1IFJA

Molecular models and structural comparisons of native and mutant class i filamentous bacteriophages ff (fd, f1, m13), if1 and ike
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOVIRUS
publication title Molecular models and structural comparisons of native and mutant class I filamentous bacteriophages Ff (fd, f1, M13), If1 and IKe.
pubmed doi rcsb
source organism Enterobacteria phage fd
molecule tags Virus
total genus 22
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1994-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ifjA00
1HGZA 1NH4A 2C0WA 1HH0A 2CPBA 2MJZA 1IFIA 2CPSA 1IFDA 1HGVA 1IFJA 2C0XA 1FDMA
chains in the Genus database with same CATH superfamily
1S5LE 3FWNA 3Q5PA 1EDKA 3S9OA 2A06E 3N7NA 1T6AA 1JEKA 5APQA 1YITP 1FOSE 4U3FD 1VQ4P 2WTYA 3B5NB 1SVFA 1M90Q 3L74G 3AEEC 3OAKA 3CI9A 2C9LY 5CBNA 5KKZC 2YKOA 2H43A 3WUTA 3G6EP 3H1JJ 3VN0A 4OGQD 2YO3A 4I1LA 3CWBD 1NTMJ 1FZCB 1KQLA 5B66E 4EOTA 1U7JA 2LKMA 4WY4D 3CC2P 1BGYE 2HYNA 4D6TE 2KSEA 2QJKB 3AECC 1LTAC 3AEGC 3P7KA 2KS1B 1Y8AA 3MHVA 2RH0A 2QG4A 1ZP0C 2CK3H 5CCGD 1NJIQ 3SFEC 1S9KD 2A45G 1JY2P 3D70A 4JBZA 3WMM0 4DJGA 3TNUA 3Q2YA 1PPJG 1GK6A 2PP6A 5AVQB 4Y99B 3B5NA 5DJTB 2IZ0A 1RY3A 3BASA 2IBZD 2JEEA 2KNCA 2J59M 4HYTB 3AE2C 4Y99C 1BSNA 1S3JA 1NU1E 5KAIE 2R44A 1MZ9A 1T8ZA 1FZCA 2WPVB 2K3RA 3L72J 5KAFE 5GTIH 1KORA 3CMAP 3BVHA 1SQXJ 1L0NE 1UIIA 4UB6H 4AUWA 1R5LA 2HLOA 3V2RA 3AE5C 3CCQP 2XU6A 1JY3N 2KS1A 5KLVE 1JOCA 1BCCD 3W68A 1LTIC 3L75J 1LTJC 5APXA 2C0WA 1IFIA 3QWOC 2W8ZA 3L70G 2YKQA 3CCRP 1J1DB 3P8CE 3CX5H 3JSVC 2Y9YA 4NPEA 2W6JH 1IJDB 1VPCA 1NTKG 3W67A 5AVYB 3VTPC 1KTMA 3FGAD 4UB8E 1J1DC 2JJLA 2G3AA 5CCHD 1OFCX 1KMIZ 2KXPB 3GHGB 4XA4A 1IK9A 4LLHA 3BRTB 1SQVG 1ZRTD 2OYIB 1KB9E 5M1BA 3RK3B 1N7LA 1P84D 3L72D 4OGQB 1M7LA 2XKMA 2OYHB 2AEFA 2LXCB 1K9MQ 1SQBJ 2ZJSE 1VQNP 5APVA 2OYIC 4WY4B 3PP5A 4OGQC 5E79H 1NYHA 2IFNA 1J1EC 1VQ5P 1NGMB 3MZWB 3H1KE 1AQTA 3U1AA 4WY4C 3HD7C 2QE7H 1PV3A 2O01N 1HJBA 3CXHH 1USEA 4HJGH 2E76B 1IFPA 3TDKA 3O8ZA 1SQPE 4W80A 1Y9BA 1YQ3C 1ZOYC 1KYOI 5CCGC 1QL2A 4L74A 3GHGA 2QRXA 1X79B 3CL3D 3RK2D 1H8AA 2QSIA 3CXHI 2E75B 4I2LC 1L0LE 4H0LD 3TGUG 2O3JA 2OYHA 5KLIB 2WSEJ 4IL6X 2Q6QA 4N78E 3G71P 3HUSA 2Q1KA 2E74D 5AW7B 1U57A 2O01J 3BATA 1BGYJ 5CBOA 2KYVA 1L0NK 4D6TJ 2YIUB 3RBZA 4GOFA 2WPSA 2GM4A 2H89C 2B87A 2FFDB 3AE1C 1S2EA 4U3FG 1KILD 4GDOA 1XTGB 1PGQA 2ITAA 1PPJD 2UWJE 3D6YA 5AW3B 3WU2H 2FFDC 2OARA 5AW2B 1FZAA 5CHXA 2IPPA 3H1LG 1G1IA 3KQGA 4OH8B 4XFJA 3BCCD 4L76A 3Q1MA 1DD3A 5B66H 3H1HE 1YJNP 2Z5HA 2HR3A 3CMEP 5GTIE 3VMAA 1NU1J 1ZR2A 3M9QA 2WITA 1JM0A 2R3SA 1FAVA 3I5CA 1Q90D 2QEXP 1NWQA 4UB6E 4YPCA 3I56P 1CI6B 3H32B 2K1AA 1OX3A 1AA0A 1L0NJ 1EC5A 3MD0A 4GIFA 1LP1B 1TU3F 5GTHH 5KLVJ 1NTZE 3CD6P 1GU5A 4A7PA 3CX5E 2XV5A 1H0TA 3KZIH 3B5ND 4CPGA 1DIPA 2H8PD 2IBZG 4EIJA 3IFMA 5CCHA 2JWAA 2PGDA 3B8EB 1OIPA 1J2JB 3TK1A 1SQPK 3P32A 3R2PA 2KLUA 1NTMG 1LTSC 3RK2B 1CW5A 1FZEA 4PD4H 1N73B 1FU1A 2P10A 3MUDA 1QLED 1OXZA 4H0LB 2YXRB 3AEAC 3RK2C 1VQLP 1GDTA 1YIJP 4C7RA 1N73C 3H32A 3JCUH 5BVZA 3D71A 5E79E 2E74B 1L0ND 4H0LC 3EWKA 3C8VA 1VQ6P 1SFCD 1JCDA 2K9JB 2Y0DA 1IFJA 4C7NB 2WWWA 4PD4I 2ZT9C 2E74C 3CXHE 1RHZB 5B5EH 1JY2N 4RKUJ 3H1KJ 1D7MA 3SFDC 1KILB 2YO2A 1IZNB 1LT9B 2I1JA 1JY2O 4KHXA 2Y0EA 3FXEA 3IAOA 3M06A 1HWTC 1U7MA 1SQPJ 3S1KA 1PGJA 3A3YB 5AVXB 3L72G 2JP3A 4BWNA 4KT0J 1SQXG 2KK7A 1NTMK 3GW6A 1LNQA 1E79H 1DD4A 1KB9D 2FYUK 1LTGC 1L0LJ 4IFDK 3L75G 2RMZA 1MKMA 3H1IE 1LGHB 3A2AA 1USDA 4C7NA 5BU5A 2GUSA 1HJ0A 2WPQA 2R5DA 3PRJA 3TNUB 1KILA 4LGDE 3H1KD 1LT9A 2OQQA 3HRNA 3CC4P 3EQ2A 1Q2NA 2KNCB 2AXTH 2YMYA 3WU2E 1M1JA 3F89A 1SQPD 1RE3A 2D2CD 3USSA 3B5NC 1HBWA 3RK3D 3H1LD 1GMJA 3CC7P 3O6QB 2KLVA 1VQKP 1SQBG 4U7JA 1FE6A 2FYUJ 1YJ9P 1SQXK 3L73E 3H1HJ 3KYQA 4M3LA 2IYPA 1FZCC 2FKWB 3WUVA 4PJ0H 4GKGA 2E5YA 1DEEG 2WMMA 1WRGA 1X9VA 2W27A 2QJKC 4ZKUA 2Q3EA 4L73A 3SWYA 1SFCB 1NO4A 2E76D 5GTHE 2QIWA 3TSIA 1GZLA 3L70E 1T2KC 1VQMP 2NPSB 5AW6B 4IFFA 1SS1A 3BRVB 1NTZJ 3KZIE 3H6PA 2A06G 3CCMP 1NTKE 4IL6E 2WSCH 1ZR4A 3M91A 3KHUA 3BCCG 3V2QA 2HPCB 2FYZA 2E75D 1OW8A 3H1JD 1URQB 2YKPA 1NTMD 1SQVE 1JMBA 3O6QA 2LXBA 4PD4E 5CJ0A 2FYUD 2LR2A 2IBZI 1SQBK 1IFNA 5AVZB 4LC1A 1GK4A 1ZLLA 1X0TA 1M1KQ 3JCUE 2W83C 4D6TG 1HUCA 1MFZA 5KJ7A 3Q5RA 2M3BA 3VOPA 1SFCA 2NPSA 1LT1A 2V7QH 1LJ2A 1H89A 5B5EE 2E43A 4R4LA 1XTCC 1NTZD 3L71E 2Q7CA 3CX5D 3K5BA 1EZVE 3T97A 2J5UA 4NPFX 2BCCE 1WMKA 2SPZA 1AFOA 2HPCA 3RL0g 1BE3E 2D2CB 4N6JA 1URQA 1VDFA 1LWUB 3GHGC 1OW6A 1NU1G 4WBAA 2AEJA 1QX8A 1K04A 1IFMA 1SQXD 2N1TA 2D2CC 1SQQE 1KYOH 2V4HA 2M8RA 3HUSB 3SSUA 3RK3C 1YTZI 4PV1D 1WT6A 3RBXA 2JKVA 1L0NG 2OYHC 2B88A 2O1JA 2RKLA 3L75D 1LTJA 3AE3C 3VYIA 3CCUP 1RH5B 3LIDA 5KLVG 3HUSC 1P84I 3LIEA 2YMKA 3H1IJ 2B87B 2MJZA 2YXQB 1PL5A 2YNYA 1G2CA 3AE7C 1HGVA 4JPZB 1LTBC 2G8YA 2E76C 4IFMA 4ZMDA 1BDCA 3CCVP 2AXTE 1EXJA 1FDMA 3EFGA 2IX7C 1LWUA 2ZXEB 4H44D 3CWBE 1GW4A 1QVGO 3AE8C 3G9RA 3PH0A 3V6IA 1SQBD 3KPEA 1NU1K 4ASWA 2E75C 5TISH 1OWAA 1RE4A 5KLIC 4PJ0E 1CSBA 2WSFH 3L73J 4BRYB 1M56D 3GF7A 3M9BA 1FJKA 3ITKA 3PLNA 3Q3DA 5KLVK 2A45H 3IR9A 3H1KG 2QVAA 1H0TB 1PFIA 2YIUC 1VF5D 3L70J 2A06D 1KQSO 1N7SD 1SQPG 2XNXA 3A7OA 1QEXA 1HGZA 1NTKJ 5AW9B 3LW5H 5CCHC 2A45I 2OTKE 1OVRA 4O9BA 1RF1B 3V2NA 2WPRA 5TJHA 3F5HA 1IFDA 1L0LG 1SQVJ 3C1LA 3NMDA 3FWLA 3VP8A 1FDOA 1PP9E 4PV1B 1CZQA 3MUDC 4BRYA 1GL2A 1BCCE 1DX7A 4K35A 3L73D 3N4XA 1BGYD 1N2DC 4D6TD 3VMYA 1MV8A 2IDBA 3U1CA 4Y28J 2P58A 5DJUB 4C46A 5AVUB 4IL6H 1GU4A 1FJPA 3FXDA 2Z4EA 1PGPA 2JO1A 1QL1A 3H1JG 1M8OB 3M0DA 2HODA 3L71J 1NKNA 2ZVOB 3G4SP 4GOEA 3TF5A 1ZRTE 1FZFA 1AV1A 2BCCJ 2VRSA 4EI2A 2DW3A 4H44B 4EYYQ 1RF1A 1JNMA 2FYUG 1NU1D 5EFWB 1BE3J 2E42A 3H1HG 2KUBA 2BASA 2ZXXA 4YTPC 4KJMA 1KYOE 2QJPB 4TT3H 4H44C 3GLMA 5KJ7D 1L0LK 3M0AA 1SQQJ 1Y47A 2NRGA 3MGNA 2P2UA 3L4FA 2HG5D 2QJPC 5KLVD 2IYOA 4N3YB 1DEBA 2NPSD 4AYCA 1YI2P 3CLQA 1NTZG 3OW2O 4I7ZB 3P8CD 1HVVA 5L8RJ 1FS0E 1RF0A 2QJYB 3V5BA 1VF5B 1JMMA 1M1JB 1N7SB 2R5BA 3L74E 1KILC 2KIKA 4RO0A 1LT9C 1URQD 5AVRB 2R3CA 3L71D 3ZDMA 1EZVD 2QJYC 4TLFA 1VF5C 3EFFK 2IFMA 3GG2A 4AQRD 1L4AA 3L36A 1NAYA 2C9NY 1M1JC 2N1TD 2Q3IA 1RE3C 1Z56A 4RESB 1BE3D 1PZQA 3A0BH 1NOHA 4JYBA 3CWBJ 1BSHA 4OVNF 3SWKA 5TISE 3G3ZA 4XE5B 2Q9IA 2M5AB 2KZJA 3MTUE 1QVFO 2KB7P 1GW3A 2ZYGA 5APYA 4YXDC 1FZBA 3II6A 1KILE 3ABVC 1OVVA 3V2PA 1KB9I 2HFED 3WUUA 1PPJE 1K8AQ 1NTZK 5AW4B 1QGKB 1N7SA 1RQUA 1KQFB 1YHQP 2AXCA 4B86A 5KKZB 3I55P 3BCCE 2FXMA 3PTZA 1L2PA 1X8YA 2WSCJ 3R4YA 1N86A 1IO4A 3AE4C 1BDDA 3C9IA 2GA1A 4MN4C 5CMZA 3NTNA 4DCKA 2ZYAA 2Y0CA 2M5AA 5AVTB 1L0LD 3GMAA 2MKVA 3U59A 2H7HA 3JC22 4N78D 3E1IA 2K9YA 1S72P 4ASVA 3HD7D 2ZFCA 1PP9J 3H1IG 3CPWO 4NPDA 3GF3A 2M3EA 1BCCJ 1HTLC 1KV4A 5KJ7C 3HE4B 1EXIA 1PIXA 2W6BA 3V4QA 4GODA 1SFCC 2ZVNB 3IF4A 1GTWA 2OTLP 1NHLA 3T97B 2NPSC 2QM7A 3HTKB 3D6ZA 5AW5B 2V7QJ 2FY8A 4JQ0D 2P67A 1W2EA 2FYNB 1IK7A 1VQ9P 1AVYA 4W7ZA 5APWA 2JWDA 1KFMA 1SLQA 1SP4A 2N1TB 1VQ7P 1URQC 3H1HD 5AW8B 2GUVA 1JB0J 2FYNC 1Q82Q 2PFXA 3L73G 1GL2D 3L37A 1BGYG 3AEDC 2ZAEB 2N1TC 2KOGA 1KC8Q 1LTJB 1PP9D 4EDFA 1FDIA 1W5CE 2PAJA 3RL0D 3HE4A 1YYCA 1JY3O 1G2CB 3UIAA 2K88A 1Q7YQ 3HTKA 4ZNCA 2K37A 3NFQA 3TYYA 2P1JA 4W7YA 2FXOA 1A02F 5AW1B 1P84H 2M0BA 3L74J 1S5LX 1JCCA 1FC2C 2B9BA 2Z5IA 1FOSF 1LWUC 2B89A 3TGUE 3CX5I 3A0BE 2O1KA 4JF7A 2QA4P 2WZ7A 1MUUA 1OVUA 1E5WA 3KDPB 3L35A 2WQYC 3A0HH 1J1EB 1KYOD 2N9BA 2R32A 1OZHA 4WB4A 1RE4C 3HD7B 5APUA 2WSFJ 1K73Q 4L75A 4GT1A 4U3FE 2Y9ZA 2WT7B 2E5TA 3VMXA 2RN0A 1PGOA 3CXHD 2KI7B 2ZYDA 2I8DA 3L71G 1OW7A 1A02J 2KP8A 4DOJA 3SWFA 1EZVG 4RJTA 1FZGA 4JYCA 4H13D 2KSJA 5H2FH 2BCCG 3RK3E 1NTKK 1L4AD 3H1LE 3AE6C 2IZ1A 3QH9A 3L74D 1BE3G 1G1JA 3CCLP 5AVWB 4IOIH 3BCCJ 2OYIA 3LW5J 2POHA 2Q5UA 1VQPP 2AEMA 1W2BO 1NVOA 4I6MC 1SQVK 1SQQG 1VQ8P 3PJSK 1GL2B 1JY3P 1EDJA 1NKZB 1YTZT 3KXDA 5APTA 4WY4A 5CJ4A 1LTTC 3HD7A 4HH2A 2ZT9D 1S9KE 3H1ID 1ZMEC 1GL2C 1T3UA 3RL0B 3V4WA 1S5LH 1GD2E 4R4MA 5CCGA 2WT7A 2CPSA 2J58A 1Q86Q 2IBZE 2XZRA 2BEQD 3RL0C 1JO5A 1OMIA 1IC2A 3MIWA 2OTJP 3OJAB 2HODB 1HF9A 2FXPA 2QM8A 3H1JE 3AE9C 4ZKPA 1NTME 1ZXGA 1UIXA 2WSEH 2W90A 3PHLA 3M0DC 1H88A 3VP9A 3AEFC 3CWBG 1K05A 2FYUE 2I1KA 1YJWP 1KD1Q 2H88C 4YXWH 1RF1C 2JDIH 1R5SA 2O01H 2CPBA 1JTHB 1SQQK 3E7KA 5AVVB 5APSA 4PV1C 3OA7A 1NH4A 1S1CX 1VL2A 3AEBC 2PRRA 4BXLA 3L70D 2W6AA 2NZ2A 5AW0B 2FFDA 4OWFA 3VMZA 3M9HA 1NTKD 3S4RA 2WSSH 1EDIA 3B4SA 3FX0A 1NAFA 2C0XA 3NXSA 1RF0C 1KFNA 4H13B 3HE5B 1L4AB 1P84E 3L72E 5KAIH 3P8MC 1SQXE 1KN7A 2OYOA 1T3JA 5KAFH 1SQVD 1YBKA 4H13C 2BEZF 5C39A 1L4AC 4DZOA 4PD4D 1FBMA 3TGUJ 3L75E 1JTHA 1KZUB 1PP9G 3A0HE 3CCEP 1EQ7A 1RQVA 1CI6A 1BCCG 1T2KD 1JUNA 1S4XA 2ZT9B 2N9YB 1LP1A 3H25A 4HKZH 3E1RA 1EDLA 2KZIA 3RGUA 3B71A 1AJYA 2WVRA 1DH3A 2OGUA 4I7ZC 2L5GB 4U3FJ 4UB8H 1N8RQ 1X22A 1KQGB 4HB1A 1Q81Q 1VQOP 3HE5A 2P7JA 5H2FE 2BCCD 4K3AA 4WVZA 5BU8B 1AQ5A 1N7SC 1AVOA 1ZN5A 2XDJA 2L91A 3MP7B 1KB9H 3H1LJ 1SQBE 3CCJP 4QMAA 3Q5SA 5AVSB 1M57D 1N73A 3A5TA 1HH0A 1SQQD 1R8EA 5KTBA 3TGUD 3CCSP 5K5GB 1ZW0A 1ZV8A 1EZVI 1YQ4C 2FBWC 4DT0A 4WWIA 2XNDH 2JR8A 4Z1MH 1MFTA 3IN6A 2K9JA
chains in the Genus database with same CATH topology
2KOGA 5CCHA 1LTJB 3B8EB 3KPEA 1NU1K 1J2JB 3N7NA 3TK1A 5APQA 1SQPK 3P32A 1OWAA 2PAJA 3R2PA 3RL0D 1FOSE 1RE4A 3HE4A 1YYCA 1LTSC 3RK2B 1JY3O 1CW5A 2WTYA 1FZEA 3B5NB 1G2CB 1N73B 1CSBA 1FU1A 2WSFH 1SVFA 3UIAA 3MUDA 3OAKA 3CI9A 3M9BA 1OXZA 2C9LY 1FJKA 3HTKA 2YKOA 3RK2C 2H43A 3NFQA 1GDTA 5KLVK 2A45H 3IR9A 3TYYA 2P1JA 4C7RA 1N73C 3H32A 3VN0A 2YO3A 4I1LA 4W7YA 5BVZA 1PFIA 1FZCB 1A02F 1KQLA 5AW1B 1SFCD 4EOTA 1JCCA 1JCDA 1IFJA 4C7NB 2LKMA 2WWWA 1N7SD 4WY4D 2XNXA 3A7OA 2HYNA 2Z5IA 1FOSF 1LWUC 1LTAC 1HGZA 3P7KA 1JY2N 5AW9B 2O1KA 1KILB 2YO2A 3LW5H 4JF7A 2WZ7A 5CCHC 1LT9B 1MUUA 2I1JA 1E5WA 1JY2O 4KHXA 5CCGD 2A45I 3KDPB 3L35A 4O9BA 3M06A 1J1EB 1RF1B 1S9KD 1HWTC 2A45G 1JY2P 3V2NA 2WPRA 2N9BA 2R32A 1IFDA 4WB4A 3A3YB 3WMM0 1RE4C 3HD7B 3TNUA 2PP6A 1GK6A 3NMDA 3VP8A 5AVQB 4Y99B 5AVXB 5APUA 3B5NA 1CZQA 1RY3A 3BASA 1GL2A 4GT1A 2JEEA 1DX7A 1NTMK 2J59M 3N4XA 1N2DC 2WT7B 3VMXA 4HYTB 4Y99C 3VMYA 1MV8A 2FYUK 1LTGC 3U1CA 1MZ9A 1A02J 1T8ZA 2KP8A 4DOJA 4IFDK 3SWFA 1FZCA 1FZGA 4JYCA 2KSJA 4C46A 1NTKK 1L4AD 1LGHB 5AVUB 3A2AA 3BVHA 4C7NA 5BU5A 1G1JA 2GUSA 1GU4A 2WPQA 5AVWB 4AUWA 1FJPA 2R5DA 2Z4EA 2HLOA 3V2RA 2XU6A 2OYIA 1JY3N 1QL1A 3M0DA 2POHA 2Q5UA 2HODA 3TNUB 4I6MC 1KILA 1JOCA 1NKNA 4LGDE 1LTIC 1LT9A 1LTJC 1SQVK 5APXA 2C0WA 1IFIA 1FZFA 3HRNA 2VRSA 2YKQA 1GL2B 3EQ2A 1RF1A 1JNMA 1J1DB 1JY3P 3P8CE 1NKZB 2YMYA 2E42A 1YTZT 1M1JA 5APTA 5CJ4A 4WY4A 1LTTC 2BASA 1RE3A 3HD7A 4HH2A 1S9KE 1IJDB 1VPCA 3B5NC 5AVYB 3RK3D 1HBWA 3VTPC 1GL2C 1T3UA 1J1DC 2JJLA 3RL0B 5KJ7D 1L0LK 3V4WA 5CCHD 3M0AA 1GD2E 5CCGA 2WT7A 3GHGB 2KLVA 2CPSA 2J58A 2P2UA 3MGNA 4XA4A 3L4FA 1IK9A 2HG5D 4LLHA 1SQXK 2XZRA 4N3YB 1DEBA 3BRTB 2NPSD 3KYQA 4M3LA 1FZCC 3RL0C 4AYCA 2FKWB 1JO5A 1IC2A 3MIWA 2OYIB 3OJAB 3CLQA 2HODB 3RK3B 1N7LA 4GKGA 1M7LA 1WRGA 2QM8A 1X9VA 1HVVA 3P8CD 2W27A 4ZKPA 2XKMA 2OYHB 1RF0A 4ZKUA 3V5BA 3SWYA 1SFCB 2WSEH 1NO4A 5APVA 2OYIC 1JMMA 3M0DC 3TSIA 1GZLA 3VP9A 1T2KC 1M1JB 1N7SB 2R5BA 1H88A 4WY4B 1KILC 3PP5A 1LT9C 2I1KA 2NPSB 1URQD 5AVRB 2R3CA 5AW6B 4IFFA 2IFNA 3BRVB 1J1EC 3H6PA 2IFMA 1RF1C 4AQRD 1L4AA 2O01H 3L36A 2C9NY 1M1JC 2CPBA 3U1AA 4WY4C 2N1TD 2Q3IA 1RE3C 3HD7C 1JTHB 2WSCH 1SQQK 1Z56A 4RESB 1ZR4A 1HJBA 5AVVB 5APSA 3M91A 1NOHA 3V2QA 3OA7A 4JYBA 3O8ZA 1NH4A 2HPCB 2FYZA 4W80A 2Q9IA 3G3ZA 4XE5B 1URQB 5CCGC 2YKPA 1QL2A 3MTUE 3GHGA 5CJ0A 2KB7P 1GW3A 1X79B 2W6AA 5AW0B 2FFDA 5APYA 3CL3D 1SQBK 1IFNA 5AVZB 3RK2D 3VMZA 4LC1A 1GK4A 1FZBA 1ZLLA 3II6A 3M9HA 1H8AA 3V2PA 1NAFA 2C0XA 3NXSA 1HUCA 1MFZA 1RF0C 1KFNA 2HFED 4I2LC 5KJ7A 2OYHA 2M3BA 3HE5B 1L4AB 1NTZK 3VOPA 5AW4B 1SFCA 4N78E 3P8MC 3HUSA 1N7SA 2NPSA 1T3JA 4B86A 5AW7B 1H89A 1L4AC 4DZOA 2E43A 1XTCC 1FBMA 2FXMA 3BATA 1X8YA 2KYVA 1L0NK 2Q7CA 1N86A 1IO4A 1JTHA 3T97A 3C9IA 1KZUB 1EQ7A 2WPSA 2GM4A 5CMZA 2FFDB 1AFOA 1T2KD 1CI6A 3NTNA 2HPCA 1KILD 1JUNA 1XTGB 4N6JA 1URQA 5AVTB 1VDFA 1LWUB 3GHGC 3U59A 2H7HA 4N78D 1GW4A 4WBAA 3E1IA 5AW3B 2FFDC 1IFMA 2N1TA 2OARA 3HD7D 5AW2B 2ZFCA 1FZAA 5CHXA 1DH3A 2IPPA 2M8RA 3HUSB 3RK3C 1G1IA 3KQGA 4OH8B 1YTZI 2L5GB 1WT6A 1HTLC 5KJ7C 3HE4B 2W6BA 2OYHC 2Z5HA 3V4QA 2O1JA 1LTJA 1SFCC 3VYIA 3HE5A 2P7JA 3LIDA 5BU8B 1AQ5A 3HUSC 1ZR2A 1N7SC 1ZN5A 2WITA 2XDJA 3M9QA 1GTWA 1NHLA 1FAVA 2NPSC 2QM7A 3I5CA 3HTKB 3LIEA 1NWQA 5AW5B 2MJZA 2P67A 1CI6B 3H32B 1W2EA 5AVSB 2YNYA 1G2CA 1N73A 3MD0A 4GIFA 1HGVA 3A5TA 1LTBC 1HH0A 4W7ZA 5APWA 5KTBA 1KFMA 1SLQA 4IFMA 1ZV8A 1SP4A 2N1TB 1GU5A 2XV5A 1FDMA 1URQC 3EFGA 5AW8B 2GUVA 2IX7C 1LWUA 3B5ND 2ZXEB 2H8PD 1GL2D 3L37A 4EIJA 3IFMA 2N1TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HGZ A;  1NH4 A;  2C0W A;  1HH0 A;  2CPB A;  2MJZ A;  1IFI A;  2CPS A;  1IFD A;  1HGV A;  1IFJ A;  2C0X A;  1FDM A; 
#chains in the Genus database with same CATH topology
 1S5L E;  3FWN A;  3Q5P A;  1EDK A;  3S9O A;  2A06 E;  3N7N A;  1T6A A;  1JEK A;  5APQ A;  1YIT P;  1FOS E;  4U3F D;  1VQ4 P;  2WTY A;  3B5N B;  1SVF A;  1M90 Q;  3L74 G;  3AEE C;  3OAK A;  3CI9 A;  2C9L Y;  5CBN A;  5KKZ C;  2YKO A;  2H43 A;  3WUT A;  3G6E P;  3H1J J;  3VN0 A;  4OGQ D;  2YO3 A;  4I1L A;  3CWB D;  1NTM J;  1FZC B;  1KQL A;  5B66 E;  4EOT A;  1U7J A;  2LKM A;  4WY4 D;  3CC2 P;  1BGY E;  2HYN A;  4D6T E;  2KSE A;  2QJK B;  3AEC C;  1LTA C;  3AEG C;  3P7K A;  2KS1 B;  1Y8A A;  3MHV A;  2RH0 A;  2QG4 A;  1ZP0 C;  2CK3 H;  5CCG D;  1NJI Q;  3SFE C;  1S9K D;  2A45 G;  1JY2 P;  3D70 A;  4JBZ A;  3WMM 0;  4DJG A;  3TNU A;  3Q2Y A;  1PPJ G;  1GK6 A;  2PP6 A;  5AVQ B;  4Y99 B;  3B5N A;  5DJT B;  2IZ0 A;  1RY3 A;  3BAS A;  2IBZ D;  2JEE A;  2KNC A;  2J59 M;  4HYT B;  3AE2 C;  4Y99 C;  1BSN A;  1S3J A;  1NU1 E;  5KAI E;  2R44 A;  1MZ9 A;  1T8Z A;  1FZC A;  2WPV B;  2K3R A;  3L72 J;  5KAF E;  5GTI H;  1KOR A;  3CMA P;  3BVH A;  1SQX J;  1L0N E;  1UII A;  4UB6 H;  4AUW A;  1R5L A;  2HLO A;  3V2R A;  3AE5 C;  3CCQ P;  2XU6 A;  1JY3 N;  2KS1 A;  5KLV E;  1JOC A;  1BCC D;  3W68 A;  1LTI C;  3L75 J;  1LTJ C;  5APX A;  2C0W A;  1IFI A;  3QWO C;  2W8Z A;  3L70 G;  2YKQ A;  3CCR P;  1J1D B;  3P8C E;  3CX5 H;  3JSV C;  2Y9Y A;  4NPE A;  2W6J H;  1IJD B;  1VPC A;  1NTK G;  3W67 A;  5AVY B;  3VTP C;  1KTM A;  3FGA D;  4UB8 E;  1J1D C;  2JJL A;  2G3A A;  5CCH D;  1OFC X;  1KMI Z;  2KXP B;  3GHG B;  4XA4 A;  1IK9 A;  4LLH A;  3BRT B;  1SQV G;  1ZRT D;  2OYI B;  1KB9 E;  5M1B A;  3RK3 B;  1N7L A;  1P84 D;  3L72 D;  4OGQ B;  1M7L A;  2XKM A;  2OYH B;  2AEF A;  2LXC B;  1K9M Q;  1SQB J;  2ZJS E;  1VQN P;  5APV A;  2OYI C;  4WY4 B;  3PP5 A;  4OGQ C;  5E79 H;  1NYH A;  2IFN A;  1J1E C;  1VQ5 P;  1NGM B;  3MZW B;  3H1K E;  1AQT A;  3U1A A;  4WY4 C;  3HD7 C;  2QE7 H;  1PV3 A;  2O01 N;  1HJB A;  3CXH H;  1USE A;  4HJG H;  2E76 B;  1IFP A;  3TDK A;  3O8Z A;  1SQP E;  4W80 A;  1Y9B A;  1YQ3 C;  1ZOY C;  1KYO I;  5CCG C;  1QL2 A;  4L74 A;  3GHG A;  2QRX A;  1X79 B;  3CL3 D;  3RK2 D;  1H8A A;  2QSI A;  3CXH I;  2E75 B;  4I2L C;  1L0L E;  4H0L D;  3TGU G;  2O3J A;  2OYH A;  5KLI B;  2WSE J;  4IL6 X;  2Q6Q A;  4N78 E;  3G71 P;  3HUS A;  2Q1K A;  2E74 D;  5AW7 B;  1U57 A;  2O01 J;  3BAT A;  1BGY J;  5CBO A;  2KYV A;  1L0N K;  4D6T J;  2YIU B;  3RBZ A;  4GOF A;  2WPS A;  2GM4 A;  2H89 C;  2B87 A;  2FFD B;  3AE1 C;  1S2E A;  4U3F G;  1KIL D;  4GDO A;  1XTG B;  1PGQ A;  2ITA A;  1PPJ D;  2UWJ E;  3D6Y A;  5AW3 B;  3WU2 H;  2FFD C;  2OAR A;  5AW2 B;  1FZA A;  5CHX A;  2IPP A;  3H1L G;  1G1I A;  3KQG A;  4OH8 B;  4XFJ A;  3BCC D;  4L76 A;  3Q1M A;  1DD3 A;  5B66 H;  3H1H E;  1YJN P;  2Z5H A;  2HR3 A;  3CME P;  5GTI E;  3VMA A;  1NU1 J;  1ZR2 A;  3M9Q A;  2WIT A;  1JM0 A;  2R3S A;  1FAV A;  3I5C A;  1Q90 D;  2QEX P;  1NWQ A;  4UB6 E;  4YPC A;  3I56 P;  1CI6 B;  3H32 B;  2K1A A;  1OX3 A;  1AA0 A;  1L0N J;  1EC5 A;  3MD0 A;  4GIF A;  1LP1 B;  1TU3 F;  5GTH H;  5KLV J;  1NTZ E;  3CD6 P;  1GU5 A;  4A7P A;  3CX5 E;  2XV5 A;  1H0T A;  3KZI H;  3B5N D;  4CPG A;  1DIP A;  2H8P D;  2IBZ G;  4EIJ A;  3IFM A;  5CCH A;  2JWA A;  2PGD A;  3B8E B;  1OIP A;  1J2J B;  3TK1 A;  1SQP K;  3P32 A;  3R2P A;  2KLU A;  1NTM G;  1LTS C;  3RK2 B;  1CW5 A;  1FZE A;  4PD4 H;  1N73 B;  1FU1 A;  2P10 A;  3MUD A;  1QLE D;  1OXZ A;  4H0L B;  2YXR B;  3AEA C;  3RK2 C;  1VQL P;  1GDT A;  1YIJ P;  4C7R A;  1N73 C;  3H32 A;  3JCU H;  5BVZ A;  3D71 A;  5E79 E;  2E74 B;  1L0N D;  4H0L C;  3EWK A;  3C8V A;  1VQ6 P;  1SFC D;  1JCD A;  2K9J B;  2Y0D A;  1IFJ A;  4C7N B;  2WWW A;  4PD4 I;  2ZT9 C;  2E74 C;  3CXH E;  1RHZ B;  5B5E H;  1JY2 N;  4RKU J;  3H1K J;  1D7M A;  3SFD C;  1KIL B;  2YO2 A;  1IZN B;  1LT9 B;  2I1J A;  1JY2 O;  4KHX A;  2Y0E A;  3FXE A;  3IAO A;  3M06 A;  1HWT C;  1U7M A;  1SQP J;  3S1K A;  1PGJ A;  3A3Y B;  5AVX B;  3L72 G;  2JP3 A;  4BWN A;  4KT0 J;  1SQX G;  2KK7 A;  1NTM K;  3GW6 A;  1LNQ A;  1E79 H;  1DD4 A;  1KB9 D;  2FYU K;  1LTG C;  1L0L J;  4IFD K;  3L75 G;  2RMZ A;  1MKM A;  3H1I E;  1LGH B;  3A2A A;  1USD A;  4C7N A;  5BU5 A;  2GUS A;  1HJ0 A;  2WPQ A;  2R5D A;  3PRJ A;  3TNU B;  1KIL A;  4LGD E;  3H1K D;  1LT9 A;  2OQQ A;  3HRN A;  3CC4 P;  3EQ2 A;  1Q2N A;  2KNC B;  2AXT H;  2YMY A;  3WU2 E;  1M1J A;  3F89 A;  1SQP D;  1RE3 A;  2D2C D;  3USS A;  3B5N C;  1HBW A;  3RK3 D;  3H1L D;  1GMJ A;  3CC7 P;  3O6Q B;  2KLV A;  1VQK P;  1SQB G;  4U7J A;  1FE6 A;  2FYU J;  1YJ9 P;  1SQX K;  3L73 E;  3H1H J;  3KYQ A;  4M3L A;  2IYP A;  1FZC C;  2FKW B;  3WUV A;  4PJ0 H;  4GKG A;  2E5Y A;  1DEE G;  2WMM A;  1WRG A;  1X9V A;  2W27 A;  2QJK C;  4ZKU A;  2Q3E A;  4L73 A;  3SWY A;  1SFC B;  1NO4 A;  2E76 D;  5GTH E;  2QIW A;  3TSI A;  1GZL A;  3L70 E;  1T2K C;  1VQM P;  2NPS B;  5AW6 B;  4IFF A;  1SS1 A;  3BRV B;  1NTZ J;  3KZI E;  3H6P A;  2A06 G;  3CCM P;  1NTK E;  4IL6 E;  2WSC H;  1ZR4 A;  3M91 A;  3KHU A;  3BCC G;  3V2Q A;  2HPC B;  2FYZ A;  2E75 D;  1OW8 A;  3H1J D;  1URQ B;  2YKP A;  1NTM D;  1SQV E;  1JMB A;  3O6Q A;  2LXB A;  4PD4 E;  5CJ0 A;  2FYU D;  2LR2 A;  2IBZ I;  1SQB K;  1IFN A;  5AVZ B;  4LC1 A;  1GK4 A;  1ZLL A;  1X0T A;  1M1K Q;  3JCU E;  2W83 C;  4D6T G;  1HUC A;  1MFZ A;  5KJ7 A;  3Q5R A;  2M3B A;  3VOP A;  1SFC A;  2NPS A;  1LT1 A;  2V7Q H;  1LJ2 A;  1H89 A;  5B5E E;  2E43 A;  4R4L A;  1XTC C;  1NTZ D;  3L71 E;  2Q7C A;  3CX5 D;  3K5B A;  1EZV E;  3T97 A;  2J5U A;  4NPF X;  2BCC E;  1WMK A;  2SPZ A;  1AFO A;  2HPC A;  3RL0 g;  1BE3 E;  2D2C B;  4N6J A;  1URQ A;  1VDF A;  1LWU B;  3GHG C;  1OW6 A;  1NU1 G;  4WBA A;  2AEJ A;  1QX8 A;  1K04 A;  1IFM A;  1SQX D;  2N1T A;  2D2C C;  1SQQ E;  1KYO H;  2V4H A;  2M8R A;  3HUS B;  3SSU A;  3RK3 C;  1YTZ I;  4PV1 D;  1WT6 A;  3RBX A;  2JKV A;  1L0N G;  2OYH C;  2B88 A;  2O1J A;  2RKL A;  3L75 D;  1LTJ A;  3AE3 C;  3VYI A;  3CCU P;  1RH5 B;  3LID A;  5KLV G;  3HUS C;  1P84 I;  3LIE A;  2YMK A;  3H1I J;  2B87 B;  2MJZ A;  2YXQ B;  1PL5 A;  2YNY A;  1G2C A;  3AE7 C;  1HGV A;  4JPZ B;  1LTB C;  2G8Y A;  2E76 C;  4IFM A;  4ZMD A;  1BDC A;  3CCV P;  2AXT E;  1EXJ A;  1FDM A;  3EFG A;  2IX7 C;  1LWU A;  2ZXE B;  4H44 D;  3CWB E;  1GW4 A;  1QVG O;  3AE8 C;  3G9R A;  3PH0 A;  3V6I A;  1SQB D;  3KPE A;  1NU1 K;  4ASW A;  2E75 C;  5TIS H;  1OWA A;  1RE4 A;  5KLI C;  4PJ0 E;  1CSB A;  2WSF H;  3L73 J;  4BRY B;  1M56 D;  3GF7 A;  3M9B A;  1FJK A;  3ITK A;  3PLN A;  3Q3D A;  5KLV K;  2A45 H;  3IR9 A;  3H1K G;  2QVA A;  1H0T B;  1PFI A;  2YIU C;  1VF5 D;  3L70 J;  2A06 D;  1KQS O;  1N7S D;  1SQP G;  2XNX A;  3A7O A;  1QEX A;  1HGZ A;  1NTK J;  5AW9 B;  3LW5 H;  5CCH C;  2A45 I;  2OTK E;  1OVR A;  4O9B A;  1RF1 B;  3V2N A;  2WPR A;  5TJH A;  3F5H A;  1IFD A;  1L0L G;  1SQV J;  3C1L A;  3NMD A;  3FWL A;  3VP8 A;  1FDO A;  1PP9 E;  4PV1 B;  1CZQ A;  3MUD C;  4BRY A;  1GL2 A;  1BCC E;  1DX7 A;  4K35 A;  3L73 D;  3N4X A;  1BGY D;  1N2D C;  4D6T D;  3VMY A;  1MV8 A;  2IDB A;  3U1C A;  4Y28 J;  2P58 A;  5DJU B;  4C46 A;  5AVU B;  4IL6 H;  1GU4 A;  1FJP A;  3FXD A;  2Z4E A;  1PGP A;  2JO1 A;  1QL1 A;  3H1J G;  1M8O B;  3M0D A;  2HOD A;  3L71 J;  1NKN A;  2ZVO B;  3G4S P;  4GOE A;  3TF5 A;  1ZRT E;  1FZF A;  1AV1 A;  2BCC J;  2VRS A;  4EI2 A;  2DW3 A;  4H44 B;  4EYY Q;  1RF1 A;  1JNM A;  2FYU G;  1NU1 D;  5EFW B;  1BE3 J;  2E42 A;  3H1H G;  2KUB A;  2BAS A;  2ZXX A;  4YTP C;  4KJM A;  1KYO E;  2QJP B;  4TT3 H;  4H44 C;  3GLM A;  5KJ7 D;  1L0L K;  3M0A A;  1SQQ J;  1Y47 A;  2NRG A;  3MGN A;  2P2U A;  3L4F A;  2HG5 D;  2QJP C;  5KLV D;  2IYO A;  4N3Y B;  1DEB A;  2NPS D;  4AYC A;  1YI2 P;  3CLQ A;  1NTZ G;  3OW2 O;  4I7Z B;  3P8C D;  1HVV A;  5L8R J;  1FS0 E;  1RF0 A;  2QJY B;  3V5B A;  1VF5 B;  1JMM A;  1M1J B;  1N7S B;  2R5B A;  3L74 E;  1KIL C;  2KIK A;  4RO0 A;  1LT9 C;  1URQ D;  5AVR B;  2R3C A;  3L71 D;  3ZDM A;  1EZV D;  2QJY C;  4TLF A;  1VF5 C;  3EFF K;  2IFM A;  3GG2 A;  4AQR D;  1L4A A;  3L36 A;  1NAY A;  2C9N Y;  1M1J C;  2N1T D;  2Q3I A;  1RE3 C;  1Z56 A;  4RES B;  1BE3 D;  1PZQ A;  3A0B H;  1NOH A;  4JYB A;  3CWB J;  1BSH A;  4OVN F;  3SWK A;  5TIS E;  3G3Z A;  4XE5 B;  2Q9I A;  2M5A B;  2KZJ A;  3MTU E;  1QVF O;  2KB7 P;  1GW3 A;  2ZYG A;  5APY A;  4YXD C;  1FZB A;  3II6 A;  1KIL E;  3ABV C;  1OVV A;  3V2P A;  1KB9 I;  2HFE D;  3WUU A;  1PPJ E;  1K8A Q;  1NTZ K;  5AW4 B;  1QGK B;  1N7S A;  1RQU A;  1KQF B;  1YHQ P;  2AXC A;  4B86 A;  5KKZ B;  3I55 P;  3BCC E;  2FXM A;  3PTZ A;  1L2P A;  1X8Y A;  2WSC J;  3R4Y A;  1N86 A;  1IO4 A;  3AE4 C;  1BDD A;  3C9I A;  2GA1 A;  4MN4 C;  5CMZ A;  3NTN A;  4DCK A;  2ZYA A;  2Y0C A;  2M5A A;  5AVT B;  1L0L D;  3GMA A;  2MKV A;  3U59 A;  2H7H A;  3JC2 2;  4N78 D;  3E1I A;  2K9Y A;  1S72 P;  4ASV A;  3HD7 D;  2ZFC A;  1PP9 J;  3H1I G;  3CPW O;  4NPD A;  3GF3 A;  2M3E A;  1BCC J;  1HTL C;  1KV4 A;  5KJ7 C;  3HE4 B;  1EXI A;  1PIX A;  2W6B A;  3V4Q A;  4GOD A;  1SFC C;  2ZVN B;  3IF4 A;  1GTW A;  2OTL P;  1NHL A;  3T97 B;  2NPS C;  2QM7 A;  3HTK B;  3D6Z A;  5AW5 B;  2V7Q J;  2FY8 A;  4JQ0 D;  2P67 A;  1W2E A;  2FYN B;  1IK7 A;  1VQ9 P;  1AVY A;  4W7Z A;  5APW A;  2JWD A;  1KFM A;  1SLQ A;  1SP4 A;  2N1T B;  1VQ7 P;  1URQ C;  3H1H D;  5AW8 B;  2GUV A;  1JB0 J;  2FYN C;  1Q82 Q;  2PFX A;  3L73 G;  1GL2 D;  3L37 A;  1BGY G;  3AED C;  2ZAE B;  2N1T C;  2KOG A;  1KC8 Q;  1LTJ B;  1PP9 D;  4EDF A;  1FDI A;  1W5C E;  2PAJ A;  3RL0 D;  3HE4 A;  1YYC A;  1JY3 O;  1G2C B;  3UIA A;  2K88 A;  1Q7Y Q;  3HTK A;  4ZNC A;  2K37 A;  3NFQ A;  3TYY A;  2P1J A;  4W7Y A;  2FXO A;  1A02 F;  5AW1 B;  1P84 H;  2M0B A;  3L74 J;  1S5L X;  1JCC A;  1FC2 C;  2B9B A;  2Z5I A;  1FOS F;  1LWU C;  2B89 A;  3TGU E;  3CX5 I;  3A0B E;  2O1K A;  4JF7 A;  2QA4 P;  2WZ7 A;  1MUU A;  1OVU A;  1E5W A;  3KDP B;  3L35 A;  2WQY C;  3A0H H;  1J1E B;  1KYO D;  2N9B A;  2R32 A;  1OZH A;  4WB4 A;  1RE4 C;  3HD7 B;  5APU A;  2WSF J;  1K73 Q;  4L75 A;  4GT1 A;  4U3F E;  2Y9Z A;  2WT7 B;  2E5T A;  3VMX A;  2RN0 A;  1PGO A;  3CXH D;  2KI7 B;  2ZYD A;  2I8D A;  3L71 G;  1OW7 A;  1A02 J;  2KP8 A;  4DOJ A;  3SWF A;  1EZV G;  4RJT A;  1FZG A;  4JYC A;  4H13 D;  2KSJ A;  5H2F H;  2BCC G;  3RK3 E;  1NTK K;  1L4A D;  3H1L E;  3AE6 C;  2IZ1 A;  3QH9 A;  3L74 D;  1BE3 G;  1G1J A;  3CCL P;  5AVW B;  4IOI H;  3BCC J;  2OYI A;  3LW5 J;  2POH A;  2Q5U A;  1VQP P;  2AEM A;  1W2B O;  1NVO A;  4I6M C;  1SQV K;  1SQQ G;  1VQ8 P;  3PJS K;  1GL2 B;  1JY3 P;  1EDJ A;  1NKZ B;  1YTZ T;  3KXD A;  5APT A;  4WY4 A;  5CJ4 A;  1LTT C;  3HD7 A;  4HH2 A;  2ZT9 D;  1S9K E;  3H1I D;  1ZME C;  1GL2 C;  1T3U A;  3RL0 B;  3V4W A;  1S5L H;  1GD2 E;  4R4M A;  5CCG A;  2WT7 A;  2CPS A;  2J58 A;  1Q86 Q;  2IBZ E;  2XZR A;  2BEQ D;  3RL0 C;  1JO5 A;  1OMI A;  1IC2 A;  3MIW A;  2OTJ P;  3OJA B;  2HOD B;  1HF9 A;  2FXP A;  2QM8 A;  3H1J E;  3AE9 C;  4ZKP A;  1NTM E;  1ZXG A;  1UIX A;  2WSE H;  2W90 A;  3PHL A;  3M0D C;  1H88 A;  3VP9 A;  3AEF C;  3CWB G;  1K05 A;  2FYU E;  2I1K A;  1YJW P;  1KD1 Q;  2H88 C;  4YXW H;  1RF1 C;  2JDI H;  1R5S A;  2O01 H;  2CPB A;  1JTH B;  1SQQ K;  3E7K A;  5AVV B;  5APS A;  4PV1 C;  3OA7 A;  1NH4 A;  1S1C X;  1VL2 A;  3AEB C;  2PRR A;  4BXL A;  3L70 D;  2W6A A;  2NZ2 A;  5AW0 B;  2FFD A;  4OWF A;  3VMZ A;  3M9H A;  1NTK D;  3S4R A;  2WSS H;  1EDI A;  3B4S A;  3FX0 A;  1NAF A;  2C0X A;  3NXS A;  1RF0 C;  1KFN A;  4H13 B;  3HE5 B;  1L4A B;  1P84 E;  3L72 E;  5KAI H;  3P8M C;  1SQX E;  1KN7 A;  2OYO A;  1T3J A;  5KAF H;  1SQV D;  1YBK A;  4H13 C;  2BEZ F;  5C39 A;  1L4A C;  4DZO A;  4PD4 D;  1FBM A;  3TGU J;  3L75 E;  1JTH A;  1KZU B;  1PP9 G;  3A0H E;  3CCE P;  1EQ7 A;  1RQV A;  1CI6 A;  1BCC G;  1T2K D;  1JUN A;  1S4X A;  2ZT9 B;  2N9Y B;  1LP1 A;  3H25 A;  4HKZ H;  3E1R A;  1EDL A;  2KZI A;  3RGU A;  3B71 A;  1AJY A;  2WVR A;  1DH3 A;  2OGU A;  4I7Z C;  2L5G B;  4U3F J;  4UB8 H;  1N8R Q;  1X22 A;  1KQG B;  4HB1 A;  1Q81 Q;  1VQO P;  3HE5 A;  2P7J A;  5H2F E;  2BCC D;  4K3A A;  4WVZ A;  5BU8 B;  1AQ5 A;  1N7S C;  1AVO A;  1ZN5 A;  2XDJ A;  2L91 A;  3MP7 B;  1KB9 H;  3H1L J;  1SQB E;  3CCJ P;  4QMA A;  3Q5S A;  5AVS B;  1M57 D;  1N73 A;  3A5T A;  1HH0 A;  1SQQ D;  1R8E A;  5KTB A;  3TGU D;  3CCS P;  5K5G B;  1ZW0 A;  1ZV8 A;  1EZV I;  1YQ4 C;  2FBW C;  4DT0 A;  4WWI A;  2XND H;  2JR8 A;  4Z1M H;  1MFT A;  3IN6 A;  2K9J A; 
#chains in the Genus database with same CATH homology
 2KOG A;  5CCH A;  1LTJ B;  3B8E B;  3KPE A;  1NU1 K;  1J2J B;  3N7N A;  3TK1 A;  5APQ A;  1SQP K;  3P32 A;  1OWA A;  2PAJ A;  3R2P A;  3RL0 D;  1FOS E;  1RE4 A;  3HE4 A;  1YYC A;  1LTS C;  3RK2 B;  1JY3 O;  1CW5 A;  2WTY A;  1FZE A;  3B5N B;  1G2C B;  1N73 B;  1CSB A;  1FU1 A;  2WSF H;  1SVF A;  3UIA A;  3MUD A;  3OAK A;  3CI9 A;  3M9B A;  1OXZ A;  2C9L Y;  1FJK A;  3HTK A;  2YKO A;  3RK2 C;  2H43 A;  3NFQ A;  1GDT A;  5KLV K;  2A45 H;  3IR9 A;  3TYY A;  2P1J A;  4C7R A;  1N73 C;  3H32 A;  3VN0 A;  2YO3 A;  4I1L A;  4W7Y A;  5BVZ A;  1PFI A;  1FZC B;  1A02 F;  1KQL A;  5AW1 B;  1SFC D;  4EOT A;  1JCC A;  1JCD A;  1IFJ A;  4C7N B;  2LKM A;  2WWW A;  1N7S D;  4WY4 D;  2XNX A;  3A7O A;  2HYN A;  2Z5I A;  1FOS F;  1LWU C;  1LTA C;  1HGZ A;  3P7K A;  1JY2 N;  5AW9 B;  2O1K A;  1KIL B;  2YO2 A;  3LW5 H;  4JF7 A;  2WZ7 A;  5CCH C;  1LT9 B;  1MUU A;  2I1J A;  1E5W A;  1JY2 O;  4KHX A;  5CCG D;  2A45 I;  3KDP B;  3L35 A;  4O9B A;  3M06 A;  1J1E B;  1RF1 B;  1S9K D;  1HWT C;  2A45 G;  1JY2 P;  3V2N A;  2WPR A;  2N9B A;  2R32 A;  1IFD A;  4WB4 A;  3A3Y B;  3WMM 0;  1RE4 C;  3HD7 B;  3TNU A;  2PP6 A;  1GK6 A;  3NMD A;  3VP8 A;  5AVQ B;  4Y99 B;  5AVX B;  5APU A;  3B5N A;  1CZQ A;  1RY3 A;  3BAS A;  1GL2 A;  4GT1 A;  2JEE A;  1DX7 A;  1NTM K;  2J59 M;  3N4X A;  1N2D C;  2WT7 B;  3VMX A;  4HYT B;  4Y99 C;  3VMY A;  1MV8 A;  2FYU K;  1LTG C;  3U1C A;  1MZ9 A;  1A02 J;  1T8Z A;  2KP8 A;  4DOJ A;  4IFD K;  3SWF A;  1FZC A;  1FZG A;  4JYC A;  2KSJ A;  4C46 A;  1NTK K;  1L4A D;  1LGH B;  5AVU B;  3A2A A;  3BVH A;  4C7N A;  5BU5 A;  1G1J A;  2GUS A;  1GU4 A;  2WPQ A;  5AVW B;  4AUW A;  1FJP A;  2R5D A;  2Z4E A;  2HLO A;  3V2R A;  2XU6 A;  2OYI A;  1JY3 N;  1QL1 A;  3M0D A;  2POH A;  2Q5U A;  2HOD A;  3TNU B;  4I6M C;  1KIL A;  1JOC A;  1NKN A;  4LGD E;  1LTI C;  1LT9 A;  1LTJ C;  1SQV K;  5APX A;  2C0W A;  1IFI A;  1FZF A;  3HRN A;  2VRS A;  2YKQ A;  1GL2 B;  3EQ2 A;  1RF1 A;  1JNM A;  1J1D B;  1JY3 P;  3P8C E;  1NKZ B;  2YMY A;  2E42 A;  1YTZ T;  1M1J A;  5APT A;  5CJ4 A;  4WY4 A;  1LTT C;  2BAS A;  1RE3 A;  3HD7 A;  4HH2 A;  1S9K E;  1IJD B;  1VPC A;  3B5N C;  5AVY B;  3RK3 D;  1HBW A;  3VTP C;  1GL2 C;  1T3U A;  1J1D C;  2JJL A;  3RL0 B;  5KJ7 D;  1L0L K;  3V4W A;  5CCH D;  3M0A A;  1GD2 E;  5CCG A;  2WT7 A;  3GHG B;  2KLV A;  2CPS A;  2J58 A;  2P2U A;  3MGN A;  4XA4 A;  3L4F A;  1IK9 A;  2HG5 D;  4LLH A;  1SQX K;  2XZR A;  4N3Y B;  1DEB A;  3BRT B;  2NPS D;  3KYQ A;  4M3L A;  1FZC C;  3RL0 C;  4AYC A;  2FKW B;  1JO5 A;  1IC2 A;  3MIW A;  2OYI B;  3OJA B;  3CLQ A;  2HOD B;  3RK3 B;  1N7L A;  4GKG A;  1M7L A;  1WRG A;  2QM8 A;  1X9V A;  1HVV A;  3P8C D;  2W27 A;  4ZKP A;  2XKM A;  2OYH B;  1RF0 A;  4ZKU A;  3V5B A;  3SWY A;  1SFC B;  2WSE H;  1NO4 A;  5APV A;  2OYI C;  1JMM A;  3M0D C;  3TSI A;  1GZL A;  3VP9 A;  1T2K C;  1M1J B;  1N7S B;  2R5B A;  1H88 A;  4WY4 B;  1KIL C;  3PP5 A;  1LT9 C;  2I1K A;  2NPS B;  1URQ D;  5AVR B;  2R3C A;  5AW6 B;  4IFF A;  2IFN A;  3BRV B;  1J1E C;  3H6P A;  2IFM A;  1RF1 C;  4AQR D;  1L4A A;  2O01 H;  3L36 A;  2C9N Y;  1M1J C;  2CPB A;  3U1A A;  4WY4 C;  2N1T D;  2Q3I A;  1RE3 C;  3HD7 C;  1JTH B;  2WSC H;  1SQQ K;  1Z56 A;  4RES B;  1ZR4 A;  1HJB A;  5AVV B;  5APS A;  3M91 A;  1NOH A;  3V2Q A;  3OA7 A;  4JYB A;  3O8Z A;  1NH4 A;  2HPC B;  2FYZ A;  4W80 A;  2Q9I A;  3G3Z A;  4XE5 B;  1URQ B;  5CCG C;  2YKP A;  1QL2 A;  3MTU E;  3GHG A;  5CJ0 A;  2KB7 P;  1GW3 A;  1X79 B;  2W6A A;  5AW0 B;  2FFD A;  5APY A;  3CL3 D;  1SQB K;  1IFN A;  5AVZ B;  3RK2 D;  3VMZ A;  4LC1 A;  1GK4 A;  1FZB A;  1ZLL A;  3II6 A;  3M9H A;  1H8A A;  3V2P A;  1NAF A;  2C0X A;  3NXS A;  1HUC A;  1MFZ A;  1RF0 C;  1KFN A;  2HFE D;  4I2L C;  5KJ7 A;  2OYH A;  2M3B A;  3HE5 B;  1L4A B;  1NTZ K;  3VOP A;  5AW4 B;  1SFC A;  4N78 E;  3P8M C;  3HUS A;  1N7S A;  2NPS A;  1T3J A;  4B86 A;  5AW7 B;  1H89 A;  1L4A C;  4DZO A;  2E43 A;  1XTC C;  1FBM A;  2FXM A;  3BAT A;  1X8Y A;  2KYV A;  1L0N K;  2Q7C A;  1N86 A;  1IO4 A;  1JTH A;  3T97 A;  3C9I A;  1KZU B;  1EQ7 A;  2WPS A;  2GM4 A;  5CMZ A;  2FFD B;  1AFO A;  1T2K D;  1CI6 A;  3NTN A;  2HPC A;  1KIL D;  1JUN A;  1XTG B;  4N6J A;  1URQ A;  5AVT B;  1VDF A;  1LWU B;  3GHG C;  3U59 A;  2H7H A;  4N78 D;  1GW4 A;  4WBA A;  3E1I A;  5AW3 B;  2FFD C;  1IFM A;  2N1T A;  2OAR A;  3HD7 D;  5AW2 B;  2ZFC A;  1FZA A;  5CHX A;  1DH3 A;  2IPP A;  2M8R A;  3HUS B;  3RK3 C;  1G1I A;  3KQG A;  4OH8 B;  1YTZ I;  2L5G B;  1WT6 A;  1HTL C;  5KJ7 C;  3HE4 B;  2W6B A;  2OYH C;  2Z5H A;  3V4Q A;  2O1J A;  1LTJ A;  1SFC C;  3VYI A;  3HE5 A;  2P7J A;  3LID A;  5BU8 B;  1AQ5 A;  3HUS C;  1ZR2 A;  1N7S C;  1ZN5 A;  2WIT A;  2XDJ A;  3M9Q A;  1GTW A;  1NHL A;  1FAV A;  2NPS C;  2QM7 A;  3I5C A;  3HTK B;  3LIE A;  1NWQ A;  5AW5 B;  2MJZ A;  2P67 A;  1CI6 B;  3H32 B;  1W2E A;  5AVS B;  2YNY A;  1G2C A;  1N73 A;  3MD0 A;  4GIF A;  1HGV A;  3A5T A;  1LTB C;  1HH0 A;  4W7Z A;  5APW A;  5KTB A;  1KFM A;  1SLQ A;  4IFM A;  1ZV8 A;  1SP4 A;  2N1T B;  1GU5 A;  2XV5 A;  1FDM A;  1URQ C;  3EFG A;  5AW8 B;  2GUV A;  2IX7 C;  1LWU A;  3B5N D;  2ZXE B;  2H8P D;  1GL2 D;  3L37 A;  4EIJ A;  3IFM A;  2N1T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...