1IFJA

Molecular models and structural comparisons of native and mutant class i filamentous bacteriophages ff (fd, f1, m13), if1 and ike
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
50
structure length
50
Chain Sequence
b'AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOVIRUS
publication title Molecular models and structural comparisons of native and mutant class I filamentous bacteriophages Ff (fd, f1, M13), If1 and IKe.
pubmed doi rcsb
source organism Enterobacteria phage fd
molecule tags Virus
total genus 22
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1994-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ifjA00
1IFIA 2MJZA 1IFJA 1FDMA 1NH4A 2CPSA 2C0XA 1HGVA 1HH0A 1IFDA 2C0WA 1HGZA 2CPBA
chains in the Genus database with same CATH superfamily
4L75A 1JY3P 2K37A 2P2UA 1KB9H 2P10A 1YYCA 3CCEP 4R4LA 1EQ7A 3GW6A 3S4RA 3L74G 1ZMEC 3C9IA 1PIXA 1J1EC 5B66H 1A02J 1S9KE 2QJPC 1FDOA 3L74J 2P1JA 1LT9C 1NU1K 3AE3C 3N7NA 1L0NE 1PGJA 1FZFA 4C7NA 1K05A 3CCSP 1USDA 1JB0J 5AW6B 3GHGC 3CCLP 2FXMA 4EYYQ 5B5EH 3WMM0 3HTKA 2GM4A 3FWLA 1W2EA 2FYUG 2E43A 3FXEA 3A7OA 2WSFJ 2Y0EA 1T8ZA 2FY8A 2XNXA 2MKVA 3HE5A 2PRRA 1KYOH 3AEBC 1Q81Q 2WSFH 1EDIA 1EXJA 5AW9B 2IBZG 3B5NA 3NFQA 3WUVA 4WY4C 1ZRTE 2C9LY 3T97B 2Y9YA 4NPDA 2WPVB 3LIEA 4RKUJ 3C1LA 3H1IG 2E76C 1JM0A 1GMJA 1NWQA 3L72G 2K3RA 4EI2A 5H2FE 2WTYA 2WMMA 2HODB 3CC7P 3H1IJ 5KLVE 4I7ZB 2QG4A 3L72J 5CHXA 3RGUA 4K3AA 3CXHD 2A06E 2WPQA 4W7YA 3Q1MA 1LP1A 2FYZA 3S1KA 1CSBA 3V6IA 1NTME 4JBZA 3LW5J 3H1KG 1NVOA 3A0BE 2WT7B 3LW5H 3G4SP 1BCCD 1IFIA 1KFNA 1G2CA 1OFCX 1OVVA 1T2KD 1QVGO 2HLOA 2JEEA 1RF1B 3M0DC 3AEFC 1IK9A 2N9BA 5H2FH 3OW2O 1KD1Q 3RL0C 4GIFA 4TT3H 2L5GB 1PFIA 4N78D 3CMEP 2FYUD 1YI2P 1DD3A 3HD7D 2KNCA 1SQBK 3AEGC 2G3AA 3TGUG 1X79B 3RL0g 1JOCA 1IK7A 1LT9A 3AE6C 3A0BH 4NPEA 2J5UA 3B4SA 3TNUB 3TGUJ 2E74C 5KKZB 1IFDA 1GW3A 1NTZE 1OXZA 3VMZA 2B87B 1T6AA 5E79H 2W83C 3L73E 2SPZA 2IFNA 5KAFE 3GHGA 3PP5A 1T3UA 3L72D 4U7JA 5C39A 1NJIQ 3CWBD 2QVAA 1SQQG 2QRXA 5AW5B 1HTLC 1VQ9P 2UWJE 1NH4A 3TDKA 1FZBA 3Q5SA 1U7JA 1SVFA 4UB6H 3CCMP 3QH9A 3H1KD 1RF0C 4IL6X 1S1CX 4WY4A 1NAFA 1SQPE 3KZIE 1BGYD 2H43A 5APQA 1FJPA 1FZAA 1SQVE 3Q5RA 3LIDA 1VDFA 4L76A 1CW5A 2KI7B 2W8ZA 2FXOA 2B9BA 4H44C 2RKLA 3TYYA 1KQFB 3HUSB 3GF7A 1N7SB 1L4AB 1ZLLA 2YXRB 4YXWH 2YO3A 1DD4A 2WQYC 2BCCD 1N2DC 1S3JA 1SQXD 4DT0A 2OGUA 4WB4A 3AE5C 1SQVJ 3BVHA 1LNQA 1RHZB 2FFDB 1PV3A 1YQ4C 1LWUB 2ZYAA 1IFPA 2HR3A 2RN0A 2ZXXA 4OGQB 3VOPA 2P58A 3M0DA 4A7PA 3II6A 2FKWB 3MTUE 2KLUA 4MN4C 3L75G 1NYHA 1L0LK 1N7SD 1L4AD 1R5LA 1MFTA 1SQQD 3CX5D 5AW8B 3H1JD 5M1BA 1VL2A 3L75J 2FBWC 4DOJA 3RK3B 3KYQA 3WUUA 2W27A 3A5TA 4CPGA 1LTJB 1JMBA 1KILE 3EFGA 1SLQA 1PPJG 4OGQD 2A45I 1HF9A 2IFMA 4GODA 5CCHD 2W6BA 1YJNP 3GLMA 4R4MA 3CXHI 3SFEC 3W67A 1PP9E 2FXPA 2KXPB 3V4WA 5L8RJ 1CI6A 3RL0D 5AVSB 1GK4A 1FBMA 3AE9C 1FE6A 3D6YA 3MZWB 1VQOP 1HJBA 1JCDA 3RK3D 4O9BA 4EIJA 2OYHC 3MD0A 1GTWA 1N86A 3MUDC 2M5AA 3NXSA 1ZW0A 1H0TA 1L2PA 2J59M 4WBAA 5CBNA 1L0NK 4GT1A 1QL2A 2GUSA 1IJDB 3VYIA 3ZDMA 4H13B 3L75D 3VMYA 1EDLA 4YXDC 3G3ZA 3AE8C 3RBXA 1R5SA 3BCCD 4DZOA 2H89C 4TLFA 4HJGH 1AQ5A 3TSIA 3UIAA 3R4YA 2M8RA 1JCCA 3P32A 2POHA 2KK7A 4BXLA 1JO5A 1GD2E 1BDCA 2ZYGA 4H44D 5CCGA 5AVYB 1D7MA 3BRVB 3GMAA 3V2QA 1LJ2A 1T2KC 2QM8A 3KQGA 3TK1A 2KZJA 4EOTA 5KLVK 1OW7A 5AVRB 3M91A 4D6TG 3RBZA 1BDDA 2IZ1A 1KB9E 4I7ZC 2Z4EA 4OWFA 4D6TJ 2N1TB 4Z1MH 2QIWA 2NPSB 1NTMK 3HE4B 5APSA 2FYNC 3G71P 1DX7A 4U3FD 1ZOYC 2K9YA 2XDJA 5B66E 1Q2NA 1JEKA 2YXQB 1FZCB 1VQ8P 4Y99B 1M1JB 3D71A 3L74E 3PHLA 1JY2O 3K5BA 3MIWA 2W6JH 4OH8B 3M0AA 1FOSF 1VQ4P 1RF1C 4M3LA 2K9JA 5APVA 1FU1A 5K5GB 2OYHA 5B5EE 2A45G 2N1TD 2NPSD 3MUDA 4K35A 2O01J 1NTKG 3RK2B 5AW4B 3H32B 2JKVA 2O01H 2ZFCA 4IFDK 1OW8A 1NTZK 2A45H 1KYOE 1NTKJ 3I56P 4JQ0D 3CXHH 5KKZC 1OZHA 3CX5I 3O8ZA 2FYUE 1BCCG 5KJ7D 2LR2A 1FDMA 2KIKA 3BASA 3IFMA 1BCCJ 2PFXA 3IN6A 1HBWA 4D6TD 2IBZE 3R2PA 3H1HD 3CCRP 3IF4A 4C7NB 3KHUA 4DCKA 2P7JA 2Q6QA 2R32A 4UB8H 1ZR4A 3H1IE 2M0BA 1OWAA 3L72E 2N9YB 2FYUJ 5TISE 1SQPK 3GG2A 1SQVK 3HTKB 1DIPA 1KN7A 2HG5D 4GDOA 5CBOA 1SP4A 1BE3D 1QEXA 1J1DB 1EXIA 3HE5B 3CC4P 1Y47A 1LTIC 3H1KE 3B5NB 1MV8A 2HODA 3SWYA 1L0LD 3CWBG 4LGDE 1BGYE 4C7RA 3HUSC 1N7SC 1L4AC 3L70G 1S2EA 4BRYB 4PD4D 3HRNA 2ZAEB 3AEAC 1LTAC 3CWBJ 1NTKD 2R5BA 3HD7A 5TISH 3CCQP 2JJLA 4WWIA 3L70J 2LXCB 2AXCA 2R44A 1P84D 1YIJP 2FFDC 3SSUA 3PRJA 1BGYG 4XFJA 1LWUC 3EFFK 4ZKPA 3H1KJ 4H0LB 4W80A 2O1JA 1RF1A 4OGQC 3TGUE 1FAVA 3WU2H 1BGYJ 1ZV8A 4RJTA 5E79E 5CCHC 5AVZB 1AFOA 1QLED 2LKMA 1H89A 3JSVC 1N7LA 2QSIA 1AV1A 3RK3C 2BCCG 2QJYB 4ZKUA 1S9KD 1SQXG 1IFNA 4JYBA 2ZYDA 2BCCJ 5BU5A 4PJ0H 1LTJC 4UB6E 1SQQE 3CX5E 1SQXJ 1L0ND 3USSA 2YNYA 4H0LD 2KNCB 1QX8A 1JNMA 5EFWB 1PGPA 1URQB 5AVUB 1K8AQ 2Q9IA 4XE5B 4GKGA 3A3YB 1JY2N 4JPZB 2MJZA 4GOEA 3L71G 2HPCA 2XZRA 3H1JG 3KXDA 3L70D 2K88A 5APXA 2HYNA 3H1LG 1N8RQ 3AE1C 2KLVA 1SQQJ 1K9MQ 2NZ2A 3H1JJ 2OARA 4IL6H 3ITKA 2H88C 1NAYA 3CX5H 1UIXA 2BEZF 2Q3IA 1VQKP 5KLIB 1NU1G 1ZRTD 2QEXP 3D6ZA 1G1JA 1URQD 4AYCA 1BSNA 1EZVG 1GW4A 1NU1J 2P67A 3Q2YA 5APWA 3B8EB 1FC2C 1JTHB 3VN0A 1PGQA 3HUSA 5KLVD 1IO4A 1L4AA 1PZQA 5GTHH 2WITA 3WUTA 2W90A 3CI9A 1UIIA 2A06D 3VTPC 1M1KQ 1JY2P 1Z56A 3ABVC 2OTJP 1NTMD 1GU4A 3L75E 4KHXA 1Y8AA 1M8OB 1YHQP 3V4QA 5CJ4A 2XKMA 1VQMP 1WT6A 5CCHA 3PTZA 2NRGA 1QGKB 1H8AA 5CMZA 1N73C 2WVRA 3FGAD 1PPJE 1YITP 3L71D 3BCCG 1Q86Q 3H1LD 3L35A 1NOHA 2N1TC 2NPSC 3BCCJ 2JO1A 1LTJA 1NTZD 3PLNA 1LTTC 4JF7A 1NU1D 3F5HA 1M57D 1S72P 4GOFA 4PD4I 1FZCC 2R3SA 2V7QJ 4Y99C 1VF5B 3L73D 1M1JC 1EZVD 4HKZH 4JYCA 4Y28J 2OYOA 5KJ7C 2V7QH 3CCJP 3VMAA 3IR9A 2WSSH 1SS1A 2OTKE 2Q7CA 1P84I 1RQVA 2QJKB 3L4FA 2YKQA 2YMKA 1NGMB 1CI6B 1SQBG 1MZ9A 4U3FG 2YKPA 1RF0A 2YMYA 3CC2P 3QWOC 1Q7YQ 1SQPD 2FYUK 5BVZA 2R3CA 4U3FJ 2E75B 2GUVA 2C0WA 2AXTH 4N6JA 2D2CB 5AW0B 2AEFA 3F89A 2M5AB 1H0TB 2C9NY 1TU3F 4I2LC 3AE2C 1XTGB 1KTMA 4PV1B 2Z5IA 2KS1A 3CL3D 1S5LH 4D6TE 3P8CD 5APYA 1KILB 1NKZB 3H1HE 3KPEA 2E75D 3A0HH 4RO0A 1YJWP 2D2CD 2Q1KA 1HGZA 1KQSO 1N73A 1J1DC 3I5CA 4H13D 1J2JB 3CD6P 1VQPP 1SFCB 3Q5PA 1HWTC 1M90Q 3H1HG 2O01N 4PV1D 2N1TA 1NHLA 2KB7P 2NPSA 2BEQD 4XA4A 1YTZT 3H1HJ 1SQBD 2I8DA 1GL2B 1KILD 1KV4A 4I1LA 4HYTB 3NMDA 5AW7B 2OYIB 1QL1A 3NTNA 1MUUA 3CXHE 1BE3G 1NTKE 1PP9D 4H0LC 4W7ZA 3Q3DA 1SFCD 2WWWA 2ZT9B 1BE3J 3O6QB 1OVRA 1Q90D 4DJGA 1L0LG 4WVZA 2K1AA 1BCCE 5CCGD 3M9QA 1LTSC 1FS0E 1RE4C 4YTPC 2KSJA 5GTIH 1L0LJ 3V2PA 4IFFA 2K9JB 2Z5HA 2QJYC 1GL2D 3H32A 4UB8E 3E1RA 5AW3B 1SQQK 3M9HA 2OYHB 4PD4H 3KDPB 4IFMA 4N78E 2GA1A 3JCUE 1KZUB 4RESB 2ZT9D 5DJTB 1Q82Q 1URQC 1P84H 3H25A 4NPFX 2WSEJ 3E1IA 2WSCJ 2WSEH 2WSCH 1T3JA 5AVWB 5TJHA 2G8YA 3RK2D 2KZIA 1EZVI 1OMIA 5AVXB 2H7HA 3OA7A 2E5TA 4L74A 2JR8A 1W2BO 3JC22 3I55P 3CWBE 1AVYA 1K73Q 3JCUH 1L0NG 3L70E 5KLIC 1VQ5P 2IYOA 3U1CA 3T97A 2QM7A 1BSHA 1YTZI 2M3EA 1RQUA 1L0NJ 2L91A 3L36A 1IFMA 4ASWA 3WU2E 4AUWA 3BRTB 5DJUB 1RH5B 1FJKA 2ZJSE 1PL5A 1KB9D 4ZNCA 1GDTA 4BRYA 3P8MC 3VP9A 3E7KA 2Y0CA 2I1JA 4HB1A 2CK3H 2IX7C 5AW1B 1VQ6P 2OTLP 2WT7A 4PJ0E 1KC8Q 1FOSE 3L74D 1ZR2A 2FYNB 2BCCE 2BASA 3HD7B 1OX3A 1LP1B 1SQXE 2CPSA 4ASVA 1OIPA 1KORA 3B5ND 4C46A 4L73A 1VPCA 5KLVG 3PH0A 1S4XA 5AW2B 2YIUB 1G2CB 2HFED 2PGDA 1RE4A 2C0XA 3D70A 2CPBA 2A06G 1RE3C 4KJMA 5KLVJ 3G6EP 1LTBC 1NTMG 3AEDC 1KYOD 1HGVA 3TNUA 3FX0A 3CMAP 3OAKA 4IL6E 3L71E 1DEBA 1YJ9P 1NTMJ 3H1JE 2B87A 3H1LE 3M9BA 1EDJA 1J1EB 1FZEA 2QJPB 1URQA 3V2NA 2B89A 1VF5C 1JUNA 1LT9B 2RH0A 3IAOA 1VQNP 1AJYA 2AEMA 2IBZD 5BU8B 2JDIH 1AVOA 1NU1E 2J58A 1GZLA 2WPRA 5APTA 5GTHE 3MGNA 2QJKC 3H1ID 1EZVE 1KQLA 3GF3A 3L71J 2B88A 3GHGB 2ITAA 5KAIE 3CLQA 4IOIH 1DH3A 3H1LJ 1HUCA 3MP7B 2QA4P 4B86A 1CZQA 1KFMA 4N3YB 2HPCB 1NTZG 3RK3E 1WRGA 2E75C 3FWNA 3L73G 1NTZJ 1JY3O 2D2CC 1JTHA 1Y9BA 3W68A 2ZXEB 1XTCC 1AQTA 3L73J 4H13C 4WY4B 1N7SA 2V4HA 2IPPA 3AE7C 1FDIA 5KAFH 1EDKA 1NO4A 2E76B 3BATA 3P7KA 1X8YA 5KAIH 4PV1C 1HH0A 2OQQA 3C8VA 3M06A 2WZ7A 2FFDA 1MFZA 1SQPG 1KILC 1LWUA 1EC5A 3TF5A 3CCUP 3BCCE 2RMZA 2E42A 1SQVG 2Q3EA 1E5WA 3TGUD 1PGOA 3B71A 1SQPJ 2PAJA 2AEJA 3KZIH 2KSEA 2XV5A 4WY4D 3P8CE 3AEEC 4BWNA 2JWAA 2JP3A 1QVFO 1GU5A 2ZVNB 1SFCC 3AECC 2E76D 1RE3A 4LC1A 1AA0A 2O1KA 1NKNA 4QMAA 4ZMDA 5CCGC 1ZP0C 4HH2A 2QE7H 3PJSK 3RL0B 2KP8A 2Y9ZA 1OW6A 2DW3A 1GL2C 1K04A 1M56D 2IYPA 1KB9I 1NTKK 2OYIC 3MHVA 1LT1A 1U57A 1KQGB 1SQBE 3VP8A 2AXTE 4U3FE 1OVUA 1DEEG 2E74B 3CPWO 2IZ0A 1ZXGA 1JMMA 2ZT9C 5AVTB 1G1IA 1W5CE 1R8EA 3S9OA 5CJ0A 1A02F 1WMKA 3N4XA 3SWFA 1HVVA 3AE4C 3RK2C 2KYVA 3VMXA 3A2AA 1S5LE 1SQBJ 1SQVD 3U1AA 1VF5D 4YPCA 3A0HE 1U7MA 1PP9G 2E74D 3OJAB 2Y0DA 1KMIZ 1KYOI 1PP9J 1IC2A 2IDBA 2O3JA 4OVNF 1YQ3C 4H44B 1VQ7P 2PP6A 4KT0J 4AQRD 2R5DA 2YO2A 1VQLP 2Q5UA 1IZNB 4I6MC 1FZGA 1KILA 2IBZI 3EQ2A 1IFJA 4EDFA 1LGHB 2KS1B 2I1KA 1YBKA 2YKOA 5AVVB 4LLHA 2KOGA 1SFCA 1PPJD 1S5LX 1GK6A 1X22A 1LTGC 1JY3N 2JWDA 2E5YA 3B5NC 2H8PD 1X0TA 3U59A 1BE3E 1N73B 3FXDA 3HE4A 1ZN5A 3H6PA 3SWKA 3V5BA 1GL2A 5GTIE 3L37A 2KUBA 2ZVOB 5KTBA 2XU6A 1L0LE 1HJ0A 2OYIA 1M7LA 2XNDH 2WPSA 1FZCA 4PD4E 3V2RA 2W6AA 1M1JA 1SQXK 1USEA 5KJ7A 3HD7C 3SFDC 5APUA 3O6QA 1E79H 3EWKA 1MKMA 1P84E 2LXBA 2VRSA 3CCVP 1RY3A 3G9RA 5AVQB 2M3BA 1X9VA 2YIUC 1H88A
chains in the Genus database with same CATH topology
3HUSA 3NXSA 1IO4A 1L4AA 1FOSE 2J59M 2WITA 1ZR2A 1JY3P 4WBAA 2BASA 3CI9A 1L0NK 3HD7B 4GT1A 3VTPC 2P2UA 1JY2P 1YYCA 2CPSA 1Z56A 1QL2A 2GUSA 1IJDB 3B5ND 1EQ7A 1GU4A 4KHXA 4C46A 1VPCA 3VYIA 5AW2B 1G2CB 2HFED 3C9IA 1RE4A 2C0XA 3VMYA 3V4QA 1J1EC 2CPBA 5CJ4A 1A02J 1RE3C 2XKMA 3G3ZA 1S9KE 1LTBC 2P1JA 1LT9C 1NU1K 1WT6A 5CCHA 3N7NA 4DZOA 1H8AA 5CMZA 1HGVA 1FZFA 1N73C 3TNUA 4C7NA 1AQ5A 3TSIA 3OAKA 3UIAA 1DEBA 2M8RA 3M9BA 1JCCA 5AW6B 1J1EB 1FZEA 3P32A 1URQA 3GHGC 3V2NA 2FXMA 3L35A 1JUNA 2POHA 1LT9B 1NOHA 1JO5A 2N1TC 3WMM0 3HTKA 1GD2E 2NPSC 2GM4A 5CCGA 5BU8B 5AVYB 1W2EA 2E43A 1LTJA 3BRVB 3V2QA 1T2KC 2J58A 1GZLA 2QM8A 2WPRA 3A7OA 3KQGA 3TK1A 1T8ZA 2XNXA 5APTA 4EOTA 5KLVK 5AVRB 4JF7A 1LTTC 3HE5A 3MGNA 3M91A 2WSFH 1KQLA 3GHGB 1FZCC 5AW9B 4Y99C 1M1JC 3CLQA 3B5NA 3NFQA 4JYCA 2Z4EA 1DH3A 1HUCA 2N1TB 5KJ7C 4WY4C 2NPSB 2C9LY 4B86A 1NTMK 1CZQA 3HE4B 1KFMA 4N3YB 5APSA 2HPCB 1DX7A 3IR9A 3LIEA 1WRGA 2Q7CA 1NWQA 2XDJA 1JY3O 2WTYA 3L4FA 1JTHA 2HODB 1FZCB 2YKQA 4Y99B 1M1JB 1CI6B 2ZXEB 1JY2O 1XTCC 5CHXA 1MZ9A 3MIWA 2YKPA 4WY4B 1RF0A 2YMYA 3M0AA 4OH8B 1N7SA 1FOSF 2WPQA 1RF1C 4W7YA 4M3LA 5APVA 2IPPA 2FYUK 1FU1A 5BVZA 2FYZA 1NO4A 3BATA 2R3CA 1CSBA 3P7KA 1X8YA 2GUVA 2OYHA 1HH0A 2C0WA 4N6JA 2A45G 2WT7B 2N1TD 3LW5H 3M06A 5AW0B 2NPSD 2WZ7A 3MUDA 1KFNA 1IFIA 1G2CA 2FFDA 2C9NY 1MFZA 1T2KD 2HLOA 1KILC 3RK2B 1LWUA 5AW4B 3H32B 2JEEA 2E42A 2O01H 1RF1B 2ZFCA 4IFDK 3M0DC 1E5WA 4I2LC 1IK9A 2N9BA 1NTZK 2A45H 1XTGB 2Z5IA 3RL0C 3O8ZA 4GIFA 2L5GB 2PAJA 1PFIA 2XV5A 5KJ7D 4WY4D 4N78D 3P8CE 1FDMA 3CL3D 1GU5A 1SFCC 3BASA 3IFMA 3HD7D 3P8CD 1SQBK 5APYA 1KILB 1NKZB 1RE3A 4LC1A 1X79B 1JOCA 1HBWA 3KPEA 1LT9A 2O1KA 1NKNA 5CCGC 3R2PA 3TNUB 4HH2A 4C7NB 3RL0B 1IFDA 2KP8A 1HGZA 2P7JA 1N73A 1GW3A 1J1DC 3I5CA 1OXZA 2R32A 3VMZA 1ZR4A 1GL2C 1J2JB 1OWAA 1SFCB 1NTKK 1SQPK 2IFNA 2OYIC 3GHGA 3PP5A 1T3UA 1HWTC 1SQVK 3HTKB 2HG5D 2N1TA 1NHLA 3VP8A 2KB7P 2NPSA 1SP4A 4XA4A 1YTZT 1JMMA 1J1DB 5AW5B 5AVTB 1HTLC 3HE5B 1GL2B 1G1IA 1KILD 4I1LA 4HYTB 1NH4A 1LTIC 1FZBA 3NMDA 5AW7B 3B5NB 1MV8A 2HODA 3SWYA 1SVFA 2OYIB 5CJ0A 1A02F 1QL1A 4LGDE 3NTNA 1MUUA 4C7RA 3N4XA 3HUSC 1RF0C 1N7SC 1L4AC 4WY4A 1NAFA 3SWFA 1HVVA 3HRNA 4W7ZA 2H43A 5APQA 3RK2C 1LTAC 1FJPA 1FZAA 1SFCD 2KYVA 2WWWA 2R5BA 3HD7A 3VMXA 3LIDA 3A2AA 2JJLA 1VDFA 1CW5A 3U1AA 3TYYA 5CCGD 3M9QA 1LTSC 2FFDC 1RE4C 3OJAB 3HUSB 2KSJA 1N7SB 1LWUC 1L4AB 3V2PA 1ZLLA 4ZKPA 4IFFA 2Z5HA 4W80A 2O1JA 1GL2D 3H32A 1RF1A 5AW3B 1FAVA 2YO3A 1IC2A 1SQQK 1ZV8A 3M9HA 1N2DC 5AVZB 5CCHC 2OYHB 1AFOA 2LKMA 3KDPB 1H89A 1N7LA 4IFMA 4N78E 4WB4A 3BVHA 2FFDB 1KZUB 2PP6A 4RESB 4AQRD 2R5DA 2YO2A 1LWUB 2Q5UA 4I6MC 3RK3C 1FZGA 1URQC 1KILA 4ZKUA 3VOPA 3EQ2A 3M0DA 1IFJA 1S9KD 3E1IA 3II6A 2FKWB 3MTUE 1IFNA 2WSEH 4JYBA 1LGHB 5BU5A 2WSCH 1LTJC 1T3JA 2I1KA 1L0LK 1N7SD 5AVWB 2YNYA 1L4AD 2YKOA 5AVVB 3RK2D 4LLHA 5AW8B 2KOGA 1SFCA 5AVXB 4DOJA 3RK3B 1JNMA 2H7HA 1GK6A 3KYQA 1URQB 3OA7A 1LTGC 5AVUB 1JY3N 3B5NC 2Q9IA 2H8PD 3U59A 4XE5B 2W27A 4GKGA 3A3YB 1JY2N 1N73B 3A5TA 3U1CA 2MJZA 3T97A 1LTJB 3HE4A 1ZN5A 3H6PA 2QM7A 2HPCA 3V5BA 1YTZI 2XZRA 3EFGA 1SLQA 5APXA 1GL2A 3L37A 2HYNA 3L36A 1IFMA 5KTBA 2A45I 2KLVA 2IFMA 2XU6A 4AUWA 5CCHD 2W6BA 2OARA 3BRTB 2OYIA 1M7LA 2WPSA 1FZCA 1FJKA 3V2RA 2W6AA 1M1JA 3V4WA 1SQXK 1CI6A 3RL0D 5AVSB 1GK4A 2Q3IA 1GDTA 5KJ7A 1FBMA 3HD7C 5APUA 3P8MC 1HJBA 1JCDA 3RK3D 1G1JA 3VP9A 4O9BA 1URQD 4AYCA 2I1JA 4EIJA 2OYHC 1GW4A 3MD0A 2P67A 2VRSA 3B8EB 5APWA 2IX7C 1GTWA 1JTHB 1N86A 1RY3A 3VN0A 5AW1B 5AVQB 2M3BA 1X9VA 2WT7A 1H88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFI A;  2MJZ A;  1IFJ A;  1FDM A;  1NH4 A;  2CPS A;  2C0X A;  1HGV A;  1HH0 A;  1IFD A;  2C0W A;  1HGZ A;  2CPB A; 
#chains in the Genus database with same CATH topology
 4L75 A;  1JY3 P;  2K37 A;  2P2U A;  1KB9 H;  2P10 A;  1YYC A;  3CCE P;  4R4L A;  1EQ7 A;  3GW6 A;  3S4R A;  3L74 G;  1ZME C;  3C9I A;  1PIX A;  1J1E C;  5B66 H;  1A02 J;  1S9K E;  2QJP C;  1FDO A;  3L74 J;  2P1J A;  1LT9 C;  1NU1 K;  3AE3 C;  3N7N A;  1L0N E;  1PGJ A;  1FZF A;  4C7N A;  1K05 A;  3CCS P;  1USD A;  1JB0 J;  5AW6 B;  3GHG C;  3CCL P;  2FXM A;  4EYY Q;  5B5E H;  3WMM 0;  3HTK A;  2GM4 A;  3FWL A;  1W2E A;  2FYU G;  2E43 A;  3FXE A;  3A7O A;  2WSF J;  2Y0E A;  1T8Z A;  2FY8 A;  2XNX A;  2MKV A;  3HE5 A;  2PRR A;  1KYO H;  3AEB C;  1Q81 Q;  2WSF H;  1EDI A;  1EXJ A;  5AW9 B;  2IBZ G;  3B5N A;  3NFQ A;  3WUV A;  4WY4 C;  1ZRT E;  2C9L Y;  3T97 B;  2Y9Y A;  4NPD A;  2WPV B;  3LIE A;  4RKU J;  3C1L A;  3H1I G;  2E76 C;  1JM0 A;  1GMJ A;  1NWQ A;  3L72 G;  2K3R A;  4EI2 A;  5H2F E;  2WTY A;  2WMM A;  2HOD B;  3CC7 P;  3H1I J;  5KLV E;  4I7Z B;  2QG4 A;  3L72 J;  5CHX A;  3RGU A;  4K3A A;  3CXH D;  2A06 E;  2WPQ A;  4W7Y A;  3Q1M A;  1LP1 A;  2FYZ A;  3S1K A;  1CSB A;  3V6I A;  1NTM E;  4JBZ A;  3LW5 J;  3H1K G;  1NVO A;  3A0B E;  2WT7 B;  3LW5 H;  3G4S P;  1BCC D;  1IFI A;  1KFN A;  1G2C A;  1OFC X;  1OVV A;  1T2K D;  1QVG O;  2HLO A;  2JEE A;  1RF1 B;  3M0D C;  3AEF C;  1IK9 A;  2N9B A;  5H2F H;  3OW2 O;  1KD1 Q;  3RL0 C;  4GIF A;  4TT3 H;  2L5G B;  1PFI A;  4N78 D;  3CME P;  2FYU D;  1YI2 P;  1DD3 A;  3HD7 D;  2KNC A;  1SQB K;  3AEG C;  2G3A A;  3TGU G;  1X79 B;  3RL0 g;  1JOC A;  1IK7 A;  1LT9 A;  3AE6 C;  3A0B H;  4NPE A;  2J5U A;  3B4S A;  3TNU B;  3TGU J;  2E74 C;  5KKZ B;  1IFD A;  1GW3 A;  1NTZ E;  1OXZ A;  3VMZ A;  2B87 B;  1T6A A;  5E79 H;  2W83 C;  3L73 E;  2SPZ A;  2IFN A;  5KAF E;  3GHG A;  3PP5 A;  1T3U A;  3L72 D;  4U7J A;  5C39 A;  1NJI Q;  3CWB D;  2QVA A;  1SQQ G;  2QRX A;  5AW5 B;  1HTL C;  1VQ9 P;  2UWJ E;  1NH4 A;  3TDK A;  1FZB A;  3Q5S A;  1U7J A;  1SVF A;  4UB6 H;  3CCM P;  3QH9 A;  3H1K D;  1RF0 C;  4IL6 X;  1S1C X;  4WY4 A;  1NAF A;  1SQP E;  3KZI E;  1BGY D;  2H43 A;  5APQ A;  1FJP A;  1FZA A;  1SQV E;  3Q5R A;  3LID A;  1VDF A;  4L76 A;  1CW5 A;  2KI7 B;  2W8Z A;  2FXO A;  2B9B A;  4H44 C;  2RKL A;  3TYY A;  1KQF B;  3HUS B;  3GF7 A;  1N7S B;  1L4A B;  1ZLL A;  2YXR B;  4YXW H;  2YO3 A;  1DD4 A;  2WQY C;  2BCC D;  1N2D C;  1S3J A;  1SQX D;  4DT0 A;  2OGU A;  4WB4 A;  3AE5 C;  1SQV J;  3BVH A;  1LNQ A;  1RHZ B;  2FFD B;  1PV3 A;  1YQ4 C;  1LWU B;  2ZYA A;  1IFP A;  2HR3 A;  2RN0 A;  2ZXX A;  4OGQ B;  3VOP A;  2P58 A;  3M0D A;  4A7P A;  3II6 A;  2FKW B;  3MTU E;  2KLU A;  4MN4 C;  3L75 G;  1NYH A;  1L0L K;  1N7S D;  1L4A D;  1R5L A;  1MFT A;  1SQQ D;  3CX5 D;  5AW8 B;  3H1J D;  5M1B A;  1VL2 A;  3L75 J;  2FBW C;  4DOJ A;  3RK3 B;  3KYQ A;  3WUU A;  2W27 A;  3A5T A;  4CPG A;  1LTJ B;  1JMB A;  1KIL E;  3EFG A;  1SLQ A;  1PPJ G;  4OGQ D;  2A45 I;  1HF9 A;  2IFM A;  4GOD A;  5CCH D;  2W6B A;  1YJN P;  3GLM A;  4R4M A;  3CXH I;  3SFE C;  3W67 A;  1PP9 E;  2FXP A;  2KXP B;  3V4W A;  5L8R J;  1CI6 A;  3RL0 D;  5AVS B;  1GK4 A;  1FBM A;  3AE9 C;  1FE6 A;  3D6Y A;  3MZW B;  1VQO P;  1HJB A;  1JCD A;  3RK3 D;  4O9B A;  4EIJ A;  2OYH C;  3MD0 A;  1GTW A;  1N86 A;  3MUD C;  2M5A A;  3NXS A;  1ZW0 A;  1H0T A;  1L2P A;  2J59 M;  4WBA A;  5CBN A;  1L0N K;  4GT1 A;  1QL2 A;  2GUS A;  1IJD B;  3VYI A;  3ZDM A;  4H13 B;  3L75 D;  3VMY A;  1EDL A;  4YXD C;  3G3Z A;  3AE8 C;  3RBX A;  1R5S A;  3BCC D;  4DZO A;  2H89 C;  4TLF A;  4HJG H;  1AQ5 A;  3TSI A;  3UIA A;  3R4Y A;  2M8R A;  1JCC A;  3P32 A;  2POH A;  2KK7 A;  4BXL A;  1JO5 A;  1GD2 E;  1BDC A;  2ZYG A;  4H44 D;  5CCG A;  5AVY B;  1D7M A;  3BRV B;  3GMA A;  3V2Q A;  1LJ2 A;  1T2K C;  2QM8 A;  3KQG A;  3TK1 A;  2KZJ A;  4EOT A;  5KLV K;  1OW7 A;  5AVR B;  3M91 A;  4D6T G;  3RBZ A;  1BDD A;  2IZ1 A;  1KB9 E;  4I7Z C;  2Z4E A;  4OWF A;  4D6T J;  2N1T B;  4Z1M H;  2QIW A;  2NPS B;  1NTM K;  3HE4 B;  5APS A;  2FYN C;  3G71 P;  1DX7 A;  4U3F D;  1ZOY C;  2K9Y A;  2XDJ A;  5B66 E;  1Q2N A;  1JEK A;  2YXQ B;  1FZC B;  1VQ8 P;  4Y99 B;  1M1J B;  3D71 A;  3L74 E;  3PHL A;  1JY2 O;  3K5B A;  3MIW A;  2W6J H;  4OH8 B;  3M0A A;  1FOS F;  1VQ4 P;  1RF1 C;  4M3L A;  2K9J A;  5APV A;  1FU1 A;  5K5G B;  2OYH A;  5B5E E;  2A45 G;  2N1T D;  2NPS D;  3MUD A;  4K35 A;  2O01 J;  1NTK G;  3RK2 B;  5AW4 B;  3H32 B;  2JKV A;  2O01 H;  2ZFC A;  4IFD K;  1OW8 A;  1NTZ K;  2A45 H;  1KYO E;  1NTK J;  3I56 P;  4JQ0 D;  3CXH H;  5KKZ C;  1OZH A;  3CX5 I;  3O8Z A;  2FYU E;  1BCC G;  5KJ7 D;  2LR2 A;  1FDM A;  2KIK A;  3BAS A;  3IFM A;  1BCC J;  2PFX A;  3IN6 A;  1HBW A;  4D6T D;  2IBZ E;  3R2P A;  3H1H D;  3CCR P;  3IF4 A;  4C7N B;  3KHU A;  4DCK A;  2P7J A;  2Q6Q A;  2R32 A;  4UB8 H;  1ZR4 A;  3H1I E;  2M0B A;  1OWA A;  3L72 E;  2N9Y B;  2FYU J;  5TIS E;  1SQP K;  3GG2 A;  1SQV K;  3HTK B;  1DIP A;  1KN7 A;  2HG5 D;  4GDO A;  5CBO A;  1SP4 A;  1BE3 D;  1QEX A;  1J1D B;  1EXI A;  3HE5 B;  3CC4 P;  1Y47 A;  1LTI C;  3H1K E;  3B5N B;  1MV8 A;  2HOD A;  3SWY A;  1L0L D;  3CWB G;  4LGD E;  1BGY E;  4C7R A;  3HUS C;  1N7S C;  1L4A C;  3L70 G;  1S2E A;  4BRY B;  4PD4 D;  3HRN A;  2ZAE B;  3AEA C;  1LTA C;  3CWB J;  1NTK D;  2R5B A;  3HD7 A;  5TIS H;  3CCQ P;  2JJL A;  4WWI A;  3L70 J;  2LXC B;  2AXC A;  2R44 A;  1P84 D;  1YIJ P;  2FFD C;  3SSU A;  3PRJ A;  1BGY G;  4XFJ A;  1LWU C;  3EFF K;  4ZKP A;  3H1K J;  4H0L B;  4W80 A;  2O1J A;  1RF1 A;  4OGQ C;  3TGU E;  1FAV A;  3WU2 H;  1BGY J;  1ZV8 A;  4RJT A;  5E79 E;  5CCH C;  5AVZ B;  1AFO A;  1QLE D;  2LKM A;  1H89 A;  3JSV C;  1N7L A;  2QSI A;  1AV1 A;  3RK3 C;  2BCC G;  2QJY B;  4ZKU A;  1S9K D;  1SQX G;  1IFN A;  4JYB A;  2ZYD A;  2BCC J;  5BU5 A;  4PJ0 H;  1LTJ C;  4UB6 E;  1SQQ E;  3CX5 E;  1SQX J;  1L0N D;  3USS A;  2YNY A;  4H0L D;  2KNC B;  1QX8 A;  1JNM A;  5EFW B;  1PGP A;  1URQ B;  5AVU B;  1K8A Q;  2Q9I A;  4XE5 B;  4GKG A;  3A3Y B;  1JY2 N;  4JPZ B;  2MJZ A;  4GOE A;  3L71 G;  2HPC A;  2XZR A;  3H1J G;  3KXD A;  3L70 D;  2K88 A;  5APX A;  2HYN A;  3H1L G;  1N8R Q;  3AE1 C;  2KLV A;  1SQQ J;  1K9M Q;  2NZ2 A;  3H1J J;  2OAR A;  4IL6 H;  3ITK A;  2H88 C;  1NAY A;  3CX5 H;  1UIX A;  2BEZ F;  2Q3I A;  1VQK P;  5KLI B;  1NU1 G;  1ZRT D;  2QEX P;  3D6Z A;  1G1J A;  1URQ D;  4AYC A;  1BSN A;  1EZV G;  1GW4 A;  1NU1 J;  2P67 A;  3Q2Y A;  5APW A;  3B8E B;  1FC2 C;  1JTH B;  3VN0 A;  1PGQ A;  3HUS A;  5KLV D;  1IO4 A;  1L4A A;  1PZQ A;  5GTH H;  2WIT A;  3WUT A;  2W90 A;  3CI9 A;  1UII A;  2A06 D;  3VTP C;  1M1K Q;  1JY2 P;  1Z56 A;  3ABV C;  2OTJ P;  1NTM D;  1GU4 A;  3L75 E;  4KHX A;  1Y8A A;  1M8O B;  1YHQ P;  3V4Q A;  5CJ4 A;  2XKM A;  1VQM P;  1WT6 A;  5CCH A;  3PTZ A;  2NRG A;  1QGK B;  1H8A A;  5CMZ A;  1N73 C;  2WVR A;  3FGA D;  1PPJ E;  1YIT P;  3L71 D;  3BCC G;  1Q86 Q;  3H1L D;  3L35 A;  1NOH A;  2N1T C;  2NPS C;  3BCC J;  2JO1 A;  1LTJ A;  1NTZ D;  3PLN A;  1LTT C;  4JF7 A;  1NU1 D;  3F5H A;  1M57 D;  1S72 P;  4GOF A;  4PD4 I;  1FZC C;  2R3S A;  2V7Q J;  4Y99 C;  1VF5 B;  3L73 D;  1M1J C;  1EZV D;  4HKZ H;  4JYC A;  4Y28 J;  2OYO A;  5KJ7 C;  2V7Q H;  3CCJ P;  3VMA A;  3IR9 A;  2WSS H;  1SS1 A;  2OTK E;  2Q7C A;  1P84 I;  1RQV A;  2QJK B;  3L4F A;  2YKQ A;  2YMK A;  1NGM B;  1CI6 B;  1SQB G;  1MZ9 A;  4U3F G;  2YKP A;  1RF0 A;  2YMY A;  3CC2 P;  3QWO C;  1Q7Y Q;  1SQP D;  2FYU K;  5BVZ A;  2R3C A;  4U3F J;  2E75 B;  2GUV A;  2C0W A;  2AXT H;  4N6J A;  2D2C B;  5AW0 B;  2AEF A;  3F89 A;  2M5A B;  1H0T B;  2C9N Y;  1TU3 F;  4I2L C;  3AE2 C;  1XTG B;  1KTM A;  4PV1 B;  2Z5I A;  2KS1 A;  3CL3 D;  1S5L H;  4D6T E;  3P8C D;  5APY A;  1KIL B;  1NKZ B;  3H1H E;  3KPE A;  2E75 D;  3A0H H;  4RO0 A;  1YJW P;  2D2C D;  2Q1K A;  1HGZ A;  1KQS O;  1N73 A;  1J1D C;  3I5C A;  4H13 D;  1J2J B;  3CD6 P;  1VQP P;  1SFC B;  3Q5P A;  1HWT C;  1M90 Q;  3H1H G;  2O01 N;  4PV1 D;  2N1T A;  1NHL A;  2KB7 P;  2NPS A;  2BEQ D;  4XA4 A;  1YTZ T;  3H1H J;  1SQB D;  2I8D A;  1GL2 B;  1KIL D;  1KV4 A;  4I1L A;  4HYT B;  3NMD A;  5AW7 B;  2OYI B;  1QL1 A;  3NTN A;  1MUU A;  3CXH E;  1BE3 G;  1NTK E;  1PP9 D;  4H0L C;  4W7Z A;  3Q3D A;  1SFC D;  2WWW A;  2ZT9 B;  1BE3 J;  3O6Q B;  1OVR A;  1Q90 D;  4DJG A;  1L0L G;  4WVZ A;  2K1A A;  1BCC E;  5CCG D;  3M9Q A;  1LTS C;  1FS0 E;  1RE4 C;  4YTP C;  2KSJ A;  5GTI H;  1L0L J;  3V2P A;  4IFF A;  2K9J B;  2Z5H A;  2QJY C;  1GL2 D;  3H32 A;  4UB8 E;  3E1R A;  5AW3 B;  1SQQ K;  3M9H A;  2OYH B;  4PD4 H;  3KDP B;  4IFM A;  4N78 E;  2GA1 A;  3JCU E;  1KZU B;  4RES B;  2ZT9 D;  5DJT B;  1Q82 Q;  1URQ C;  1P84 H;  3H25 A;  4NPF X;  2WSE J;  3E1I A;  2WSC J;  2WSE H;  2WSC H;  1T3J A;  5AVW B;  5TJH A;  2G8Y A;  3RK2 D;  2KZI A;  1EZV I;  1OMI A;  5AVX B;  2H7H A;  3OA7 A;  2E5T A;  4L74 A;  2JR8 A;  1W2B O;  3JC2 2;  3I55 P;  3CWB E;  1AVY A;  1K73 Q;  3JCU H;  1L0N G;  3L70 E;  5KLI C;  1VQ5 P;  2IYO A;  3U1C A;  3T97 A;  2QM7 A;  1BSH A;  1YTZ I;  2M3E A;  1RQU A;  1L0N J;  2L91 A;  3L36 A;  1IFM A;  4ASW A;  3WU2 E;  4AUW A;  3BRT B;  5DJU B;  1RH5 B;  1FJK A;  2ZJS E;  1PL5 A;  1KB9 D;  4ZNC A;  1GDT A;  4BRY A;  3P8M C;  3VP9 A;  3E7K A;  2Y0C A;  2I1J A;  4HB1 A;  2CK3 H;  2IX7 C;  5AW1 B;  1VQ6 P;  2OTL P;  2WT7 A;  4PJ0 E;  1KC8 Q;  1FOS E;  3L74 D;  1ZR2 A;  2FYN B;  2BCC E;  2BAS A;  3HD7 B;  1OX3 A;  1LP1 B;  1SQX E;  2CPS A;  4ASV A;  1OIP A;  1KOR A;  3B5N D;  4C46 A;  4L73 A;  1VPC A;  5KLV G;  3PH0 A;  1S4X A;  5AW2 B;  2YIU B;  1G2C B;  2HFE D;  2PGD A;  1RE4 A;  2C0X A;  3D70 A;  2CPB A;  2A06 G;  1RE3 C;  4KJM A;  5KLV J;  3G6E P;  1LTB C;  1NTM G;  3AED C;  1KYO D;  1HGV A;  3TNU A;  3FX0 A;  3CMA P;  3OAK A;  4IL6 E;  3L71 E;  1DEB A;  1YJ9 P;  1NTM J;  3H1J E;  2B87 A;  3H1L E;  3M9B A;  1EDJ A;  1J1E B;  1FZE A;  2QJP B;  1URQ A;  3V2N A;  2B89 A;  1VF5 C;  1JUN A;  1LT9 B;  2RH0 A;  3IAO A;  1VQN P;  1AJY A;  2AEM A;  2IBZ D;  5BU8 B;  2JDI H;  1AVO A;  1NU1 E;  2J58 A;  1GZL A;  2WPR A;  5APT A;  5GTH E;  3MGN A;  2QJK C;  3H1I D;  1EZV E;  1KQL A;  3GF3 A;  3L71 J;  2B88 A;  3GHG B;  2ITA A;  5KAI E;  3CLQ A;  4IOI H;  1DH3 A;  3H1L J;  1HUC A;  3MP7 B;  2QA4 P;  4B86 A;  1CZQ A;  1KFM A;  4N3Y B;  2HPC B;  1NTZ G;  3RK3 E;  1WRG A;  2E75 C;  3FWN A;  3L73 G;  1NTZ J;  1JY3 O;  2D2C C;  1JTH A;  1Y9B A;  3W68 A;  2ZXE B;  1XTC C;  1AQT A;  3L73 J;  4H13 C;  4WY4 B;  1N7S A;  2V4H A;  2IPP A;  3AE7 C;  1FDI A;  5KAF H;  1EDK A;  1NO4 A;  2E76 B;  3BAT A;  3P7K A;  1X8Y A;  5KAI H;  4PV1 C;  1HH0 A;  2OQQ A;  3C8V A;  3M06 A;  2WZ7 A;  2FFD A;  1MFZ A;  1SQP G;  1KIL C;  1LWU A;  1EC5 A;  3TF5 A;  3CCU P;  3BCC E;  2RMZ A;  2E42 A;  1SQV G;  2Q3E A;  1E5W A;  3TGU D;  1PGO A;  3B71 A;  1SQP J;  2PAJ A;  2AEJ A;  3KZI H;  2KSE A;  2XV5 A;  4WY4 D;  3P8C E;  3AEE C;  4BWN A;  2JWA A;  2JP3 A;  1QVF O;  1GU5 A;  2ZVN B;  1SFC C;  3AEC C;  2E76 D;  1RE3 A;  4LC1 A;  1AA0 A;  2O1K A;  1NKN A;  4QMA A;  4ZMD A;  5CCG C;  1ZP0 C;  4HH2 A;  2QE7 H;  3PJS K;  3RL0 B;  2KP8 A;  2Y9Z A;  1OW6 A;  2DW3 A;  1GL2 C;  1K04 A;  1M56 D;  2IYP A;  1KB9 I;  1NTK K;  2OYI C;  3MHV A;  1LT1 A;  1U57 A;  1KQG B;  1SQB E;  3VP8 A;  2AXT E;  4U3F E;  1OVU A;  1DEE G;  2E74 B;  3CPW O;  2IZ0 A;  1ZXG A;  1JMM A;  2ZT9 C;  5AVT B;  1G1I A;  1W5C E;  1R8E A;  3S9O A;  5CJ0 A;  1A02 F;  1WMK A;  3N4X A;  3SWF A;  1HVV A;  3AE4 C;  3RK2 C;  2KYV A;  3VMX A;  3A2A A;  1S5L E;  1SQB J;  1SQV D;  3U1A A;  1VF5 D;  4YPC A;  3A0H E;  1U7M A;  1PP9 G;  2E74 D;  3OJA B;  2Y0D A;  1KMI Z;  1KYO I;  1PP9 J;  1IC2 A;  2IDB A;  2O3J A;  4OVN F;  1YQ3 C;  4H44 B;  1VQ7 P;  2PP6 A;  4KT0 J;  4AQR D;  2R5D A;  2YO2 A;  1VQL P;  2Q5U A;  1IZN B;  4I6M C;  1FZG A;  1KIL A;  2IBZ I;  3EQ2 A;  1IFJ A;  4EDF A;  1LGH B;  2KS1 B;  2I1K A;  1YBK A;  2YKO A;  5AVV B;  4LLH A;  2KOG A;  1SFC A;  1PPJ D;  1S5L X;  1GK6 A;  1X22 A;  1LTG C;  1JY3 N;  2JWD A;  2E5Y A;  3B5N C;  2H8P D;  1X0T A;  3U59 A;  1BE3 E;  1N73 B;  3FXD A;  3HE4 A;  1ZN5 A;  3H6P A;  3SWK A;  3V5B A;  1GL2 A;  5GTI E;  3L37 A;  2KUB A;  2ZVO B;  5KTB A;  2XU6 A;  1L0L E;  1HJ0 A;  2OYI A;  1M7L A;  2XND H;  2WPS A;  1FZC A;  4PD4 E;  3V2R A;  2W6A A;  1M1J A;  1SQX K;  1USE A;  5KJ7 A;  3HD7 C;  3SFD C;  5APU A;  3O6Q A;  1E79 H;  3EWK A;  1MKM A;  1P84 E;  2LXB A;  2VRS A;  3CCV P;  1RY3 A;  3G9R A;  5AVQ B;  2M3B A;  1X9V A;  2YIU C;  1H88 A; 
#chains in the Genus database with same CATH homology
 3HUS A;  3NXS A;  1IO4 A;  1L4A A;  1FOS E;  2J59 M;  2WIT A;  1ZR2 A;  1JY3 P;  4WBA A;  2BAS A;  3CI9 A;  1L0N K;  3HD7 B;  4GT1 A;  3VTP C;  2P2U A;  1JY2 P;  1YYC A;  2CPS A;  1Z56 A;  1QL2 A;  2GUS A;  1IJD B;  3B5N D;  1EQ7 A;  1GU4 A;  4KHX A;  4C46 A;  1VPC A;  3VYI A;  5AW2 B;  1G2C B;  2HFE D;  3C9I A;  1RE4 A;  2C0X A;  3VMY A;  3V4Q A;  1J1E C;  2CPB A;  5CJ4 A;  1A02 J;  1RE3 C;  2XKM A;  3G3Z A;  1S9K E;  1LTB C;  2P1J A;  1LT9 C;  1NU1 K;  1WT6 A;  5CCH A;  3N7N A;  4DZO A;  1H8A A;  5CMZ A;  1HGV A;  1FZF A;  1N73 C;  3TNU A;  4C7N A;  1AQ5 A;  3TSI A;  3OAK A;  3UIA A;  1DEB A;  2M8R A;  3M9B A;  1JCC A;  5AW6 B;  1J1E B;  1FZE A;  3P32 A;  1URQ A;  3GHG C;  3V2N A;  2FXM A;  3L35 A;  1JUN A;  2POH A;  1LT9 B;  1NOH A;  1JO5 A;  2N1T C;  3WMM 0;  3HTK A;  1GD2 E;  2NPS C;  2GM4 A;  5CCG A;  5BU8 B;  5AVY B;  1W2E A;  2E43 A;  1LTJ A;  3BRV B;  3V2Q A;  1T2K C;  2J58 A;  1GZL A;  2QM8 A;  2WPR A;  3A7O A;  3KQG A;  3TK1 A;  1T8Z A;  2XNX A;  5APT A;  4EOT A;  5KLV K;  5AVR B;  4JF7 A;  1LTT C;  3HE5 A;  3MGN A;  3M91 A;  2WSF H;  1KQL A;  3GHG B;  1FZC C;  5AW9 B;  4Y99 C;  1M1J C;  3CLQ A;  3B5N A;  3NFQ A;  4JYC A;  2Z4E A;  1DH3 A;  1HUC A;  2N1T B;  5KJ7 C;  4WY4 C;  2NPS B;  2C9L Y;  4B86 A;  1NTM K;  1CZQ A;  3HE4 B;  1KFM A;  4N3Y B;  5APS A;  2HPC B;  1DX7 A;  3IR9 A;  3LIE A;  1WRG A;  2Q7C A;  1NWQ A;  2XDJ A;  1JY3 O;  2WTY A;  3L4F A;  1JTH A;  2HOD B;  1FZC B;  2YKQ A;  4Y99 B;  1M1J B;  1CI6 B;  2ZXE B;  1JY2 O;  1XTC C;  5CHX A;  1MZ9 A;  3MIW A;  2YKP A;  4WY4 B;  1RF0 A;  2YMY A;  3M0A A;  4OH8 B;  1N7S A;  1FOS F;  2WPQ A;  1RF1 C;  4W7Y A;  4M3L A;  5APV A;  2IPP A;  2FYU K;  1FU1 A;  5BVZ A;  2FYZ A;  1NO4 A;  3BAT A;  2R3C A;  1CSB A;  3P7K A;  1X8Y A;  2GUV A;  2OYH A;  1HH0 A;  2C0W A;  4N6J A;  2A45 G;  2WT7 B;  2N1T D;  3LW5 H;  3M06 A;  5AW0 B;  2NPS D;  2WZ7 A;  3MUD A;  1KFN A;  1IFI A;  1G2C A;  2FFD A;  2C9N Y;  1MFZ A;  1T2K D;  2HLO A;  1KIL C;  3RK2 B;  1LWU A;  5AW4 B;  3H32 B;  2JEE A;  2E42 A;  2O01 H;  1RF1 B;  2ZFC A;  4IFD K;  3M0D C;  1E5W A;  4I2L C;  1IK9 A;  2N9B A;  1NTZ K;  2A45 H;  1XTG B;  2Z5I A;  3RL0 C;  3O8Z A;  4GIF A;  2L5G B;  2PAJ A;  1PFI A;  2XV5 A;  5KJ7 D;  4WY4 D;  4N78 D;  3P8C E;  1FDM A;  3CL3 D;  1GU5 A;  1SFC C;  3BAS A;  3IFM A;  3HD7 D;  3P8C D;  1SQB K;  5APY A;  1KIL B;  1NKZ B;  1RE3 A;  4LC1 A;  1X79 B;  1JOC A;  1HBW A;  3KPE A;  1LT9 A;  2O1K A;  1NKN A;  5CCG C;  3R2P A;  3TNU B;  4HH2 A;  4C7N B;  3RL0 B;  1IFD A;  2KP8 A;  1HGZ A;  2P7J A;  1N73 A;  1GW3 A;  1J1D C;  3I5C A;  1OXZ A;  2R32 A;  3VMZ A;  1ZR4 A;  1GL2 C;  1J2J B;  1OWA A;  1SFC B;  1NTK K;  1SQP K;  2IFN A;  2OYI C;  3GHG A;  3PP5 A;  1T3U A;  1HWT C;  1SQV K;  3HTK B;  2HG5 D;  2N1T A;  1NHL A;  3VP8 A;  2KB7 P;  2NPS A;  1SP4 A;  4XA4 A;  1YTZ T;  1JMM A;  1J1D B;  5AW5 B;  5AVT B;  1HTL C;  3HE5 B;  1GL2 B;  1G1I A;  1KIL D;  4I1L A;  4HYT B;  1NH4 A;  1LTI C;  1FZB A;  3NMD A;  5AW7 B;  3B5N B;  1MV8 A;  2HOD A;  3SWY A;  1SVF A;  2OYI B;  5CJ0 A;  1A02 F;  1QL1 A;  4LGD E;  3NTN A;  1MUU A;  4C7R A;  3N4X A;  3HUS C;  1RF0 C;  1N7S C;  1L4A C;  4WY4 A;  1NAF A;  3SWF A;  1HVV A;  3HRN A;  4W7Z A;  2H43 A;  5APQ A;  3RK2 C;  1LTA C;  1FJP A;  1FZA A;  1SFC D;  2KYV A;  2WWW A;  2R5B A;  3HD7 A;  3VMX A;  3LID A;  3A2A A;  2JJL A;  1VDF A;  1CW5 A;  3U1A A;  3TYY A;  5CCG D;  3M9Q A;  1LTS C;  2FFD C;  1RE4 C;  3OJA B;  3HUS B;  2KSJ A;  1N7S B;  1LWU C;  1L4A B;  3V2P A;  1ZLL A;  4ZKP A;  4IFF A;  2Z5H A;  4W80 A;  2O1J A;  1GL2 D;  3H32 A;  1RF1 A;  5AW3 B;  1FAV A;  2YO3 A;  1IC2 A;  1SQQ K;  1ZV8 A;  3M9H A;  1N2D C;  5AVZ B;  5CCH C;  2OYH B;  1AFO A;  2LKM A;  3KDP B;  1H89 A;  1N7L A;  4IFM A;  4N78 E;  4WB4 A;  3BVH A;  2FFD B;  1KZU B;  2PP6 A;  4RES B;  4AQR D;  2R5D A;  2YO2 A;  1LWU B;  2Q5U A;  4I6M C;  3RK3 C;  1FZG A;  1URQ C;  1KIL A;  4ZKU A;  3VOP A;  3EQ2 A;  3M0D A;  1IFJ A;  1S9K D;  3E1I A;  3II6 A;  2FKW B;  3MTU E;  1IFN A;  2WSE H;  4JYB A;  1LGH B;  5BU5 A;  2WSC H;  1LTJ C;  1T3J A;  2I1K A;  1L0L K;  1N7S D;  5AVW B;  2YNY A;  1L4A D;  2YKO A;  5AVV B;  3RK2 D;  4LLH A;  5AW8 B;  2KOG A;  1SFC A;  5AVX B;  4DOJ A;  3RK3 B;  1JNM A;  2H7H A;  1GK6 A;  3KYQ A;  1URQ B;  3OA7 A;  1LTG C;  5AVU B;  1JY3 N;  3B5N C;  2Q9I A;  2H8P D;  3U59 A;  4XE5 B;  2W27 A;  4GKG A;  3A3Y B;  1JY2 N;  1N73 B;  3A5T A;  3U1C A;  2MJZ A;  3T97 A;  1LTJ B;  3HE4 A;  1ZN5 A;  3H6P A;  2QM7 A;  2HPC A;  3V5B A;  1YTZ I;  2XZR A;  3EFG A;  1SLQ A;  5APX A;  1GL2 A;  3L37 A;  2HYN A;  3L36 A;  1IFM A;  5KTB A;  2A45 I;  2KLV A;  2IFM A;  2XU6 A;  4AUW A;  5CCH D;  2W6B A;  2OAR A;  3BRT B;  2OYI A;  1M7L A;  2WPS A;  1FZC A;  1FJK A;  3V2R A;  2W6A A;  1M1J A;  3V4W A;  1SQX K;  1CI6 A;  3RL0 D;  5AVS B;  1GK4 A;  2Q3I A;  1GDT A;  5KJ7 A;  1FBM A;  3HD7 C;  5APU A;  3P8M C;  1HJB A;  1JCD A;  3RK3 D;  1G1J A;  3VP9 A;  4O9B A;  1URQ D;  4AYC A;  2I1J A;  4EIJ A;  2OYH C;  1GW4 A;  3MD0 A;  2P67 A;  2VRS A;  3B8E B;  5APW A;  2IX7 C;  1GTW A;  1JTH B;  1N86 A;  1RY3 A;  3VN0 A;  5AW1 B;  5AVQ B;  2M3B A;  1X9V A;  2WT7 A;  1H88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...