1IFJA

Molecular models and structural comparisons of native and mutant class i filamentous bacteriophages ff (fd, f1, m13), if1 and ike
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular models and structural comparisons of native and mutant class I filamentous bacteriophages Ff (fd, f1, M13), If1 and IKe.
pubmed doi rcsb
source organism Enterobacteria phage fd
molecule tags Virus
molecule keywords INOVIRUS
total genus 22
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1994-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ifjA00
1IFDA 1HGZA 2CPBA 2MJZA 1FDMA 1IFJA 1NH4A 2C0WA 1HGVA 2C0XA 1HH0A 1IFIA 2CPSA
chains in the Genus database with same CATH superfamily
2WSFH 1CI6B 1L4AA 1J1EC 3ABVC 1DEBA 1PPJE 1SQXD 2OTKE 1WMKA 4DOJA 3B5NA 3E7KA 3V4QA 1VL2A 2O01H 3L72J 4H44B 1VQKP 1AQTA 1NTZJ 3VMXA 1WT6A 5B66H 5CCGC 2YIUB 2FYNC 1OIPA 3MIWA 3PTZA 1EXJA 2QJYC 1YQ4C 2KI7B 2M5AB 3L73G 3P32A 4OGQD 4UB6H 1M56D 1Q90D 1QL2A 1OMIA 1S5LX 1SQQJ 3BRVB 3C8VA 1IK9A 1KYOH 2K37A 1R5SA 1QGKB 2XKMA 3A7OA 3CX5E 4GKGA 4H13B 4L73A 3CLQA 3AEDC 1BDDA 2J58A 1A02F 4AUWA 3L35A 3CXHD 5AVQB 1EZVI 2BASA 2J59M 3CCQP 1IFNA 4RKUJ 5APSA 2Q1KA 1KFNA 1X9VA 1QL1A 2QJKB 1L2PA 3I5CA 3L75E 1NTKK 3L74G 2RMZA 5DJTB 1DH3A 2QJKC 2GM4A 1OVVA 5KKZC 1ZR4A 2KSEA 2OYHB 3NFQA 2OQQA 2WZ7A 3AE1C 1SQXE 2W83C 1IFJA 1BGYG 1KZUB 2JDIH 4YTPC 1FOSF 1KMIZ 3L75J 2E76D 1LT9A 4KT0J 3H1LJ 1H89A 3B5NC 5KLVD 2Q6QA 1KTMA 3KDPB 5BU5A 5AVRB 1SFCB 4R4LA 1W2BO 1SS1A 2E5YA 1LTTC 3R2PA 3WUTA 4GODA 5AW9B 4WWIA 1HH0A 4DZOA 3AEFC 3H32A 4D6TG 3Q5SA 2KK7A 4OH8B 2L5GB 5AVUB 2H88C 3L73E 3M0DC 3NMDA 1JB0J 1VQLP 2KOGA 5B66E 3HTKB 1NU1J 1BCCJ 3Q3DA 3RL0C 1M8OB 1OFCX 1S1CX 2IX7C 3BVHA 3AE7C 2WSCJ 2M3BA 1SLQA 2MJZA 1PGJA 3AE4C 3LIDA 1KYOE 1YQ3C 2IZ0A 3AE3C 1SQXK 3PRJA 3A5TA 1VQMP 1KILA 5KLIB 3CC2P 1BCCE 4XFJA 1NTMJ 4AQRD 1VQ9P 1LJ2A 3CL3D 3H1HD 3L72G 5AW5B 1PGOA 1YITP 1SQPG 1AV1A 3VP8A 1KC8Q 2JO1A 3UIAA 2JEEA 2H7HA 1JOCA 2Q3EA 1SQQD 4IFDK 2WT7B 3EWKA 1QVFO 3V2PA 1BGYE 2WPQA 2E5TA 3KYQA 4N3YB 1S9KE 3GF3A 1SQQG 1A02J 1CSBA 2O01J 3PHLA 4OVNF 1N73C 2L91A 3OW2O 2H43A 5APXA 4H13D 1YBKA 3EQ2A 2AEFA 1SQQK 2BCCE 2G8YA 2AXTE 1NHLA 3H1HG 3HD7D 3CCJP 3CCSP 2ZAEB 1FDMA 2W6JH 1YIJP 5BU8B 1NAYA 1JTHB 4Y99B 1QX8A 2N1TA 3VMAA 2QM7A 4DT0A 2OYIB 1QVGO 1EZVG 3EFGA 2QVAA 3QWOC 3SWFA 4L76A 1HVVA 1ZN5A 2E75B 2C0WA 3BCCD 3BRTB 5APQA 3ZDMA 5CBNA 1RF0A 4PJ0E 3T97B 1BCCD 2V7QH 1OVRA 1L0NG 5AVSB 2OTLP 3MGNA 4WY4C 2ZT9D 1KILC 1MFZA 1JY3P 4N78D 4QMAA 5CCHC 3H1LG 1YHQP 2C9NY 1Q82Q 2Z5HA 1FDOA 1S3JA 1SQQE 1USDA 2FXPA 1OW8A 2V4HA 2YIUC 3GHGA 3LIEA 4HKZH 1LTJB 1LWUC 3R4YA 1PPJG 2JWAA 2C0XA 1IK7A 1HUCA 1SQBE 1JY3N 2BCCG 2IFNA 3SFDC 3I55P 1SQPE 3VMZA 3WUUA 4IFMA 1UIIA 4EOTA 1AJYA 1N73A 4UB8E 2R5BA 2QSIA 4XA4A 1RF1B 3JCUH 3KXDA 1KQFB 5APYA 1U7JA 2ZT9C 4DJGA 4TLFA 1KQLA 4EI2A 1SQBJ 3GW6A 1Q81Q 3VMYA 1RF1A 1Q2NA 2D2CD 4LGDE 2SPZA 1NU1E 2WWWA 3CWBD 1DEEG 5AVVB 1OW6A 2QEXP 2NRGA 1URQC 3O8ZA 2FFDA 3FGAD 1GD2E 3H1KJ 1X22A 2OYHC 1JY3O 2R5DA 2W8ZA 1CZQA 2RKLA 3BCCG 3KQGA 3KZIE 4N78E 2HODA 2XU6A 2O3JA 1VQ6P 3MUDA 3CXHE 1KQSO 4GOEA 5L8RJ 1KORA 3L73J 1AVYA 4AYCA 2HYNA 1NTZG 3H1HJ 2GA1A 2ZVNB 3U59A 5TISH 1LTBC 2KXPB 3A0BE 1NTKJ 3CXHI 4KHXA 1KILB 1EXIA 1SQXG 4LC1A 2B89A 1N86A 2NPSD 1R5LA 2WSSH 2A45I 1NTMG 2M8RA 2WVRA 3P8MC 1DIPA 2QJYB 2K9JB 4M3LA 1NTKE 1JNMA 1FS0E 3CCUP 1SFCD 3CWBE 1VQPP 4I7ZC 1L4AD 1SQPD 1T8ZA 3T97A 4C7NA 1PL5A 2GUVA 1BGYJ 2QIWA 1J1EB 2IBZE 3AECC 3L75G 3F5HA 1URQA 1LTAC 2IPPA 1AFOA 2FXMA 3CWBJ 3G3ZA 2CK3H 2XV5A 1VQ8P 1JTHA 2V7QJ 1MV8A 3M0DA 1MFTA 1JMBA 1IJDB 1S5LE 2WPSA 1KYOD 1BE3G 2WSEH 3AE6C 3F89A 4KJMA 3QH9A 2PAJA 2FYUK 5APTA 2P67A 1RE3A 1Y8AA 1YYCA 1GK4A 3IF4A 3V4WA 3CMAP 3BCCE 2YNYA 3CX5H 1M7LA 3M9HA 2E76C 4RESB 2FYUG 3CXHH 4K3AA 3LW5H 2FY8A 3CX5D 5EFWB 3KPEA 5KLVK 1FZCA 1JO5A 2KZIA 1N7LA 1HJBA 1USEA 1SVFA 3L36A 1N2DC 2AEMA 1SQVG 2KB7P 1Z56A 1SQBK 3H1KD 1LTJC 1LWUB 1NU1G 5TISE 4LLHA 5KLVG 1AQ5A 5CJ0A 1HF9A 2OYIA 1T2KD 3G4SP 1SQVK 4U3FE 1GW4A 2HODB 2O1KA 3HUSC 1N7SB 4WY4B 5KAFH 3N4XA 4PD4H 1SQBD 3M0AA 5KJ7D 1PP9D 2RN0A 4EIJA 3TSIA 1NKZB 3SWKA 3B4SA 1AA0A 2FYUE 1SQPJ 2E74B 5KAIH 3FXDA 3B5NB 3IFMA 2R3SA 3VTPC 4NPDA 4OGQC 1IC2A 5AW3B 5GTHH 1PFIA 4Y99C 2IBZD 1URQD 3H1LE 1L0LK 1FZEA 3A0HE 1X0TA 2M0BA 3D6ZA 4RO0A 1S72P 3CCLP 2W27A 3L73D 3CCRP 3CCEP 2PRRA 4H0LB 3HE5A 1LT9B 2QA4P 1KB9H 1RY3A 2QJPC 5AVWB 1LTSC 1FC2C 1FU1A 4MN4C 2J5UA 3H1KE 2K88A 3IAOA 1FZCC 1G1IA 1KQGB 1ZXGA 2FBWC 4WY4A 2Q7CA 2JWDA 2K3RA 2LXCB 5CCHA 1K04A 2BEQD 4IOIH 1FAVA 1RHZB 2R3CA 2WQYC 2WSEJ 3G9RA 3VP9A 3LW5J 5K5GB 1TU3F 2KLVA 3I56P 3CC4P 4C46A 1LWUA 2M3EA 5KTBA 1NTKG 1FOSE 1NAFA 3H1HE 2MKVA 4EYYQ 4JPZB 5H2FH 1NTME 1L0NJ 1JUNA 3K5BA 2D2CC 1LT1A 1IFIA 1N8RQ 1M57D 2ZVOB 1NTMD 3TGUJ 3MZWB 4WVZA 5KAFE 1GU4A 2OARA 1PP9J 2A06D 4WBAA 3EFFK 2UWJE 1K05A 1M1KQ 1U7MA 3H1IE 3L71G 4OGQB 4JF7A 3M9BA 3NTNA 1Q86Q 3MP7B 3U1AA 4JQ0D 2FKWB 3AEEC 2JKVA 1E5WA 4PV1D 2KLUA 3M9QA 2CPSA 3OAKA 1IFPA 2WTYA 1FJKA 2WITA 3B8EB 1MZ9A 4IL6H 1NJIQ 2OYHA 3MHVA 3A0HH 3KZIH 2YXRB 4WY4D 4IFFA 2KZJA 3GG2A 1RF0C 4NPEA 1VQOP 1KN7A 4U3FJ 5AW0B 3D70A 3S9OA 3USSA 1JY2N 2YKQA 3V2QA 3BCCJ 4W7ZA 1VQ5P 1GTWA 2E43A 4RJTA 3RK2D 1ZR2A 1SQBG 1NWQA 4L74A 1URQB 1EDLA 3OA7A 1PGPA 3HD7B 1ZV8A 2I8DA 4ZKUA 1NYHA 2Y9YA 1ZOYC 3L70G 4B86A 4H13C 1KV4A 1LNQA 1K8AQ 3AEBC 1E79H 1NH4A 1WRGA 2JR8A 3TGUD 1SQVD 2ZT9B 3H1JD 3H1KG 1EC5A 3SSUA 4GOFA 5KJ7A 1KD1Q 1RF1C 1HBWA 4ZKPA 1IFDA 2XNXA 3H1JE 2ZXXA 1JCDA 1G2CB 1L0ND 1QEXA 2B9BA 2IZ1A 1HJ0A 3FX0A 3H1ID 2P2UA 2FYUJ 1DD4A 2WSCH 3A2AA 2IDBA 2KS1B 3TYYA 1PIXA 1VDFA 2Z5IA 4IL6X 4YXWH 4UB6E 4YXDC 2JP3A 2PGDA 2DW3A 3U1CA 3H25A 4U7JA 2B87B 1P84D 2OTJP 3BASA 5AVYB 5APUA 2FXOA 1KB9I 2E75D 3RK2C 4C7RA 4DCKA 4U3FD 4BWNA 3GHGB 5CJ4A 3RBZA 1P84E 2K9JA 3ITKA 5AW2B 2ZYGA 1GL2B 3P8CE 1PP9E 2OYIC 3WMM0 2QJPB 5AW1B 3HUSA 2JJLA 2E74D 3A3YB 3FWNA 2R32A 4H44D 1NTKD 3CCMP 1ZP0C 3V2NA 4PD4E 1MUUA 2POHA 2VRSA 3AEGC 1CW5A 1SFCA 2YMYA 4PD4D 4U3FG 2HFED 1L0LJ 5APVA 2QG4A 3L4FA 4CPGA 1LTGC 4BXLA 3TGUE 1BE3E 3PH0A 1SQVE 2E74C 2I1KA 1AVOA 2N1TD 1GMJA 5DJUB 5AW6B 3V5BA 3CPWO 2YKOA 2FFDB 4NPFX 3FXEA 4Z1MH 1D7MA 3H1IJ 3D71A 2Q9IA 3MUDC 2Y9ZA 2PFXA 1W5CE 1EQ7A 1N7SC 1SQVJ 1FE6A 3RK3E 3L70J 2IBZG 5KLIC 1GU5A 4PJ0H 2HPCA 1EDKA 5APWA 1RE3C 1ZRTE 2Z4EA 3CWBG 1P84I 1BSNA 3H1JG 1KB9D 2P10A 3W68A 2K1AA 1SQPK 2A06G 1LTIC 1LTJA 1VF5B 3AE2C 5TJHA 3AEAC 3VOPA 1S4XA 3HE5B 1FZBA 1IO4A 2M5AA 1X79B 2ZXEB 3W67A 4A7PA 2N9YB 2W6BA 4WB4A 3CCVP 4ASWA 3L74D 4BRYB 1R8EA 1NTZE 3S4RA 1T6AA 3IR9A 3JC22 2N9BA 1LT9C 2NZ2A 5E79E 2KNCB 5C39A 1OXZA 2AXCA 1FBMA 4HJGH 2W6AA 5AW7B 1FZFA 2FYUD 2A06E 2WT7A 3TDKA 2KP8A 1XTGB 5KKZB 1QLED 1OZHA 2YO2A 3L71J 1VQNP 2Y0CA 2AEJA 3GMAA 1RE4C 2A45H 1FJPA 4GDOA 3P7KA 1N7SA 3S1KA 1ZLLA 3HRNA 3VN0A 4ASVA 5CCHD 5GTIE 1OWAA 2O1JA 1L0NK 1GZLA 3RGUA 2QM8A 1K9MQ 3CC7P 1NTZK 3E1IA 3E1RA 1JY2P 1Y47A 3RK2B 1YI2P 4TT3H 1Q7YQ 1LGHB 1M1JC 2I1JA 2NPSA 4HH2A 3TGUG 5M1BA 2FYNB 3D6YA 1NVOA 1G1JA 2NPSB 2ZYDA 1PP9G 1RQVA 3WU2E 3L70D 1SP4A 3PLNA 4W80A 2C9LY 1YJ9P 1KFMA 3P8CD 4BRYA 4GT1A 3AE8C 1NO4A 1RQUA 2E76B 3GLMA 2HLOA 3L74J 1NU1D 4JBZA 1L0NE 5AVTB 2FYZA 1YJNP 1RH5B 1N7SD 1NOHA 5E79H 4YPCA 3G71P 1FZAA 4PV1B 4L75A 2XNDH 3H32B 1RE4A 1L0LG 2XZRA 5CHXA 3MTUE 2N1TC 2KSJA 2WMMA 4Y28J 4HYTB 3SWYA 3B5ND 3CD6P 3RL0B 2YXQB 1OW7A 1Y9BA 1S5LH 1FZCB 1VF5C 1JCCA 2OYOA 1X8YA 1GL2A 2HPCB 3RL0D 3RK3D 4I7ZB 4H0LC 1UIXA 4OWFA 3PJSK 1EZVE 1XTCC 2YMKA 1GL2D 1K73Q 2E42A 2ZFCA 3L71D 2WPRA 2NPSC 3NXSA 1W2EA 1NKNA 3L70E 3M91A 3N7NA 3OJAB 1PGQA 3TF5A 3TNUA 1M1JB 3C9IA 1P84H 3Q5RA 1EDIA 1YTZT 2LXBA 3GF7A 5AVZB 2CPBA 1S9KD 2BCCJ 3HTKA 2Q5UA 2BEZF 3WU2H 4HB1A 3V6IA 5GTIH 2E75C 2QRXA 4I6MC 2PP6A 1CI6A 1L4AB 3RK3C 3CMEP 1GDTA 3O6QA 3M06A 2P7JA 1PV3A 5AVXB 1M90Q 3TK1A 1JEKA 2Y0DA 2OGUA 4H44C 1YTZI 4PD4I 5CMZA 3WUVA 4D6TJ 5KJ7C 1PZQA 5CCGD 1YJWP 2GUSA 3RL0g 5GTHE 1DD3A 4EDFA 3MD0A 1MKMA 1T3JA 1BCCG 5B5EH 3B71A 2D2CB 1LP1A 4N6JA 1S2EA 1JY2O 1HTLC 4D6TE 1BE3D 3HD7A 3Q1MA 1T2KC 3FWLA 2LR2A 3H1JJ 1EZVD 1GL2C 2ITAA 3HE4A 3AE5C 2KUBA 5AW4B 4C7NB 1VQ7P 4H0LD 3H1IG 1KB9E 3L71E 3V2RA 1U57A 3H6PA 3II6A 3GHGC 1VF5D 2IYOA 2R44A 2WPVB 2P1JA 2W90A 2KIKA 1ZMEC 1IFMA 1SQXJ 2KYVA 1JMMA 1OVUA 2B88A 3JSVC 1NTMK 5AW8B 3L74E 1H0TB 1KILD 2G3AA 3IN6A 3HE4B 4K35A 3L72D 1VPCA 3CI9A 2WSFJ 1J1DB 2BCCD 1KYOI 2H89C 3BATA 3JCUE 1J2JB 4O9BA 3Q5PA 2P58A 1BDCA 2IBZI 4I2LC 2AXTH 1H88A 5BVZA 2O01N 2IFMA 5KAIE 1L4AC 2LKMA 3RK3B 4ZMDA 3C1LA 3Q2YA 2KNCA 1NTZD 1VQ4P 1SFCC 1LP1B 3H1LD 2A45G 3RBXA 2FFDC 1G2CA 1HGZA 2K9YA 2Q3IA 4R4MA 4XE5B 1NGMB 3HD7C 1FDIA 3VYIA 5CCGA 2XDJA 1L0LE 1J1DC 3HUSB 5B5EE 1H8AA 1BE3J 4IL6E 3O6QB 4W7YA 1L0LD 4D6TD 2YKPA 2B87A 3CX5I 1N73B 1HGVA 2HG5D 3AE9C 2YO3A 1GW3A 3A0BH 3KHUA 3L75D 1ZRTD 1OX3A 4GIFA 2IYPA 2QE7H 4I1LA 5CBOA 1H0TA 5KLVJ 3G6EP 1NU1K 1M1JA 1DX7A 2N1TB 4ZNCA 1IZNB 1BGYD 2HR3A 2Y0EA 3SFEC 2ZYAA 1GK6A 1ZW0A 4PV1C 5H2FE 3TNUB 1HWTC 1FZGA 2ZJSE 4UB8H 2KS1A 4JYBA 1BSHA 3PP5A 1EDJA 3L37A 5KLVE 4JYCA 2RH0A 1PPJD 1JM0A 3L72E 1KILE 1T3UA 2H8PD
chains in the Genus database with same CATH topology
2WSFH 1CI6B 1L4AA 1J1EC 1DEBA 4DOJA 3B5NA 3V4QA 2O01H 3VMXA 1WT6A 5CCGC 3MIWA 3VN0A 3P32A 1QL2A 3BRVB 1IK9A 4GKGA 2XKMA 3A7OA 3CLQA 2J58A 1A02F 4AUWA 3L35A 5AVQB 2BASA 2J59M 1IFNA 5APSA 1KFNA 1X9VA 1QL1A 3I5CA 1NTKK 2GM4A 1ZR4A 2OYHB 3NFQA 2WZ7A 1IFJA 1KZUB 1FOSF 1LT9A 1H89A 3B5NC 3KDPB 5BU5A 5AVRB 1SFCB 3R2PA 1LTTC 5AW9B 4DZOA 1HH0A 3H32A 4OH8B 2L5GB 5AVUB 3M0DC 3NMDA 2KOGA 3HTKB 3RL0C 2IX7C 2M3BA 1SLQA 2MJZA 4W7ZA 3RL0B 1SQXK 1KILA 4AQRD 3CL3D 5AW5B 1DH3A 3VP8A 2H7HA 3UIAA 2JEEA 1JOCA 4IFDK 2WT7B 3V2PA 2WPQA 3KYQA 4N3YB 1S9KE 1A02J 1CSBA 1N73C 2H43A 5APXA 3EQ2A 1SQQK 3HD7D 1NHLA 1FDMA 5BU8B 4Y99B 1JTHB 2N1TA 2OYIB 2QM7A 3EFGA 3A5TA 3SWFA 1HVVA 1ZN5A 3BRTB 2C0WA 5APQA 1RF0A 5AVSB 3MGNA 4WY4C 4N78D 1KILC 1MFZA 1JY3P 5CCHC 2C9NY 2Z5HA 3GHGA 3LIEA 1LTJB 1LWUC 2C0XA 1HUCA 1JY3N 2IFNA 3VMZA 4IFMA 4EOTA 1N73A 2R5BA 4XA4A 1RF1B 5APYA 1RF1A 1KQLA 3VMYA 4LGDE 2WWWA 5AVVB 3O8ZA 1URQC 2FFDA 1GD2E 2OYHC 1JY3O 2R5DA 1CZQA 4N78E 3KQGA 2HODA 2XU6A 3MUDA 4AYCA 2HYNA 3U59A 1LTBC 4KHXA 1KILB 4LC1A 1N86A 2NPSD 2A45I 3P8MC 2M8RA 4M3LA 1JNMA 1SFCD 3T97A 1L4AD 1T8ZA 4C7NA 2GUVA 1J1EB 1URQA 1LTAC 2IPPA 1AFOA 2FXMA 3G3ZA 2XV5A 1JTHA 1MV8A 3M0DA 1IJDB 2WPSA 2WSEH 5APTA 2PAJA 2FYUK 3V4WA 2P67A 1RE3A 1YYCA 1GK4A 2YNYA 1M7LA 3M9HA 4RESB 5KLVK 3LW5H 1JO5A 1FZCA 3KPEA 1N7LA 1HJBA 1SVFA 3L36A 1N2DC 2KB7P 1Z56A 1SQBK 1AQ5A 1LTJC 1LWUB 4LLHA 5CJ0A 2OYIA 1T2KD 1SQVK 3HUSC 1GW4A 2HODB 2O1KA 1N7SB 4WY4B 3N4XA 3M0AA 5KJ7D 4EIJA 3TSIA 1NKZB 3B5NB 3IFMA 3VTPC 1IC2A 5AW3B 1PFIA 4Y99C 1URQD 1L0LK 1FZEA 2W27A 3HE5A 1LT9B 5AVWB 1RY3A 1LTSC 1FU1A 1FZCC 1G1IA 4WY4A 2Q7CA 5CCHA 1FAVA 2R3CA 3VP9A 2KLVA 4C46A 1LWUA 5KTBA 1FOSE 1NAFA 1JUNA 1IFIA 1GU4A 2OARA 4WBAA 4JF7A 3M9BA 3NTNA 3U1AA 2FKWB 1E5WA 3M9QA 2CPSA 3OAKA 2WTYA 1FJKA 2WITA 3B8EB 1MZ9A 2OYHA 4WY4D 4IFFA 1RF0C 5AW0B 1JY2N 2YKQA 3V2QA 1GTWA 2E43A 3RK2D 1ZR2A 1NWQA 1URQB 3OA7A 3HD7B 1ZV8A 4ZKUA 4B86A 1NH4A 1WRGA 5KJ7A 1RF1C 1HBWA 4ZKPA 1IFDA 2XNXA 1JCDA 1G2CB 3TNUA 3LIDA 2P2UA 3TYYA 2WSCH 3A2AA 1VDFA 2Z5IA 3U1CA 3BASA 5AVYB 5APUA 3RK2C 5CJ4A 4C7RA 3GHGB 5AW2B 1GL2B 3P8CE 2OYIC 3WMM0 5AW1B 3HUSA 2JJLA 3A3YB 2R32A 3V2NA 1MUUA 2POHA 2VRSA 1CW5A 1SFCA 2YMYA 2HFED 5APVA 3L4FA 1LTGC 2I1KA 2N1TD 2FFDB 3V5BA 5AW6B 2YKOA 2Q9IA 1EQ7A 1N7SC 1GU5A 2HPCA 5APWA 1RE3C 2Z4EA 1SQPK 1LTIC 1LTJA 3VOPA 3HE5B 1FZBA 1IO4A 1X79B 2ZXEB 2W6BA 4WB4A 3IR9A 2N9BA 1LT9C 1OXZA 1FZFA 1FBMA 2W6AA 5AW7B 2WT7A 2KP8A 1XTGB 2YO2A 1RE4C 2A45H 1FJPA 3P7KA 1N7SA 5CCHD 1ZLLA 3HRNA 1OWAA 2O1JA 1L0NK 1GZLA 2QM8A 1NTZK 3E1IA 3RK2B 1JY2P 1LGHB 1M1JC 2I1JA 2NPSA 4HH2A 2NPSB 1G1JA 1SP4A 4W80A 2C9LY 1KFMA 3P8CD 4GT1A 1NO4A 2HLOA 5AVTB 2FYZA 1N7SD 1NOHA 1FZAA 3H32B 1RE4A 2XZRA 5CHXA 3MTUE 2N1TC 2KSJA 3SWYA 4HYTB 3B5ND 1FZCB 1JCCA 1X8YA 1GL2A 2HPCB 3RL0D 3RK3D 1XTCC 2E42A 1GL2D 2ZFCA 3NXSA 2WPRA 2NPSC 1W2EA 1NKNA 3M91A 3OJAB 3N7NA 1M1JB 3C9IA 1YTZT 5AVZB 2CPBA 1S9KD 3HTKA 2Q5UA 4I6MC 2PP6A 1CI6A 1L4AB 3RK3C 1GDTA 3M06A 2P7JA 5AVXB 3TK1A 1DX7A 5CMZA 1YTZI 3BVHA 5KJ7C 5CCGD 2GUSA 3MD0A 1T3JA 4N6JA 1JY2O 1HTLC 1T2KC 3HD7A 1GL2C 3HE4A 4C7NB 5AW4B 3V2RA 3H6PA 3II6A 3GHGC 2P1JA 1IFMA 2KYVA 1JMMA 1NTMK 5AW8B 1KILD 3HE4B 1VPCA 3CI9A 1J1DB 3BATA 1J2JB 4O9BA 4I2LC 1H88A 5BVZA 2IFMA 1L4AC 2LKMA 3RK3B 1SFCC 2A45G 2FFDC 1G2CA 1HGZA 2Q3IA 4XE5B 3HD7C 3VYIA 5CCGA 2XDJA 3HUSB 1J1DC 1H8AA 4W7YA 2YKPA 1N73B 1HGVA 2HG5D 2YO3A 1GW3A 4GIFA 4I1LA 1NU1K 1M1JA 2N1TB 3TNUB 1GK6A 1HWTC 1FZGA 4JYBA 3PP5A 3L37A 4JYCA 1T3UA 2H8PD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFD A;  1HGZ A;  2CPB A;  2MJZ A;  1FDM A;  1IFJ A;  1NH4 A;  2C0W A;  1HGV A;  2C0X A;  1HH0 A;  1IFI A;  2CPS A; 
#chains in the Genus database with same CATH topology
 2WSF H;  1CI6 B;  1L4A A;  1J1E C;  3ABV C;  1DEB A;  1PPJ E;  1SQX D;  2OTK E;  1WMK A;  4DOJ A;  3B5N A;  3E7K A;  3V4Q A;  1VL2 A;  2O01 H;  3L72 J;  4H44 B;  1VQK P;  1AQT A;  1NTZ J;  3VMX A;  1WT6 A;  5B66 H;  5CCG C;  2YIU B;  2FYN C;  1OIP A;  3MIW A;  3PTZ A;  1EXJ A;  2QJY C;  1YQ4 C;  2KI7 B;  2M5A B;  3L73 G;  3P32 A;  4OGQ D;  4UB6 H;  1M56 D;  1Q90 D;  1QL2 A;  1OMI A;  1S5L X;  1SQQ J;  3BRV B;  3C8V A;  1IK9 A;  1KYO H;  2K37 A;  1R5S A;  1QGK B;  2XKM A;  3A7O A;  3CX5 E;  4GKG A;  4H13 B;  4L73 A;  3CLQ A;  3AED C;  1BDD A;  2J58 A;  1A02 F;  4AUW A;  3L35 A;  3CXH D;  5AVQ B;  1EZV I;  2BAS A;  2J59 M;  3CCQ P;  1IFN A;  4RKU J;  5APS A;  2Q1K A;  1KFN A;  1X9V A;  1QL1 A;  2QJK B;  1L2P A;  3I5C A;  3L75 E;  1NTK K;  3L74 G;  2RMZ A;  5DJT B;  1DH3 A;  2QJK C;  2GM4 A;  1OVV A;  5KKZ C;  1ZR4 A;  2KSE A;  2OYH B;  3NFQ A;  2OQQ A;  2WZ7 A;  3AE1 C;  1SQX E;  2W83 C;  1IFJ A;  1BGY G;  1KZU B;  2JDI H;  4YTP C;  1FOS F;  1KMI Z;  3L75 J;  2E76 D;  1LT9 A;  4KT0 J;  3H1L J;  1H89 A;  3B5N C;  5KLV D;  2Q6Q A;  1KTM A;  3KDP B;  5BU5 A;  5AVR B;  1SFC B;  4R4L A;  1W2B O;  1SS1 A;  2E5Y A;  1LTT C;  3R2P A;  3WUT A;  4GOD A;  5AW9 B;  4WWI A;  1HH0 A;  4DZO A;  3AEF C;  3H32 A;  4D6T G;  3Q5S A;  2KK7 A;  4OH8 B;  2L5G B;  5AVU B;  2H88 C;  3L73 E;  3M0D C;  3NMD A;  1JB0 J;  1VQL P;  2KOG A;  5B66 E;  3HTK B;  1NU1 J;  1BCC J;  3Q3D A;  3RL0 C;  1M8O B;  1OFC X;  1S1C X;  2IX7 C;  3BVH A;  3AE7 C;  2WSC J;  2M3B A;  1SLQ A;  2MJZ A;  1PGJ A;  3AE4 C;  3LID A;  1KYO E;  1YQ3 C;  2IZ0 A;  3AE3 C;  1SQX K;  3PRJ A;  3A5T A;  1VQM P;  1KIL A;  5KLI B;  3CC2 P;  1BCC E;  4XFJ A;  1NTM J;  4AQR D;  1VQ9 P;  1LJ2 A;  3CL3 D;  3H1H D;  3L72 G;  5AW5 B;  1PGO A;  1YIT P;  1SQP G;  1AV1 A;  3VP8 A;  1KC8 Q;  2JO1 A;  3UIA A;  2JEE A;  2H7H A;  1JOC A;  2Q3E A;  1SQQ D;  4IFD K;  2WT7 B;  3EWK A;  1QVF O;  3V2P A;  1BGY E;  2WPQ A;  2E5T A;  3KYQ A;  4N3Y B;  1S9K E;  3GF3 A;  1SQQ G;  1A02 J;  1CSB A;  2O01 J;  3PHL A;  4OVN F;  1N73 C;  2L91 A;  3OW2 O;  2H43 A;  5APX A;  4H13 D;  1YBK A;  3EQ2 A;  2AEF A;  1SQQ K;  2BCC E;  2G8Y A;  2AXT E;  1NHL A;  3H1H G;  3HD7 D;  3CCJ P;  3CCS P;  2ZAE B;  1FDM A;  2W6J H;  1YIJ P;  5BU8 B;  1NAY A;  1JTH B;  4Y99 B;  1QX8 A;  2N1T A;  3VMA A;  2QM7 A;  4DT0 A;  2OYI B;  1QVG O;  1EZV G;  3EFG A;  2QVA A;  3QWO C;  3SWF A;  4L76 A;  1HVV A;  1ZN5 A;  2E75 B;  2C0W A;  3BCC D;  3BRT B;  5APQ A;  3ZDM A;  5CBN A;  1RF0 A;  4PJ0 E;  3T97 B;  1BCC D;  2V7Q H;  1OVR A;  1L0N G;  5AVS B;  2OTL P;  3MGN A;  4WY4 C;  2ZT9 D;  1KIL C;  1MFZ A;  1JY3 P;  4N78 D;  4QMA A;  5CCH C;  3H1L G;  1YHQ P;  2C9N Y;  1Q82 Q;  2Z5H A;  1FDO A;  1S3J A;  1SQQ E;  1USD A;  2FXP A;  1OW8 A;  2V4H A;  2YIU C;  3GHG A;  3LIE A;  4HKZ H;  1LTJ B;  1LWU C;  3R4Y A;  1PPJ G;  2JWA A;  2C0X A;  1IK7 A;  1HUC A;  1SQB E;  1JY3 N;  2BCC G;  2IFN A;  3SFD C;  3I55 P;  1SQP E;  3VMZ A;  3WUU A;  4IFM A;  1UII A;  4EOT A;  1AJY A;  1N73 A;  4UB8 E;  2R5B A;  2QSI A;  4XA4 A;  1RF1 B;  3JCU H;  3KXD A;  1KQF B;  5APY A;  1U7J A;  2ZT9 C;  4DJG A;  4TLF A;  1KQL A;  4EI2 A;  1SQB J;  3GW6 A;  1Q81 Q;  3VMY A;  1RF1 A;  1Q2N A;  2D2C D;  4LGD E;  2SPZ A;  1NU1 E;  2WWW A;  3CWB D;  1DEE G;  5AVV B;  1OW6 A;  2QEX P;  2NRG A;  1URQ C;  3O8Z A;  2FFD A;  3FGA D;  1GD2 E;  3H1K J;  1X22 A;  2OYH C;  1JY3 O;  2R5D A;  2W8Z A;  1CZQ A;  2RKL A;  3BCC G;  3KQG A;  3KZI E;  4N78 E;  2HOD A;  2XU6 A;  2O3J A;  1VQ6 P;  3MUD A;  3CXH E;  1KQS O;  4GOE A;  5L8R J;  1KOR A;  3L73 J;  1AVY A;  4AYC A;  2HYN A;  1NTZ G;  3H1H J;  2GA1 A;  2ZVN B;  3U59 A;  5TIS H;  1LTB C;  2KXP B;  3A0B E;  1NTK J;  3CXH I;  4KHX A;  1KIL B;  1EXI A;  1SQX G;  4LC1 A;  2B89 A;  1N86 A;  2NPS D;  1R5L A;  2WSS H;  2A45 I;  1NTM G;  2M8R A;  2WVR A;  3P8M C;  1DIP A;  2QJY B;  2K9J B;  4M3L A;  1NTK E;  1JNM A;  1FS0 E;  3CCU P;  1SFC D;  3CWB E;  1VQP P;  4I7Z C;  1L4A D;  1SQP D;  1T8Z A;  3T97 A;  4C7N A;  1PL5 A;  2GUV A;  1BGY J;  2QIW A;  1J1E B;  2IBZ E;  3AEC C;  3L75 G;  3F5H A;  1URQ A;  1LTA C;  2IPP A;  1AFO A;  2FXM A;  3CWB J;  3G3Z A;  2CK3 H;  2XV5 A;  1VQ8 P;  1JTH A;  2V7Q J;  1MV8 A;  3M0D A;  1MFT A;  1JMB A;  1IJD B;  1S5L E;  2WPS A;  1KYO D;  1BE3 G;  2WSE H;  3AE6 C;  3F89 A;  4KJM A;  3QH9 A;  2PAJ A;  2FYU K;  5APT A;  2P67 A;  1RE3 A;  1Y8A A;  1YYC A;  1GK4 A;  3IF4 A;  3V4W A;  3CMA P;  3BCC E;  2YNY A;  3CX5 H;  1M7L A;  3M9H A;  2E76 C;  4RES B;  2FYU G;  3CXH H;  4K3A A;  3LW5 H;  2FY8 A;  3CX5 D;  5EFW B;  3KPE A;  5KLV K;  1FZC A;  1JO5 A;  2KZI A;  1N7L A;  1HJB A;  1USE A;  1SVF A;  3L36 A;  1N2D C;  2AEM A;  1SQV G;  2KB7 P;  1Z56 A;  1SQB K;  3H1K D;  1LTJ C;  1LWU B;  1NU1 G;  5TIS E;  4LLH A;  5KLV G;  1AQ5 A;  5CJ0 A;  1HF9 A;  2OYI A;  1T2K D;  3G4S P;  1SQV K;  4U3F E;  1GW4 A;  2HOD B;  2O1K A;  3HUS C;  1N7S B;  4WY4 B;  5KAF H;  3N4X A;  4PD4 H;  1SQB D;  3M0A A;  5KJ7 D;  1PP9 D;  2RN0 A;  4EIJ A;  3TSI A;  1NKZ B;  3SWK A;  3B4S A;  1AA0 A;  2FYU E;  1SQP J;  2E74 B;  5KAI H;  3FXD A;  3B5N B;  3IFM A;  2R3S A;  3VTP C;  4NPD A;  4OGQ C;  1IC2 A;  5AW3 B;  5GTH H;  1PFI A;  4Y99 C;  2IBZ D;  1URQ D;  3H1L E;  1L0L K;  1FZE A;  3A0H E;  1X0T A;  2M0B A;  3D6Z A;  4RO0 A;  1S72 P;  3CCL P;  2W27 A;  3L73 D;  3CCR P;  3CCE P;  2PRR A;  4H0L B;  3HE5 A;  1LT9 B;  2QA4 P;  1KB9 H;  1RY3 A;  2QJP C;  5AVW B;  1LTS C;  1FC2 C;  1FU1 A;  4MN4 C;  2J5U A;  3H1K E;  2K88 A;  3IAO A;  1FZC C;  1G1I A;  1KQG B;  1ZXG A;  2FBW C;  4WY4 A;  2Q7C A;  2JWD A;  2K3R A;  2LXC B;  5CCH A;  1K04 A;  2BEQ D;  4IOI H;  1FAV A;  1RHZ B;  2R3C A;  2WQY C;  2WSE J;  3G9R A;  3VP9 A;  3LW5 J;  5K5G B;  1TU3 F;  2KLV A;  3I56 P;  3CC4 P;  4C46 A;  1LWU A;  2M3E A;  5KTB A;  1NTK G;  1FOS E;  1NAF A;  3H1H E;  2MKV A;  4EYY Q;  4JPZ B;  5H2F H;  1NTM E;  1L0N J;  1JUN A;  3K5B A;  2D2C C;  1LT1 A;  1IFI A;  1N8R Q;  1M57 D;  2ZVO B;  1NTM D;  3TGU J;  3MZW B;  4WVZ A;  5KAF E;  1GU4 A;  2OAR A;  1PP9 J;  2A06 D;  4WBA A;  3EFF K;  2UWJ E;  1K05 A;  1M1K Q;  1U7M A;  3H1I E;  3L71 G;  4OGQ B;  4JF7 A;  3M9B A;  3NTN A;  1Q86 Q;  3MP7 B;  3U1A A;  4JQ0 D;  2FKW B;  3AEE C;  2JKV A;  1E5W A;  4PV1 D;  2KLU A;  3M9Q A;  2CPS A;  3OAK A;  1IFP A;  2WTY A;  1FJK A;  2WIT A;  3B8E B;  1MZ9 A;  4IL6 H;  1NJI Q;  2OYH A;  3MHV A;  3A0H H;  3KZI H;  2YXR B;  4WY4 D;  4IFF A;  2KZJ A;  3GG2 A;  1RF0 C;  4NPE A;  1VQO P;  1KN7 A;  4U3F J;  5AW0 B;  3D70 A;  3S9O A;  3USS A;  1JY2 N;  2YKQ A;  3V2Q A;  3BCC J;  4W7Z A;  1VQ5 P;  1GTW A;  2E43 A;  4RJT A;  3RK2 D;  1ZR2 A;  1SQB G;  1NWQ A;  4L74 A;  1URQ B;  1EDL A;  3OA7 A;  1PGP A;  3HD7 B;  1ZV8 A;  2I8D A;  4ZKU A;  1NYH A;  2Y9Y A;  1ZOY C;  3L70 G;  4B86 A;  4H13 C;  1KV4 A;  1LNQ A;  1K8A Q;  3AEB C;  1E79 H;  1NH4 A;  1WRG A;  2JR8 A;  3TGU D;  1SQV D;  2ZT9 B;  3H1J D;  3H1K G;  1EC5 A;  3SSU A;  4GOF A;  5KJ7 A;  1KD1 Q;  1RF1 C;  1HBW A;  4ZKP A;  1IFD A;  2XNX A;  3H1J E;  2ZXX A;  1JCD A;  1G2C B;  1L0N D;  1QEX A;  2B9B A;  2IZ1 A;  1HJ0 A;  3FX0 A;  3H1I D;  2P2U A;  2FYU J;  1DD4 A;  2WSC H;  3A2A A;  2IDB A;  2KS1 B;  3TYY A;  1PIX A;  1VDF A;  2Z5I A;  4IL6 X;  4YXW H;  4UB6 E;  4YXD C;  2JP3 A;  2PGD A;  2DW3 A;  3U1C A;  3H25 A;  4U7J A;  2B87 B;  1P84 D;  2OTJ P;  3BAS A;  5AVY B;  5APU A;  2FXO A;  1KB9 I;  2E75 D;  3RK2 C;  4C7R A;  4DCK A;  4U3F D;  4BWN A;  3GHG B;  5CJ4 A;  3RBZ A;  1P84 E;  2K9J A;  3ITK A;  5AW2 B;  2ZYG A;  1GL2 B;  3P8C E;  1PP9 E;  2OYI C;  3WMM 0;  2QJP B;  5AW1 B;  3HUS A;  2JJL A;  2E74 D;  3A3Y B;  3FWN A;  2R32 A;  4H44 D;  1NTK D;  3CCM P;  1ZP0 C;  3V2N A;  4PD4 E;  1MUU A;  2POH A;  2VRS A;  3AEG C;  1CW5 A;  1SFC A;  2YMY A;  4PD4 D;  4U3F G;  2HFE D;  1L0L J;  5APV A;  2QG4 A;  3L4F A;  4CPG A;  1LTG C;  4BXL A;  3TGU E;  1BE3 E;  3PH0 A;  1SQV E;  2E74 C;  2I1K A;  1AVO A;  2N1T D;  1GMJ A;  5DJU B;  5AW6 B;  3V5B A;  3CPW O;  2YKO A;  2FFD B;  4NPF X;  3FXE A;  4Z1M H;  1D7M A;  3H1I J;  3D71 A;  2Q9I A;  3MUD C;  2Y9Z A;  2PFX A;  1W5C E;  1EQ7 A;  1N7S C;  1SQV J;  1FE6 A;  3RK3 E;  3L70 J;  2IBZ G;  5KLI C;  1GU5 A;  4PJ0 H;  2HPC A;  1EDK A;  5APW A;  1RE3 C;  1ZRT E;  2Z4E A;  3CWB G;  1P84 I;  1BSN A;  3H1J G;  1KB9 D;  2P10 A;  3W68 A;  2K1A A;  1SQP K;  2A06 G;  1LTI C;  1LTJ A;  1VF5 B;  3AE2 C;  5TJH A;  3AEA C;  3VOP A;  1S4X A;  3HE5 B;  1FZB A;  1IO4 A;  2M5A A;  1X79 B;  2ZXE B;  3W67 A;  4A7P A;  2N9Y B;  2W6B A;  4WB4 A;  3CCV P;  4ASW A;  3L74 D;  4BRY B;  1R8E A;  1NTZ E;  3S4R A;  1T6A A;  3IR9 A;  3JC2 2;  2N9B A;  1LT9 C;  2NZ2 A;  5E79 E;  2KNC B;  5C39 A;  1OXZ A;  2AXC A;  1FBM A;  4HJG H;  2W6A A;  5AW7 B;  1FZF A;  2FYU D;  2A06 E;  2WT7 A;  3TDK A;  2KP8 A;  1XTG B;  5KKZ B;  1QLE D;  1OZH A;  2YO2 A;  3L71 J;  1VQN P;  2Y0C A;  2AEJ A;  3GMA A;  1RE4 C;  2A45 H;  1FJP A;  4GDO A;  3P7K A;  1N7S A;  3S1K A;  1ZLL A;  3HRN A;  3VN0 A;  4ASV A;  5CCH D;  5GTI E;  1OWA A;  2O1J A;  1L0N K;  1GZL A;  3RGU A;  2QM8 A;  1K9M Q;  3CC7 P;  1NTZ K;  3E1I A;  3E1R A;  1JY2 P;  1Y47 A;  3RK2 B;  1YI2 P;  4TT3 H;  1Q7Y Q;  1LGH B;  1M1J C;  2I1J A;  2NPS A;  4HH2 A;  3TGU G;  5M1B A;  2FYN B;  3D6Y A;  1NVO A;  1G1J A;  2NPS B;  2ZYD A;  1PP9 G;  1RQV A;  3WU2 E;  3L70 D;  1SP4 A;  3PLN A;  4W80 A;  2C9L Y;  1YJ9 P;  1KFM A;  3P8C D;  4BRY A;  4GT1 A;  3AE8 C;  1NO4 A;  1RQU A;  2E76 B;  3GLM A;  2HLO A;  3L74 J;  1NU1 D;  4JBZ A;  1L0N E;  5AVT B;  2FYZ A;  1YJN P;  1RH5 B;  1N7S D;  1NOH A;  5E79 H;  4YPC A;  3G71 P;  1FZA A;  4PV1 B;  4L75 A;  2XND H;  3H32 B;  1RE4 A;  1L0L G;  2XZR A;  5CHX A;  3MTU E;  2N1T C;  2KSJ A;  2WMM A;  4Y28 J;  4HYT B;  3SWY A;  3B5N D;  3CD6 P;  3RL0 B;  2YXQ B;  1OW7 A;  1Y9B A;  1S5L H;  1FZC B;  1VF5 C;  1JCC A;  2OYO A;  1X8Y A;  1GL2 A;  2HPC B;  3RL0 D;  3RK3 D;  4I7Z B;  4H0L C;  1UIX A;  4OWF A;  3PJS K;  1EZV E;  1XTC C;  2YMK A;  1GL2 D;  1K73 Q;  2E42 A;  2ZFC A;  3L71 D;  2WPR A;  2NPS C;  3NXS A;  1W2E A;  1NKN A;  3L70 E;  3M91 A;  3N7N A;  3OJA B;  1PGQ A;  3TF5 A;  3TNU A;  1M1J B;  3C9I A;  1P84 H;  3Q5R A;  1EDI A;  1YTZ T;  2LXB A;  3GF7 A;  5AVZ B;  2CPB A;  1S9K D;  2BCC J;  3HTK A;  2Q5U A;  2BEZ F;  3WU2 H;  4HB1 A;  3V6I A;  5GTI H;  2E75 C;  2QRX A;  4I6M C;  2PP6 A;  1CI6 A;  1L4A B;  3RK3 C;  3CME P;  1GDT A;  3O6Q A;  3M06 A;  2P7J A;  1PV3 A;  5AVX B;  1M90 Q;  3TK1 A;  1JEK A;  2Y0D A;  2OGU A;  4H44 C;  1YTZ I;  4PD4 I;  5CMZ A;  3WUV A;  4D6T J;  5KJ7 C;  1PZQ A;  5CCG D;  1YJW P;  2GUS A;  3RL0 g;  5GTH E;  1DD3 A;  4EDF A;  3MD0 A;  1MKM A;  1T3J A;  1BCC G;  5B5E H;  3B71 A;  2D2C B;  1LP1 A;  4N6J A;  1S2E A;  1JY2 O;  1HTL C;  4D6T E;  1BE3 D;  3HD7 A;  3Q1M A;  1T2K C;  3FWL A;  2LR2 A;  3H1J J;  1EZV D;  1GL2 C;  2ITA A;  3HE4 A;  3AE5 C;  2KUB A;  5AW4 B;  4C7N B;  1VQ7 P;  4H0L D;  3H1I G;  1KB9 E;  3L71 E;  3V2R A;  1U57 A;  3H6P A;  3II6 A;  3GHG C;  1VF5 D;  2IYO A;  2R44 A;  2WPV B;  2P1J A;  2W90 A;  2KIK A;  1ZME C;  1IFM A;  1SQX J;  2KYV A;  1JMM A;  1OVU A;  2B88 A;  3JSV C;  1NTM K;  5AW8 B;  3L74 E;  1H0T B;  1KIL D;  2G3A A;  3IN6 A;  3HE4 B;  4K35 A;  3L72 D;  1VPC A;  3CI9 A;  2WSF J;  1J1D B;  2BCC D;  1KYO I;  2H89 C;  3BAT A;  3JCU E;  1J2J B;  4O9B A;  3Q5P A;  2P58 A;  1BDC A;  2IBZ I;  4I2L C;  2AXT H;  1H88 A;  5BVZ A;  2O01 N;  2IFM A;  5KAI E;  1L4A C;  2LKM A;  3RK3 B;  4ZMD A;  3C1L A;  3Q2Y A;  2KNC A;  1NTZ D;  1VQ4 P;  1SFC C;  1LP1 B;  3H1L D;  2A45 G;  3RBX A;  2FFD C;  1G2C A;  1HGZ A;  2K9Y A;  2Q3I A;  4R4M A;  4XE5 B;  1NGM B;  3HD7 C;  1FDI A;  3VYI A;  5CCG A;  2XDJ A;  1L0L E;  1J1D C;  3HUS B;  5B5E E;  1H8A A;  1BE3 J;  4IL6 E;  3O6Q B;  4W7Y A;  1L0L D;  4D6T D;  2YKP A;  2B87 A;  3CX5 I;  1N73 B;  1HGV A;  2HG5 D;  3AE9 C;  2YO3 A;  1GW3 A;  3A0B H;  3KHU A;  3L75 D;  1ZRT D;  1OX3 A;  4GIF A;  2IYP A;  2QE7 H;  4I1L A;  5CBO A;  1H0T A;  5KLV J;  3G6E P;  1NU1 K;  1M1J A;  1DX7 A;  2N1T B;  4ZNC A;  1IZN B;  1BGY D;  2HR3 A;  2Y0E A;  3SFE C;  2ZYA A;  1GK6 A;  1ZW0 A;  4PV1 C;  5H2F E;  3TNU B;  1HWT C;  1FZG A;  2ZJS E;  4UB8 H;  2KS1 A;  4JYB A;  1BSH A;  3PP5 A;  1EDJ A;  3L37 A;  5KLV E;  4JYC A;  2RH0 A;  1PPJ D;  1JM0 A;  3L72 E;  1KIL E;  1T3U A;  2H8P D; 
#chains in the Genus database with same CATH homology
 2WSF H;  1CI6 B;  1L4A A;  1J1E C;  1DEB A;  4DOJ A;  3B5N A;  3V4Q A;  2O01 H;  3VMX A;  1WT6 A;  5CCG C;  3MIW A;  3VN0 A;  3P32 A;  1QL2 A;  3BRV B;  1IK9 A;  4GKG A;  2XKM A;  3A7O A;  3CLQ A;  2J58 A;  1A02 F;  4AUW A;  3L35 A;  5AVQ B;  2BAS A;  2J59 M;  1IFN A;  5APS A;  1KFN A;  1X9V A;  1QL1 A;  3I5C A;  1NTK K;  2GM4 A;  1ZR4 A;  2OYH B;  3NFQ A;  2WZ7 A;  1IFJ A;  1KZU B;  1FOS F;  1LT9 A;  1H89 A;  3B5N C;  3KDP B;  5BU5 A;  5AVR B;  1SFC B;  3R2P A;  1LTT C;  5AW9 B;  4DZO A;  1HH0 A;  3H32 A;  4OH8 B;  2L5G B;  5AVU B;  3M0D C;  3NMD A;  2KOG A;  3HTK B;  3RL0 C;  2IX7 C;  2M3B A;  1SLQ A;  2MJZ A;  4W7Z A;  3RL0 B;  1SQX K;  1KIL A;  4AQR D;  3CL3 D;  5AW5 B;  1DH3 A;  3VP8 A;  2H7H A;  3UIA A;  2JEE A;  1JOC A;  4IFD K;  2WT7 B;  3V2P A;  2WPQ A;  3KYQ A;  4N3Y B;  1S9K E;  1A02 J;  1CSB A;  1N73 C;  2H43 A;  5APX A;  3EQ2 A;  1SQQ K;  3HD7 D;  1NHL A;  1FDM A;  5BU8 B;  4Y99 B;  1JTH B;  2N1T A;  2OYI B;  2QM7 A;  3EFG A;  3A5T A;  3SWF A;  1HVV A;  1ZN5 A;  3BRT B;  2C0W A;  5APQ A;  1RF0 A;  5AVS B;  3MGN A;  4WY4 C;  4N78 D;  1KIL C;  1MFZ A;  1JY3 P;  5CCH C;  2C9N Y;  2Z5H A;  3GHG A;  3LIE A;  1LTJ B;  1LWU C;  2C0X A;  1HUC A;  1JY3 N;  2IFN A;  3VMZ A;  4IFM A;  4EOT A;  1N73 A;  2R5B A;  4XA4 A;  1RF1 B;  5APY A;  1RF1 A;  1KQL A;  3VMY A;  4LGD E;  2WWW A;  5AVV B;  3O8Z A;  1URQ C;  2FFD A;  1GD2 E;  2OYH C;  1JY3 O;  2R5D A;  1CZQ A;  4N78 E;  3KQG A;  2HOD A;  2XU6 A;  3MUD A;  4AYC A;  2HYN A;  3U59 A;  1LTB C;  4KHX A;  1KIL B;  4LC1 A;  1N86 A;  2NPS D;  2A45 I;  3P8M C;  2M8R A;  4M3L A;  1JNM A;  1SFC D;  3T97 A;  1L4A D;  1T8Z A;  4C7N A;  2GUV A;  1J1E B;  1URQ A;  1LTA C;  2IPP A;  1AFO A;  2FXM A;  3G3Z A;  2XV5 A;  1JTH A;  1MV8 A;  3M0D A;  1IJD B;  2WPS A;  2WSE H;  5APT A;  2PAJ A;  2FYU K;  3V4W A;  2P67 A;  1RE3 A;  1YYC A;  1GK4 A;  2YNY A;  1M7L A;  3M9H A;  4RES B;  5KLV K;  3LW5 H;  1JO5 A;  1FZC A;  3KPE A;  1N7L A;  1HJB A;  1SVF A;  3L36 A;  1N2D C;  2KB7 P;  1Z56 A;  1SQB K;  1AQ5 A;  1LTJ C;  1LWU B;  4LLH A;  5CJ0 A;  2OYI A;  1T2K D;  1SQV K;  3HUS C;  1GW4 A;  2HOD B;  2O1K A;  1N7S B;  4WY4 B;  3N4X A;  3M0A A;  5KJ7 D;  4EIJ A;  3TSI A;  1NKZ B;  3B5N B;  3IFM A;  3VTP C;  1IC2 A;  5AW3 B;  1PFI A;  4Y99 C;  1URQ D;  1L0L K;  1FZE A;  2W27 A;  3HE5 A;  1LT9 B;  5AVW B;  1RY3 A;  1LTS C;  1FU1 A;  1FZC C;  1G1I A;  4WY4 A;  2Q7C A;  5CCH A;  1FAV A;  2R3C A;  3VP9 A;  2KLV A;  4C46 A;  1LWU A;  5KTB A;  1FOS E;  1NAF A;  1JUN A;  1IFI A;  1GU4 A;  2OAR A;  4WBA A;  4JF7 A;  3M9B A;  3NTN A;  3U1A A;  2FKW B;  1E5W A;  3M9Q A;  2CPS A;  3OAK A;  2WTY A;  1FJK A;  2WIT A;  3B8E B;  1MZ9 A;  2OYH A;  4WY4 D;  4IFF A;  1RF0 C;  5AW0 B;  1JY2 N;  2YKQ A;  3V2Q A;  1GTW A;  2E43 A;  3RK2 D;  1ZR2 A;  1NWQ A;  1URQ B;  3OA7 A;  3HD7 B;  1ZV8 A;  4ZKU A;  4B86 A;  1NH4 A;  1WRG A;  5KJ7 A;  1RF1 C;  1HBW A;  4ZKP A;  1IFD A;  2XNX A;  1JCD A;  1G2C B;  3TNU A;  3LID A;  2P2U A;  3TYY A;  2WSC H;  3A2A A;  1VDF A;  2Z5I A;  3U1C A;  3BAS A;  5AVY B;  5APU A;  3RK2 C;  5CJ4 A;  4C7R A;  3GHG B;  5AW2 B;  1GL2 B;  3P8C E;  2OYI C;  3WMM 0;  5AW1 B;  3HUS A;  2JJL A;  3A3Y B;  2R32 A;  3V2N A;  1MUU A;  2POH A;  2VRS A;  1CW5 A;  1SFC A;  2YMY A;  2HFE D;  5APV A;  3L4F A;  1LTG C;  2I1K A;  2N1T D;  2FFD B;  3V5B A;  5AW6 B;  2YKO A;  2Q9I A;  1EQ7 A;  1N7S C;  1GU5 A;  2HPC A;  5APW A;  1RE3 C;  2Z4E A;  1SQP K;  1LTI C;  1LTJ A;  3VOP A;  3HE5 B;  1FZB A;  1IO4 A;  1X79 B;  2ZXE B;  2W6B A;  4WB4 A;  3IR9 A;  2N9B A;  1LT9 C;  1OXZ A;  1FZF A;  1FBM A;  2W6A A;  5AW7 B;  2WT7 A;  2KP8 A;  1XTG B;  2YO2 A;  1RE4 C;  2A45 H;  1FJP A;  3P7K A;  1N7S A;  5CCH D;  1ZLL A;  3HRN A;  1OWA A;  2O1J A;  1L0N K;  1GZL A;  2QM8 A;  1NTZ K;  3E1I A;  3RK2 B;  1JY2 P;  1LGH B;  1M1J C;  2I1J A;  2NPS A;  4HH2 A;  2NPS B;  1G1J A;  1SP4 A;  4W80 A;  2C9L Y;  1KFM A;  3P8C D;  4GT1 A;  1NO4 A;  2HLO A;  5AVT B;  2FYZ A;  1N7S D;  1NOH A;  1FZA A;  3H32 B;  1RE4 A;  2XZR A;  5CHX A;  3MTU E;  2N1T C;  2KSJ A;  3SWY A;  4HYT B;  3B5N D;  1FZC B;  1JCC A;  1X8Y A;  1GL2 A;  2HPC B;  3RL0 D;  3RK3 D;  1XTC C;  2E42 A;  1GL2 D;  2ZFC A;  3NXS A;  2WPR A;  2NPS C;  1W2E A;  1NKN A;  3M91 A;  3OJA B;  3N7N A;  1M1J B;  3C9I A;  1YTZ T;  5AVZ B;  2CPB A;  1S9K D;  3HTK A;  2Q5U A;  4I6M C;  2PP6 A;  1CI6 A;  1L4A B;  3RK3 C;  1GDT A;  3M06 A;  2P7J A;  5AVX B;  3TK1 A;  1DX7 A;  5CMZ A;  1YTZ I;  3BVH A;  5KJ7 C;  5CCG D;  2GUS A;  3MD0 A;  1T3J A;  4N6J A;  1JY2 O;  1HTL C;  1T2K C;  3HD7 A;  1GL2 C;  3HE4 A;  4C7N B;  5AW4 B;  3V2R A;  3H6P A;  3II6 A;  3GHG C;  2P1J A;  1IFM A;  2KYV A;  1JMM A;  1NTM K;  5AW8 B;  1KIL D;  3HE4 B;  1VPC A;  3CI9 A;  1J1D B;  3BAT A;  1J2J B;  4O9B A;  4I2L C;  1H88 A;  5BVZ A;  2IFM A;  1L4A C;  2LKM A;  3RK3 B;  1SFC C;  2A45 G;  2FFD C;  1G2C A;  1HGZ A;  2Q3I A;  4XE5 B;  3HD7 C;  3VYI A;  5CCG A;  2XDJ A;  3HUS B;  1J1D C;  1H8A A;  4W7Y A;  2YKP A;  1N73 B;  1HGV A;  2HG5 D;  2YO3 A;  1GW3 A;  4GIF A;  4I1L A;  1NU1 K;  1M1J A;  2N1T B;  3TNU B;  1GK6 A;  1HWT C;  1FZG A;  4JYB A;  3PP5 A;  3L37 A;  4JYC A;  1T3U A;  2H8P D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...