DB 1TJGH 1F6AA 4O51A 1RUPL 5GRVK 4YNYA 4ZD3L 2WP3O 1ZS8A 3L5HA 1T1YA 2NYYC 4BQBA 3K80A 3Q5OA 3P0VH 1MRFH 3IETB 3VWKB 5HGGS 1J1OL 4TNVF 1J8HA 1JTOA 2FEEL 3GI9H 2HTKD 3BDYH 4L8DB 4EIZC 5EU5A 1F6FB 3SGJC 4I2XB 2NLJB 1EEZA 4LVHB 4G9FD 5FYJU 1WBZB 1YEHH 2HVJA 1J0JA 3QEHA 3VRIA 2VXUL 4R4BA 4RIRA 4OZGA 3F8UB 5BVPL 4LCYA 4RGMB 1I1AD 4NSKA 25C8L 4MJIB 4K8RD 5ICZB 3UTQB 5C08E 4QRRD 3G04A 3UJTH 3GSUA 2NR6C 1ORSA 5D70H 2HTLC 1X44A 3ZKND 4BFIB 4I0KA 5D93C 2QJDA 2HRPH 4DW2H 2P8LB 1A6VH 4KK5D 5JORA 4PJDE 4OZIE 3B43A 5KSAD 3JWOC 1J18A 4LKXB 3U7AA 5TE6L 3VFWB 5DFVD 1T7WA 3W9EA 3TF7C 2BVQA 3QUZC 4V1DD 2YA0A 3ZTJH 3H9SD 3I3EA 4JLRB 4QHUB 4OLVH 5FEBA 3EO9H 2QSQA 3SBWA 1V3JA 1D5MB 1BQSA 3S98A 1J1XH 5D96C 2DWEB 5HI3C 1D9KC 5DHXB 4TTDD 1UZ6F 2R1YB 2EDYA 1ERNA 5ABDE 2HKFL 2WWMD 5DUBB 1MF2H 3GSNL 3OSKA 2RR3A 1JFQL 3C9NB 4WUUD 4JFYB 5ACMA 5I2IB 1U8JB 3BPCA 3BUYA 4TQEL 4JDTL 4ODWA 1Z6JT 2OR8A 4P9HC 2YEZB 3QEQE 4FABH 3CLFH 3QUMA 5IGXL 1TETH 4XCCH 1N6QH 3TT1H 4FXKA 3RKPA 3WNKA 3HUJB 5INCA 4GRWH 4XVJH 5F89A 2RIKA 5DJYA 3IU4L 1K4CB 3BIBX 4LMQI 4XVSL 1KCRL 2CMRL 5GS0H 3QFJD 4RA0C 4Y8DC 5C0AE 3O6ML 1MHHB 5EOCH 1FYHB 5J4MA 5IB3B 4XPGH 3V6OA 4XCFH 4OV5B 1JZ6A 2UWEA 4XH2A 3S3PA 4JAMB 4GG6A 3KJ4C 1FQ9C 2Q76B 1KJ3L 1N8ZA 2WIMA 3BGFC 3SKOB 2BVEA 4XXDA 4HIIB 4KGLA 4PJ7F 4Q7DA 3VGBA 4EI6B 3HZVB 2GTWB 2IAMD 4LIQE 2VKXA 4LSRH 4JHWH 4J3TA 4WNQA 4HS6A 5HGDA 1PG7W 4W6YB 1JPFB 1S7RA 1A7BA 4KHTH 3TC9A 5AZ2H 5DTFB 1S5IL 3RTQD 5GIRA 3BXNA 1NDMA 1QFWL 2BY2A 3A67L 3CDCA 5ENWB 3I6KA 4Z7NF 3HZKB 3LPFA 3T77B 1CFQB 3GO1L 5EC2B 3DX9B 4O02L 4ENEC 3RWFA 5LGHL 2CDFA 1TMCB 4NOFA 4QXWA 3ZDZE 3O9WA 3UJIL 5IKCA 4ODBD 4WFED 5C08D 4NO3B 4GRMA 2VE6A 2R39A 2KQNA 4P2QD 1RIHL 5DQ9B 5F70A 2NW3B 1H15A 2MNUA 4U7SA 3HAEG 4YC2B 3N85L 5TJWK 4RISL 4KI1A 1H3GA 5DRWA 5IF0B 5FHAH 3ARQA 3FN9A 4IMLB 3LB6C 5KVGL 3L7EA 4GMSH 1AGDB 4KU1A 5HHOE 1NANH 4KVNH 3WIHA 1IC4L 3ZYJA 4ZUWA 2VLKE 2M2DA 5BV7L 2XTJB 4JZJC 4TUKH 2WMPA 3KXFA 1F00I 2Z8RA 3O45A 1X7QA 3MJ8B 4RX4D 1HN1A 5JHDB 3UTZA 2VC2H 3WUWG 4EUPG 4K3JH 4OF0A 3O11B 4YDKH 3OXRA 3IYLW 4M1CD 5JR1H 1JZ5A 3TIEB 4Z0XA 3G08B 3WXVH 1EX0A 2ED8A 3G6JA 1QKZH 5J13B 2R9HC 5F9WB 5FA4A 1T03H 2CO7B 3MRDB 4HXAL 4HQQL 4FFVC 4N0YL 4F7MB 1EHLL 1NGZA 4UV4H 1FO0B 5B3JE 1ZGLB 2YD2A 4PJEF 5F1IB 5EIIA 2X10A 1K3ZA 3P2TA 3QEQD 2W92A 4LSQH 2AJXL 3ILPB 1HILA 2FJGB 4C56A 1ZWIB 4F9LC 3TA3A 3MLVL 2HT2C 1BZ9B 4FFWD 5DGRA 5ESQA 3IDYC 4K94C 4P9MH 4UTBH 1A9EB 1AO7A 4MLSA 3VFTA 4XZUB 4ELMF 4Y4KC 3QEGL 1KB9J 1J8HE 4S10A 5I1AA 3L5WA 1MVFA 5DQDL 4PJBB 4ZTOL 1HK6A 5C0AD 3RWHA 2FATH 4KUCD 4XRCB 2BOBB 5FM4A 1CLZH 3CX5J 3BRDA 1TTUA 2BMKA 1FO0H 4JB9L 2WQ8A 3RGVD 2YPKA 4WJ5B 3QI9B 3CFKA 3QQ9C 1K8IA 4DGYH 3LS4H 2EYSB 4OZGE 1JYWA 1CGSL 4PJAB 2E9WA 2DYPD 2GSGA 4JPVH 4OZ4B 4P5MA 4UAOC 1GC1C 1DE4B 3HZYA 5DJ2B 3NPSB 3TBWA 5D1QA 4HXBH 4J4PD 1MCJA 3FQNA 1FL6A 3WFZA 4WUKH 4MD5A 1Z0NA 3DHJA 2EH8L 2I9TB 3MRJA 3BEWA 2NY1D 4X8XA 4PUBH 1BQUA 5B21A 1TJHL 4X6EA 1H3PL 4OF6A 1TTFA 4ZO8A 3RKDC 5HDQH 1JF6A 2J3SA 2OTUB 3E2HC 4TVPH 5D2LF 3GMQA 1X5FA 4G6FD 1IT9H 3PP4H 5AZEH 4JFQB 1QG3A 1C12B 1REIA 5FGBC 5CCKL 3VE0B 5CEZE 5I17B 4KMTL 5HPMA 3F5WA 5CJOL 1KIQA 3T0DA 5HDOA 5F7WC 3NCEB 5DZNA 5C6PB 1MFEH 1P1ZA 1TQCB 1CU4L 4FQXC