1IFNA

Two forms of pf1 inovirus: x-ray diffraction studies on a structural phase transition and a calculated libration normal mode of the asymmetric unit
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
46
structure length
46
Chain Sequence
b'GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOVIRUS
publication title Two Forms of Pf1 Inovirus: X-Ray Diffraction Studies on a Structural Phase Transition and a Calculated Libration Normal Mode of the Asymmetric Unit
pubmed rcsb
source organism Pseudomonas phage pf1
molecule tags Virus
total genus 21
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1994-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ifnA00
2KLVA 1QL1A 2XKMA 4IFMA 3IFMA 2IFMA 1PFIA 1QL2A 2IFNA 1ZN5A 2KSJA 1IFMA 1IFNA
chains in the Genus database with same CATH superfamily
1JUNA 1DD4A 2M5AB 1PL5A 3OAKA 2O1KA 2Z4EA 4AUWA 1IFPA 3KPEA 4W80A 1X0TA 2C9NY 2R32A 4OVNF 4H13D 2KNCA 2ZT9C 3AE6C 4XA4A 2YNYA 1OMIA 1PPJD 1W2EA 3GHGA 1PPJE 2E75C 2E76D 4UB8H 2OTJP 3L74G 1FZCA 2LXCB 5DJTB 1LWUA 2LR2A 1OW8A 5BU8B 1U7JA 4PV1C 1T3UA 3L70J 1M7LA 5CCHA 3W67A 4C46A 1S9KD 1FZFA 2NPSD 1S9KE 4IFDK 3RK3C 3D70A 3T97B 3Q5SA 1NVOA 3CCQP 4I7ZB 1NU1J 4U3FD 4ZKPA 4U3FE 3CPWO 2QJPB 1N7SA 2GM4A 2WWWA 3H1LG 5B5EH 3AEGC 3AE2C 2FYUK 2KIKA 2WSEJ 1LT9B 4HJGH 2YXQB 4C7NA 3V2QA 1NTKJ 1VF5D 2HODA 5GTIH 1YJNP 1CSBA 2HPCB 1KYOD 1T2KC 1L0NK 3GHGC 5H2FE 3PTZA 2WITA 1SQVK 1FZCC 1LWUC 2ZAEB 1AA0A 1KQFB 2NZ2A 1D7MA 1JY2O 3I5CA 1OZHA 5CCHC 2WPVB 2L91A 2V7QJ 2YKQA 2QE7H 2P58A 3MIWA 1JB0J 3R4YA 4BWNA 2WSCJ 1FZEA 2N1TD 1KILA 1PZQA 2QIWA 2AEJA 1M57D 3RK3E 4YXWH 2PAJA 3V6IA 1FDMA 1Y47A 1QL2A 4EIJA 3D6YA 3B4SA 2B9BA 1N7SC 2O1JA 2R5DA 5APUA 5KLVJ 5L8RJ 3V4QA 1HJBA 3UIAA 3TF5A 1Q90D 1YJ9P 2IBZD 5KLIB 2A45I 3KZIE 2IBZE 3NXSA 1T2KD 5APXA 1RF0A 1H88A 2MKVA 4N78D 2AXTH 5B66H 2FFDA 4N78E 3WMM0 3CCLP 4RO0A 2HFED 5KKZC 1SQXK 3L73D 5AVVB 3L73E 1SLQA 2IDBA 4BRYA 4H44C 1DEEG 2KYVA 2JKVA 2OYHA 2YO3A 1PFIA 1GW4A 1L4AA 1KILC 2A06E 2H89C 1JO5A 2BEZF 1YQ4C 5AVZB 3SWFA 2E76B 1BDDA 3TGUG 1CI6B 5KAFE 1AJYA 1L0LK 2OYIB 1VL2A 1BE3G 2XZRA 3SFDC 2QJYB 5APSA 3VP8A 1OVUA 1XTGB 3FWLA 3QWOC 2Z5HA 1G2CB 1URQD 4W7ZA 1IK9A 2Y0EA 1RF0C 2JR8A 2FFDC 1QVFO 3M0DA 3V2RA 2HR3A 1EDJA 1PGPA 2XNXA 1PP9G 2YKOA 3JCUE 2WMMA 4EOTA 1NGMB 1BGYJ 3AE3C 4A7PA 1JCCA 1NTME 1FE6A 1BSHA 1KB9D 1N86A 3L75D 2O01J 3S1KA 2K88A 5APQA 1KMIZ 1KB9E 3L75E 3HE4A 2OYHC 5AW9B 2ZT9B 4LLHA 1EQ7A 1VF5B 3L72G 2OARA 1S5LE 5H2FH 3HTKA 5M1BA 2E5YA 2H7HA 1EDKA 3GF3A 3C8VA 3CXHE 2E75B 2KZIA 1OVVA 2WVRA 3CWBD 4ASVA 1RE4A 3H1KD 3PH0A 1GW3A 3CWBE 4PV1B 1KFNA 1FJKA 3CC4P 2KB7P 4Y99C 4GOEA 3H1JJ 3AEAC 1SQPJ 3HE5B 1A02J 1HUCA 3AEBC 3G9RA 2I8DA 1VQ4P 4OH8B 2N9YB 3G4SP 2KP8A 3RK3B 1SQBD 4EI2A 3M0DC 1DH3A 2XKMA 4IFMA 1L0NG 3CI9A 5CBOA 1DIPA 1VPCA 2QRXA 5KTBA 1BCCG 3QH9A 1ZOYC 3KZIH 3V2NA 1IFNA 3RK2C 3CMEP 4GT1A 1KQSO 3WUVA 3Q5RA 4HB1A 2BCCJ 1AQ5A 3GHGB 1M90Q 2FY8A 1RE3A 1FDIA 4CPGA 3AE8C 1LNQA 2FXOA 3JC22 1FZCB 3L70E 1LWUB 1RE4C 3M91A 3WUTA 3M9BA 3BCCG 1UIIA 2B89A 5TJHA 1FDOA 2ZYAA 1EC5A 1NU1D 3USSA 1X8YA 1R5LA 2KK7A 1LTIC 1NU1E 3L71J 1NTZJ 2Q9IA 5KAFH 1FOSF 2JWDA 1SQQG 1Q7YQ 3C9IA 1EZVG 4NPDA 1N7SB 3VMYA 5BU5A 1NTKD 3B8EB 1NTKE 1YTZI 4AYCA 5EFWB 2E5TA 1K05A 4C7NB 2K9YA 4PD4D 2QVAA 2HODB 4PD4E 1GMJA 1AFOA 3JCUH 1K73Q 1RE3C 2Z5IA 2WSFJ 1KQLA 4UB6E 3EFGA 5KKZB 1EXJA 2J5UA 3RBXA 3RL0C 3D71A 1PPJG 1KB9H 1H8AA 1DX7A 1N7LA 3CC2P 1IK7A 1S5LH 1VQLP 2WPSA 1X22A 4U7JA 1KILB 2QJKC 3CXHH 2GUVA 3CX5I 3H1IJ 2ZJSE 1JTHA 3HRNA 5KLVD 1LTJA 5C39A 5KLVE 4HH2A 3RBZA 2YKPA 1HTLC 3TGUJ 1HF9A 5BVZA 2L5GB 3MHVA 2QEXP 5AW5B 3P32A 4U3FG 1RF1A 2D2CC 1RH5B 4D6TJ 1JY3N 5AVSB 1IJDB 1YHQP 3P8MC 4ASWA 1IZNB 2Y0DA 1E79H 2PRRA 4EYYQ 1J1DC 2IZ1A 1KZUB 4PJ0E 2FFDB 2WSSH 4RESB 3CMAP 3HUSA 3LIDA 1Q2NA 3M9QA 1SQBK 3RL0D 4C7RA 3AEDC 4IFFA 1KD1Q 4WVZA 2FXMA 2OYHB 2YMKA 2FXPA 2KZJA 1VQ5P 2JWAA 1HGVA 4GIFA 1M1KQ 3C1LA 1N73A 1LTJC 1EXIA 1EDLA 3CCJP 2J58A 2LKMA 1JMMA 2XU6A 3H1HJ 1LTBC 1HWTC 1MFTA 4Y99B 3CLQA 2D2CD 1RF1C 3P8CD 2Q7CA 1Y8AA 3VOPA 1M1JA 3P8CE 3AE7C 2HYNA 1XTCC 2FYUJ 1BGYD 4DCKA 1VDFA 1BGYE 3HUSC 2WT7A 3NFQA 2ZT9D 2WSEH 5KJ7A 2IBZG 1BSNA 5AW0B 3CCUP 1L0NJ 4L76A 4NPFX 2POHA 2E43A 2E75D 1YYCA 1W2BO 1SQVJ 3RL0g 1KN7A 3KQGA 3H32A 4PD4H 3HE4B 4JF7A 3U59A 3RK2B 1RY3A 4PV1D 2R5BA 5DJUB 1BCCJ 3HTKB 3VMXA 3L73G 1QVGO 4UB6H 3IFMA 2Q1KA 3F89A 1N73C 1Q81Q 3ITKA 4GDOA 4TLFA 2V7QH 3H1JD 1Z56A 1FU1A 2I1KA 3RK3D 2W8ZA 3H1JE 1SQPD 2WSCH 3IN6A 1SQPE 1FZBA 2YO2A 3Q1MA 1EDIA 1M56D 2KSJA 4IL6X 3O6QA 1K8AQ 3U1AA 1M1JC 5CHXA 2FBWC 4H0LC 1GL2A 3CCMP 1T3JA 2PFXA 4WB4A 4RKUJ 1VQ9P 2H43A 5KJ7C 2QM8A 3WU2E 3PRJA 3V2PA 1SQQK 4B86A 2PGDA 2IX7C 1LT1A 1EZVI 2BCCD 2M0BA 2BCCE 1J1EB 5KAIE 4GKGA 1USDA 1GK6A 4I1LA 3SSUA 1SQXJ 2SPZA 3MGNA 4PJ0H 3TYYA 2RKLA 5CCHD 5CCGA 1OWAA 4OGQC 3ABVC 3L75G 3M06A 3L37A 1U57A 5AVTB 2A06D 2CK3H 1ZN5A 3RL0B 2DW3A 1QL1A 3PP5A 3L71D 1NTZD 1LTSC 3L71E 1NTZE 3CL3D 1N7SD 1ZLLA 1L0LJ 2WTYA 1FS0E 3CWBG 1HGZA 3H1KG 2GUSA 2QJKB 4H0LD 1NYHA 1GL2C 1FC2C 1GD2E 1JMBA 1G1JA 5APTA 3GG2A 2KLUA 2N9BA 1JY3P 1GZLA 1SQBG 3AE9C 1CW5A 2ZVOB 2J59M 2D2CB 1NTMD 3OJAB 1SP4A 3U1CA 2C9LY 4YXDC 4DZOA 3TNUA 1J1DB 3LIEA 5AW7B 5CCGC 4H44D 1NKNA 1S2EA 2O01H 3SFEC 2M3BA 1KILD 3BRTB 1L4AC 2IFNA 1ZRTE 1LP1A 1KILE 1QEXA 1U7MA 1KQGB 3CXHD 1YI2P 1P84D 3OW2O 3G71P 1KYOI 2OGUA 1P84E 3H1ID 3CX5E 3AECC 3AE4C 3TK1A 3H1IE 4EDFA 4QMAA 3B71A 3L74J 1VQPP 3IAOA 1SFCA 1JTHB 1GU4A 1LTJB 3TGUE 4LC1A 1LTAC 1NAFA 1NU1G 3A2AA 1ZMEC 4D6TD 1JOCA 3A0BE 4D6TE 3NMDA 3GMAA 1MKMA 1RF1B 2QG4A 1YIJP 4ZNCA 1NTKG 1OFCX 5CCGD 3VMAA 1IC2A 3WU2H 3H1LJ 3HUSB 2KNCB 2QA4P 1SVFA 1L4AD 2JO1A 4WY4A 2I1JA 1LTTC 4L75A 5AW8B 2KOGA 2JP3A 5KAIH 1HVVA 2IBZI 1X9VA 5K5GB 3L70D 2Q3EA 1S5LX 2CPSA 4K3AA 4KT0J 1H89A 4M3LA 2YXRB 2JJLA 3E1RA 1J2JB 1OW6A 1SFCC 4W7YA 3CCRP 1N73B 1YQ3C 3H1HD 1AVYA 4R4MA 1FAVA 3H1HE 2RN0A 3M0AA 3E1IA 2UWJE 5APYA 5KLVG 1Q82Q 5AVXB 2C0WA 2YIUC 2FYUD 1YTZT 1YJWP 5AW4B 1DEBA 2HLOA 2FYUE 1M1JB 2KSEA 4H0LB 1VQ7P 2P2UA 4DJGA 3MD0A 1JM0A 3RK2D 3Q5PA 3CCEP 1L0NE 3H25A 1SQVD 4WY4C 2NPSA 2R3CA 1VQMP 1SQVE 1R5SA 1QX8A 2Y9YA 2ZXXA 1KV4A 3A0HE 5TISE 3H32B 5AVWB 1BCCE 4HKZH 3M9HA 2WSFH 4L74A 3EFFK 3MTUE 3LW5J 1ZP0C 5CJ0A 4OGQB 1NTMK 4H44B 4H13C 3D6ZA 1A02F 1RQVA 3KYQA 1KB9I 1JEKA 2K3RA 1P84H 1IFDA 3CX5H 2Q3IA 3O6QB 4XFJA 2JDIH 1FZGA 1MZ9A 3ZDMA 2ZXEB 2ZYGA 3MUDA 3A3YB 2BASA 1GL2B 3H1KJ 3A7OA 3HE5A 5AW3B 2NPSC 1GDTA 2JEEA 3A0BH 3FXDA 1BE3J 4N3YB 5GTHE 2E74C 3I56P 2N1TA 3GW6A 1OVRA 1NO4A 4LGDE 1SQXD 4ZMDA 1BGYG 1SQXE 1SQBJ 2ZYDA 3TDKA 1PP9J 2W27A 1MV8A 4I6MC 4BRYB 1T8ZA 3IR9A 2VRSA 2K37A 2W6JH 1VF5C 2NRGA 3HD7A 1L4AB 3AE5C 3RGUA 1FJPA 1L0LD 5AVUB 2Y0CA 3L72J 1L0LE 3FXEA 1LGHB 2AXCA 1YBKA 3SWYA 2Q5UA 1RHZB 4WBAA 3AEFC 1ZV8A 3CC7P 3Q3DA 3H1JG 1NWQA 3MP7B 1SQPG 3S4RA 3MUDC 1JY3O 2KLVA 2IPPA 1QLED 1JY2N 3AE1C 3F5HA 2B88A 2WZ7A 4IL6E 3N4XA 1N2DC 2E74D 1S72P 2N1TC 1NH4A 2CPBA 4AQRD 1Y9BA 2W6BA 1NU1K 1PIXA 2K9JA 2FYNC 3E7KA 1VQKP 1H0TA 3VP9A 1FOSE 1CZQA 4GODA 3TNUB 2H88C 1MUUA 1HBWA 2BCCG 1VQ6P 2WQYC 3B5NA 1NTKK 3HD7C 1VQOP 1Q86Q 4BXLA 1NAYA 1LP1B 1URQA 1KYOE 3A0HH 5TISH 1NJIQ 2H8PD 1JCDA 2B87A 4PD4I 1YITP 3CCSP 3L74D 3L74E 4YPCA 1PV3A 2C0XA 2A06G 3JSVC 4HYTB 3FWNA 1ZR2A 3S9OA 3I55P 2K1AA 1SFCB 5CMZA 1S4XA 3L71G 1NTZG 3BCCJ 3KHUA 2KS1A 3N7NA 4R4LA 1KORA 2YIUB 4OWFA 3P7KA 2A45H 2ITAA 1AVOA 3H1LD 4JQ0D 4RJTA 3EQ2A 2Q6QA 1SQQJ 5KLVK 3H1LE 3SWKA 3BATA 3V5BA 1K04A 5CBNA 5GTHH 1LJ2A 1OXZA 1KFMA 3B5NC 3HD7D 4WY4B 1NTMG 2M5AA 1PGJA 1URQC 2FYZA 2AEMA 5AW6B 2V4HA 3OA7A 2G3AA 1USEA 1AQTA 1G1IA 3PHLA 1KC8Q 2R3SA 2P1JA 5E79E 4KHXA 1WT6A 4Z1MH 2IFMA 1KTMA 1M8OB 2WPRA 3G3ZA 4H13B 3GLMA 3H1IG 1RQUA 3VTPC 2ZVNB 3KDPB 4JYBA 2QM7A 1IFJA 2G8YA 2Y9ZA 5KJ7D 2OQQA 1WMKA 1DD3A 1JNMA 3T97A 4D6TG 4DT0A 1OX3A 4IL6H 1R8EA 1UIXA 2KI7B 3B5ND 2AEFA 1S1CX 3FX0A 3L36A 1VQ8P 2NPSB 4WWIA 1L2PA 3NTNA 4U3FJ 2E74B 2XV5A 1IFMA 2R44A 4OGQD 2W83C 1ZXGA 4DOJA 1LT9A 1ZRTD 2YMYA 2HPCA 3R2PA 3PLNA 5AVRB 3BRVB 2RH0A 3GF7A 3CX5D 2RMZA 3L70G 2PP6A 1KYOH 2O3JA 3II6A 1TU3F 1MFZA 1GL2D 1FBMA 3TGUD 3EWKA 2IZ0A 1JY2P 3H1HG 3WUUA 3VYIA 3Q2YA 1ZR4A 2KUBA 2W90A 3H1KE 4I7ZC 1BE3D 1OIPA 1WRGA 1BE3E 3BASA 1GU5A 3V4WA 4I2LC 1QGKB 2QJPC 3L4FA 5AVYB 1SQPK 2FYUG 3G6EP 2P67A 1LTGC 1S3JA 2N1TB 4NPEA 2LXBA 2BEQD 1PGQA 2P10A 1SQBE 1LT9C 5AW2B 3O8ZA 1PP9D 2FYNB 3TSIA 1PP9E 1SQVG 3BVHA 2FKWB 2XDJA 4IOIH 4YTPC 3VN0A 1T6AA 3FGAD 5AW1B 1K9MQ 4KJMA 3VMZA 3L72D 3HD7B 4UB8E 3L72E 4MN4C 2XNDH 3L73J 5E79H 4ZKUA 2IYOA 3K5BA 4K35A 2E42A 2HG5D 1W5CE 3IF4A 3MZWB 5APVA 4N6JA 3H6PA 1IO4A 1CI6A 1GK4A 4JYCA 5APWA 1NHLA 1NKZB 2OYIA 1NTZK 2A45G 2M8RA 2OTKE 5B5EE 1L0ND 4JBZA 3PJSK 2OTLP 2K9JB 2WT7B 2P7JA 1G2CA 5KLIC 1H0TB 3CCVP 5GTIE 2WPQA 2QSIA 2KXPB 1BCCD 1FZAA 1SQXG 3KXDA 1J1EC 1NOHA 3B5NB 1ZW0A 1AV1A 1URQB 1OW7A 1X79B 1SFCD 4O9BA 4GOFA 2B87B 2IYPA 1NTMJ 3LW5H 5AVQB 1N8RQ 1GTWA 3L75J 1PGOA 3BCCD 4L73A 3BCCE 1L0LG 4XE5B 1IFIA 1VQNP 2E76C 2M3EA 3W68A 3L35A 2O01N 2W6AA 2MJZA 3CXHI 1SS1A 2OYIC 3CD6P 1P84I 5CJ4A 2KS1B 3CWBJ 2QJYC 1HH0A 4TT3H 1SQQD 4WY4D 1EZVD 1SQQE 2OYOA 2ZFCA 4Y28J 1EZVE 2GA1A 3A5TA 3AEEC 1HJ0A 1BDCA 2AXTE 5B66E 4JPZB 1E5WA
chains in the Genus database with same CATH topology
1JUNA 3OJAB 1SFCB 5CMZA 1SP4A 3U1CA 3OAKA 2C9LY 4DZOA 2O1KA 3TNUA 2Z4EA 4AUWA 1J1DB 3LIEA 5AW7B 1X8YA 3KPEA 4W80A 5CCGC 1LTIC 1NKNA 2C9NY 2R32A 2O01H 4XA4A 2Q9IA 2M3BA 1KILD 3BRTB 1L4AC 2IFNA 1FOSF 2YNYA 3N7NA 1W2EA 3GHGA 3C9IA 3P7KA 1N7SB 2A45H 3VMYA 5BU5A 3EQ2A 3B8EB 5KLVK 1FZCA 3BATA 3V5BA 1YTZI 4AYCA 1LWUA 3TK1A 5BU8B 1T3UA 4C7NB 1OXZA 1KFMA 3B5NC 3HD7D 2HODB 1M7LA 4WY4B 1SFCA 5CCHA 1URQC 1JTHB 2FYZA 1GU4A 1AFOA 4C46A 1S9KD 1FZFA 1LTJB 2NPSD 4LC1A 5AW6B 1LTAC 3OA7A 1NAFA 1RE3C 1S9KE 2Z5IA 1KQLA 3A2AA 1G1IA 4IFDK 3RK3C 1JOCA 3NMDA 3EFGA 2P1JA 4ZKPA 3RL0C 4KHXA 1RF1B 1WT6A 2IFMA 1H8AA 1DX7A 1N7LA 1N7SA 2GM4A 2WWWA 2WPRA 3G3ZA 2WPSA 5CCGD 2FYUK 1IC2A 1KILB 3VTPC 1LT9B 3HUSB 4C7NA 3V2QA 3KDPB 2HODA 2GUVA 1SVFA 1L4AD 4JYBA 2QM7A 4WY4A 1CSBA 1IFJA 2I1JA 2HPCB 1LTTC 1JTHA 3HRNA 5AW8B 1T2KC 1L0NK 1LTJA 3GHGC 5KJ7D 2KOGA 4HH2A 2WITA 1SQVK 1JNMA 2YKPA 1HVVA 1X9VA 1HTLC 3T97A 1FZCC 1LWUC 2CPSA 5BVZA 2L5GB 5AW5B 3P32A 1H89A 4M3LA 1RF1A 3B5ND 2JJLA 1JY3N 5AVSB 1IJDB 3L36A 3P8MC 1J2JB 1JY2O 1SFCC 2NPSB 3I5CA 5CCHC 4W7YA 3NTNA 2XV5A 1N73B 2YKQA 1J1DC 1IFMA 1KZUB 3MIWA 1FAVA 2FFDB 1FZEA 2N1TD 4RESB 1KILA 4DOJA 1LT9A 3HUSA 3LIDA 3M0AA 2PAJA 3M9QA 2YMYA 1SQBK 3R2PA 2HPCA 3RL0D 3E1IA 1FDMA 1QL2A 5APYA 5AVXB 2C0WA 5AVRB 4C7RA 4EIJA 1YTZT 3BRVB 4IFFA 1N7SC 2O1JA 1DEBA 2HLOA 2R5DA 5AW4B 1M1JB 5APUA 2FXMA 2OYHB 2PP6A 3V4QA 1HJBA 3II6A 2P2UA 3UIAA 3MD0A 3RK2D 1HGVA 1MFZA 4WY4C 1GL2D 2NPSA 2R3CA 2A45I 1FBMA 4GIFA 3NXSA 1T2KD 1N73A 5APXA 1RF0A 1H88A 1LTJC 4N78D 1JY2P 2FFDA 3VYIA 4N78E 2J58A 3WMM0 1ZR4A 3H32B 5AVWB 3M9HA 2LKMA 2WSFH 1JMMA 2XU6A 2HFED 1LTBC 1HWTC 4Y99B 3CLQA 3MTUE 1WRGA 3BASA 1SQXK 1GU5A 3V4WA 1RF1C 4I2LC 3L4FA 5AVVB 5AVYB 1SLQA 1SQPK 3P8CD 2Q7CA 3VOPA 1M1JA 5CJ0A 2P67A 1NTMK 3P8CE 1LTGC 2N1TB 2KYVA 2OYHA 2YO3A 2HYNA 1XTCC 1PFIA 1A02F 1GW4A 1L4AA 1KILC 1LT9C 1VDFA 5AW2B 3O8ZA 3HUSC 2WT7A 3KYQA 3NFQA 3TSIA 2WSEH 1JO5A 5KJ7A 3BVHA 1IFDA 5AVZB 2FKWB 5AW0B 3SWFA 2Q3IA 2E43A 2POHA 2XDJA 1CI6B 1YYCA 1L0LK 1FZGA 3VN0A 1MZ9A 3KQGA 3H32A 2ZXEB 5AW1B 2OYIB 3HE4B 3VMZA 4JF7A 3U59A 3RK2B 1RY3A 3MUDA 3HD7B 2XZRA 3A3YB 2R5BA 2BASA 1GL2B 5APSA 3VP8A 3HTKB 3VMXA 3A7OA 1XTGB 3HE5A 2Z5HA 1G2CB 5AW3B 2NPSC 1GDTA 2JEEA 4N3YB 1URQD 3IFMA 4W7ZA 1IK9A 1N73C 2N1TA 1RF0C 1NO4A 4LGDE 2FFDC 4ZKUA 1Z56A 3M0DA 3V2RA 1FU1A 2I1KA 3RK3D 2XNXA 2YKOA 2E42A 2WSCH 2HG5D 4EOTA 1FZBA 2YO2A 5APVA 4N6JA 3H6PA 1JCCA 1IO4A 2KSJA 2W27A 1CI6A 1GK4A 4JYCA 3U1AA 5APWA 1MV8A 1M1JC 1N86A 4I6MC 5APQA 1NHLA 1T8ZA 1NKZB 2OYIA 3IR9A 3HE4A 5CHXA 1NTZK 2OYHC 2A45G 2M8RA 5AW9B 2VRSA 4LLHA 1EQ7A 3HD7A 2OARA 1L4AB 1GL2A 1T3JA 3HTKA 2WT7B 4WB4A 1FJPA 2H43A 2H7HA 2P7JA 1G2CA 5KJ7C 5AVUB 2QM8A 3V2PA 1LGHB 2WPQA 1SQQK 4B86A 3SWYA 2Q5UA 4WBAA 1FZAA 1ZV8A 2IX7C 1RE4A 1NWQA 1GW3A 1KFNA 1J1EC 1NOHA 1FJKA 1J1EB 3B5NB 4GKGA 2KB7P 4Y99C 1JY3O 2KLVA 2IPPA 1GK6A 4I1LA 3MGNA 1URQB 3TYYA 1JY2N 1X79B 2WZ7A 1SFCD 3HE5B 1HUCA 1A02J 4O9BA 5CCHD 3N4XA 1N2DC 5CCGA 1OWAA 3LW5H 3M06A 3L37A 4OH8B 2N1TC 1NH4A 5AVQB 5AVTB 2CPBA 4AQRD 2KP8A 3RK3B 2W6BA 1NU1K 3M0DC 1DH3A 2XKMA 4IFMA 1GTWA 1ZN5A 3RL0B 1QL1A 3CI9A 4XE5B 3PP5A 3VP9A 1IFIA 1FOSE 1CZQA 1LTSC 1VPCA 3L35A 3TNUB 2W6AA 3CL3D 1N7SD 1ZLLA 2WTYA 2MJZA 1HGZA 5KTBA 1MUUA 2GUSA 2OYIC 1HBWA 3V2NA 1IFNA 3RK2C 3B5NA 1NTKK 3HD7C 5CJ4A 4GT1A 1GL2C 1HH0A 1GD2E 1URQA 1G1JA 5APTA 1AQ5A 4WY4D 3GHGB 2ZFCA 2H8PD 2N9BA 1JCDA 1JY3P 1RE3A 3A5TA 1GZLA 1FZCB 1LWUB 2C0XA 1RE4C 1CW5A 4HYTB 3M91A 2J59M 3M9BA 1ZR2A 1E5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLV A;  1QL1 A;  2XKM A;  4IFM A;  3IFM A;  2IFM A;  1PFI A;  1QL2 A;  2IFN A;  1ZN5 A;  2KSJ A;  1IFM A;  1IFN A; 
#chains in the Genus database with same CATH topology
 1JUN A;  1DD4 A;  2M5A B;  1PL5 A;  3OAK A;  2O1K A;  2Z4E A;  4AUW A;  1IFP A;  3KPE A;  4W80 A;  1X0T A;  2C9N Y;  2R32 A;  4OVN F;  4H13 D;  2KNC A;  2ZT9 C;  3AE6 C;  4XA4 A;  2YNY A;  1OMI A;  1PPJ D;  1W2E A;  3GHG A;  1PPJ E;  2E75 C;  2E76 D;  4UB8 H;  2OTJ P;  3L74 G;  1FZC A;  2LXC B;  5DJT B;  1LWU A;  2LR2 A;  1OW8 A;  5BU8 B;  1U7J A;  4PV1 C;  1T3U A;  3L70 J;  1M7L A;  5CCH A;  3W67 A;  4C46 A;  1S9K D;  1FZF A;  2NPS D;  1S9K E;  4IFD K;  3RK3 C;  3D70 A;  3T97 B;  3Q5S A;  1NVO A;  3CCQ P;  4I7Z B;  1NU1 J;  4U3F D;  4ZKP A;  4U3F E;  3CPW O;  2QJP B;  1N7S A;  2GM4 A;  2WWW A;  3H1L G;  5B5E H;  3AEG C;  3AE2 C;  2FYU K;  2KIK A;  2WSE J;  1LT9 B;  4HJG H;  2YXQ B;  4C7N A;  3V2Q A;  1NTK J;  1VF5 D;  2HOD A;  5GTI H;  1YJN P;  1CSB A;  2HPC B;  1KYO D;  1T2K C;  1L0N K;  3GHG C;  5H2F E;  3PTZ A;  2WIT A;  1SQV K;  1FZC C;  1LWU C;  2ZAE B;  1AA0 A;  1KQF B;  2NZ2 A;  1D7M A;  1JY2 O;  3I5C A;  1OZH A;  5CCH C;  2WPV B;  2L91 A;  2V7Q J;  2YKQ A;  2QE7 H;  2P58 A;  3MIW A;  1JB0 J;  3R4Y A;  4BWN A;  2WSC J;  1FZE A;  2N1T D;  1KIL A;  1PZQ A;  2QIW A;  2AEJ A;  1M57 D;  3RK3 E;  4YXW H;  2PAJ A;  3V6I A;  1FDM A;  1Y47 A;  1QL2 A;  4EIJ A;  3D6Y A;  3B4S A;  2B9B A;  1N7S C;  2O1J A;  2R5D A;  5APU A;  5KLV J;  5L8R J;  3V4Q A;  1HJB A;  3UIA A;  3TF5 A;  1Q90 D;  1YJ9 P;  2IBZ D;  5KLI B;  2A45 I;  3KZI E;  2IBZ E;  3NXS A;  1T2K D;  5APX A;  1RF0 A;  1H88 A;  2MKV A;  4N78 D;  2AXT H;  5B66 H;  2FFD A;  4N78 E;  3WMM 0;  3CCL P;  4RO0 A;  2HFE D;  5KKZ C;  1SQX K;  3L73 D;  5AVV B;  3L73 E;  1SLQ A;  2IDB A;  4BRY A;  4H44 C;  1DEE G;  2KYV A;  2JKV A;  2OYH A;  2YO3 A;  1PFI A;  1GW4 A;  1L4A A;  1KIL C;  2A06 E;  2H89 C;  1JO5 A;  2BEZ F;  1YQ4 C;  5AVZ B;  3SWF A;  2E76 B;  1BDD A;  3TGU G;  1CI6 B;  5KAF E;  1AJY A;  1L0L K;  2OYI B;  1VL2 A;  1BE3 G;  2XZR A;  3SFD C;  2QJY B;  5APS A;  3VP8 A;  1OVU A;  1XTG B;  3FWL A;  3QWO C;  2Z5H A;  1G2C B;  1URQ D;  4W7Z A;  1IK9 A;  2Y0E A;  1RF0 C;  2JR8 A;  2FFD C;  1QVF O;  3M0D A;  3V2R A;  2HR3 A;  1EDJ A;  1PGP A;  2XNX A;  1PP9 G;  2YKO A;  3JCU E;  2WMM A;  4EOT A;  1NGM B;  1BGY J;  3AE3 C;  4A7P A;  1JCC A;  1NTM E;  1FE6 A;  1BSH A;  1KB9 D;  1N86 A;  3L75 D;  2O01 J;  3S1K A;  2K88 A;  5APQ A;  1KMI Z;  1KB9 E;  3L75 E;  3HE4 A;  2OYH C;  5AW9 B;  2ZT9 B;  4LLH A;  1EQ7 A;  1VF5 B;  3L72 G;  2OAR A;  1S5L E;  5H2F H;  3HTK A;  5M1B A;  2E5Y A;  2H7H A;  1EDK A;  3GF3 A;  3C8V A;  3CXH E;  2E75 B;  2KZI A;  1OVV A;  2WVR A;  3CWB D;  4ASV A;  1RE4 A;  3H1K D;  3PH0 A;  1GW3 A;  3CWB E;  4PV1 B;  1KFN A;  1FJK A;  3CC4 P;  2KB7 P;  4Y99 C;  4GOE A;  3H1J J;  3AEA C;  1SQP J;  3HE5 B;  1A02 J;  1HUC A;  3AEB C;  3G9R A;  2I8D A;  1VQ4 P;  4OH8 B;  2N9Y B;  3G4S P;  2KP8 A;  3RK3 B;  1SQB D;  4EI2 A;  3M0D C;  1DH3 A;  2XKM A;  4IFM A;  1L0N G;  3CI9 A;  5CBO A;  1DIP A;  1VPC A;  2QRX A;  5KTB A;  1BCC G;  3QH9 A;  1ZOY C;  3KZI H;  3V2N A;  1IFN A;  3RK2 C;  3CME P;  4GT1 A;  1KQS O;  3WUV A;  3Q5R A;  4HB1 A;  2BCC J;  1AQ5 A;  3GHG B;  1M90 Q;  2FY8 A;  1RE3 A;  1FDI A;  4CPG A;  3AE8 C;  1LNQ A;  2FXO A;  3JC2 2;  1FZC B;  3L70 E;  1LWU B;  1RE4 C;  3M91 A;  3WUT A;  3M9B A;  3BCC G;  1UII A;  2B89 A;  5TJH A;  1FDO A;  2ZYA A;  1EC5 A;  1NU1 D;  3USS A;  1X8Y A;  1R5L A;  2KK7 A;  1LTI C;  1NU1 E;  3L71 J;  1NTZ J;  2Q9I A;  5KAF H;  1FOS F;  2JWD A;  1SQQ G;  1Q7Y Q;  3C9I A;  1EZV G;  4NPD A;  1N7S B;  3VMY A;  5BU5 A;  1NTK D;  3B8E B;  1NTK E;  1YTZ I;  4AYC A;  5EFW B;  2E5T A;  1K05 A;  4C7N B;  2K9Y A;  4PD4 D;  2QVA A;  2HOD B;  4PD4 E;  1GMJ A;  1AFO A;  3JCU H;  1K73 Q;  1RE3 C;  2Z5I A;  2WSF J;  1KQL A;  4UB6 E;  3EFG A;  5KKZ B;  1EXJ A;  2J5U A;  3RBX A;  3RL0 C;  3D71 A;  1PPJ G;  1KB9 H;  1H8A A;  1DX7 A;  1N7L A;  3CC2 P;  1IK7 A;  1S5L H;  1VQL P;  2WPS A;  1X22 A;  4U7J A;  1KIL B;  2QJK C;  3CXH H;  2GUV A;  3CX5 I;  3H1I J;  2ZJS E;  1JTH A;  3HRN A;  5KLV D;  1LTJ A;  5C39 A;  5KLV E;  4HH2 A;  3RBZ A;  2YKP A;  1HTL C;  3TGU J;  1HF9 A;  5BVZ A;  2L5G B;  3MHV A;  2QEX P;  5AW5 B;  3P32 A;  4U3F G;  1RF1 A;  2D2C C;  1RH5 B;  4D6T J;  1JY3 N;  5AVS B;  1IJD B;  1YHQ P;  3P8M C;  4ASW A;  1IZN B;  2Y0D A;  1E79 H;  2PRR A;  4EYY Q;  1J1D C;  2IZ1 A;  1KZU B;  4PJ0 E;  2FFD B;  2WSS H;  4RES B;  3CMA P;  3HUS A;  3LID A;  1Q2N A;  3M9Q A;  1SQB K;  3RL0 D;  4C7R A;  3AED C;  4IFF A;  1KD1 Q;  4WVZ A;  2FXM A;  2OYH B;  2YMK A;  2FXP A;  2KZJ A;  1VQ5 P;  2JWA A;  1HGV A;  4GIF A;  1M1K Q;  3C1L A;  1N73 A;  1LTJ C;  1EXI A;  1EDL A;  3CCJ P;  2J58 A;  2LKM A;  1JMM A;  2XU6 A;  3H1H J;  1LTB C;  1HWT C;  1MFT A;  4Y99 B;  3CLQ A;  2D2C D;  1RF1 C;  3P8C D;  2Q7C A;  1Y8A A;  3VOP A;  1M1J A;  3P8C E;  3AE7 C;  2HYN A;  1XTC C;  2FYU J;  1BGY D;  4DCK A;  1VDF A;  1BGY E;  3HUS C;  2WT7 A;  3NFQ A;  2ZT9 D;  2WSE H;  5KJ7 A;  2IBZ G;  1BSN A;  5AW0 B;  3CCU P;  1L0N J;  4L76 A;  4NPF X;  2POH A;  2E43 A;  2E75 D;  1YYC A;  1W2B O;  1SQV J;  3RL0 g;  1KN7 A;  3KQG A;  3H32 A;  4PD4 H;  3HE4 B;  4JF7 A;  3U59 A;  3RK2 B;  1RY3 A;  4PV1 D;  2R5B A;  5DJU B;  1BCC J;  3HTK B;  3VMX A;  3L73 G;  1QVG O;  4UB6 H;  3IFM A;  2Q1K A;  3F89 A;  1N73 C;  1Q81 Q;  3ITK A;  4GDO A;  4TLF A;  2V7Q H;  3H1J D;  1Z56 A;  1FU1 A;  2I1K A;  3RK3 D;  2W8Z A;  3H1J E;  1SQP D;  2WSC H;  3IN6 A;  1SQP E;  1FZB A;  2YO2 A;  3Q1M A;  1EDI A;  1M56 D;  2KSJ A;  4IL6 X;  3O6Q A;  1K8A Q;  3U1A A;  1M1J C;  5CHX A;  2FBW C;  4H0L C;  1GL2 A;  3CCM P;  1T3J A;  2PFX A;  4WB4 A;  4RKU J;  1VQ9 P;  2H43 A;  5KJ7 C;  2QM8 A;  3WU2 E;  3PRJ A;  3V2P A;  1SQQ K;  4B86 A;  2PGD A;  2IX7 C;  1LT1 A;  1EZV I;  2BCC D;  2M0B A;  2BCC E;  1J1E B;  5KAI E;  4GKG A;  1USD A;  1GK6 A;  4I1L A;  3SSU A;  1SQX J;  2SPZ A;  3MGN A;  4PJ0 H;  3TYY A;  2RKL A;  5CCH D;  5CCG A;  1OWA A;  4OGQ C;  3ABV C;  3L75 G;  3M06 A;  3L37 A;  1U57 A;  5AVT B;  2A06 D;  2CK3 H;  1ZN5 A;  3RL0 B;  2DW3 A;  1QL1 A;  3PP5 A;  3L71 D;  1NTZ D;  1LTS C;  3L71 E;  1NTZ E;  3CL3 D;  1N7S D;  1ZLL A;  1L0L J;  2WTY A;  1FS0 E;  3CWB G;  1HGZ A;  3H1K G;  2GUS A;  2QJK B;  4H0L D;  1NYH A;  1GL2 C;  1FC2 C;  1GD2 E;  1JMB A;  1G1J A;  5APT A;  3GG2 A;  2KLU A;  2N9B A;  1JY3 P;  1GZL A;  1SQB G;  3AE9 C;  1CW5 A;  2ZVO B;  2J59 M;  2D2C B;  1NTM D;  3OJA B;  1SP4 A;  3U1C A;  2C9L Y;  4YXD C;  4DZO A;  3TNU A;  1J1D B;  3LIE A;  5AW7 B;  5CCG C;  4H44 D;  1NKN A;  1S2E A;  2O01 H;  3SFE C;  2M3B A;  1KIL D;  3BRT B;  1L4A C;  2IFN A;  1ZRT E;  1LP1 A;  1KIL E;  1QEX A;  1U7M A;  1KQG B;  3CXH D;  1YI2 P;  1P84 D;  3OW2 O;  3G71 P;  1KYO I;  2OGU A;  1P84 E;  3H1I D;  3CX5 E;  3AEC C;  3AE4 C;  3TK1 A;  3H1I E;  4EDF A;  4QMA A;  3B71 A;  3L74 J;  1VQP P;  3IAO A;  1SFC A;  1JTH B;  1GU4 A;  1LTJ B;  3TGU E;  4LC1 A;  1LTA C;  1NAF A;  1NU1 G;  3A2A A;  1ZME C;  4D6T D;  1JOC A;  3A0B E;  4D6T E;  3NMD A;  3GMA A;  1MKM A;  1RF1 B;  2QG4 A;  1YIJ P;  4ZNC A;  1NTK G;  1OFC X;  5CCG D;  3VMA A;  1IC2 A;  3WU2 H;  3H1L J;  3HUS B;  2KNC B;  2QA4 P;  1SVF A;  1L4A D;  2JO1 A;  4WY4 A;  2I1J A;  1LTT C;  4L75 A;  5AW8 B;  2KOG A;  2JP3 A;  5KAI H;  1HVV A;  2IBZ I;  1X9V A;  5K5G B;  3L70 D;  2Q3E A;  1S5L X;  2CPS A;  4K3A A;  4KT0 J;  1H89 A;  4M3L A;  2YXR B;  2JJL A;  3E1R A;  1J2J B;  1OW6 A;  1SFC C;  4W7Y A;  3CCR P;  1N73 B;  1YQ3 C;  3H1H D;  1AVY A;  4R4M A;  1FAV A;  3H1H E;  2RN0 A;  3M0A A;  3E1I A;  2UWJ E;  5APY A;  5KLV G;  1Q82 Q;  5AVX B;  2C0W A;  2YIU C;  2FYU D;  1YTZ T;  1YJW P;  5AW4 B;  1DEB A;  2HLO A;  2FYU E;  1M1J B;  2KSE A;  4H0L B;  1VQ7 P;  2P2U A;  4DJG A;  3MD0 A;  1JM0 A;  3RK2 D;  3Q5P A;  3CCE P;  1L0N E;  3H25 A;  1SQV D;  4WY4 C;  2NPS A;  2R3C A;  1VQM P;  1SQV E;  1R5S A;  1QX8 A;  2Y9Y A;  2ZXX A;  1KV4 A;  3A0H E;  5TIS E;  3H32 B;  5AVW B;  1BCC E;  4HKZ H;  3M9H A;  2WSF H;  4L74 A;  3EFF K;  3MTU E;  3LW5 J;  1ZP0 C;  5CJ0 A;  4OGQ B;  1NTM K;  4H44 B;  4H13 C;  3D6Z A;  1A02 F;  1RQV A;  3KYQ A;  1KB9 I;  1JEK A;  2K3R A;  1P84 H;  1IFD A;  3CX5 H;  2Q3I A;  3O6Q B;  4XFJ A;  2JDI H;  1FZG A;  1MZ9 A;  3ZDM A;  2ZXE B;  2ZYG A;  3MUD A;  3A3Y B;  2BAS A;  1GL2 B;  3H1K J;  3A7O A;  3HE5 A;  5AW3 B;  2NPS C;  1GDT A;  2JEE A;  3A0B H;  3FXD A;  1BE3 J;  4N3Y B;  5GTH E;  2E74 C;  3I56 P;  2N1T A;  3GW6 A;  1OVR A;  1NO4 A;  4LGD E;  1SQX D;  4ZMD A;  1BGY G;  1SQX E;  1SQB J;  2ZYD A;  3TDK A;  1PP9 J;  2W27 A;  1MV8 A;  4I6M C;  4BRY B;  1T8Z A;  3IR9 A;  2VRS A;  2K37 A;  2W6J H;  1VF5 C;  2NRG A;  3HD7 A;  1L4A B;  3AE5 C;  3RGU A;  1FJP A;  1L0L D;  5AVU B;  2Y0C A;  3L72 J;  1L0L E;  3FXE A;  1LGH B;  2AXC A;  1YBK A;  3SWY A;  2Q5U A;  1RHZ B;  4WBA A;  3AEF C;  1ZV8 A;  3CC7 P;  3Q3D A;  3H1J G;  1NWQ A;  3MP7 B;  1SQP G;  3S4R A;  3MUD C;  1JY3 O;  2KLV A;  2IPP A;  1QLE D;  1JY2 N;  3AE1 C;  3F5H A;  2B88 A;  2WZ7 A;  4IL6 E;  3N4X A;  1N2D C;  2E74 D;  1S72 P;  2N1T C;  1NH4 A;  2CPB A;  4AQR D;  1Y9B A;  2W6B A;  1NU1 K;  1PIX A;  2K9J A;  2FYN C;  3E7K A;  1VQK P;  1H0T A;  3VP9 A;  1FOS E;  1CZQ A;  4GOD A;  3TNU B;  2H88 C;  1MUU A;  1HBW A;  2BCC G;  1VQ6 P;  2WQY C;  3B5N A;  1NTK K;  3HD7 C;  1VQO P;  1Q86 Q;  4BXL A;  1NAY A;  1LP1 B;  1URQ A;  1KYO E;  3A0H H;  5TIS H;  1NJI Q;  2H8P D;  1JCD A;  2B87 A;  4PD4 I;  1YIT P;  3CCS P;  3L74 D;  3L74 E;  4YPC A;  1PV3 A;  2C0X A;  2A06 G;  3JSV C;  4HYT B;  3FWN A;  1ZR2 A;  3S9O A;  3I55 P;  2K1A A;  1SFC B;  5CMZ A;  1S4X A;  3L71 G;  1NTZ G;  3BCC J;  3KHU A;  2KS1 A;  3N7N A;  4R4L A;  1KOR A;  2YIU B;  4OWF A;  3P7K A;  2A45 H;  2ITA A;  1AVO A;  3H1L D;  4JQ0 D;  4RJT A;  3EQ2 A;  2Q6Q A;  1SQQ J;  5KLV K;  3H1L E;  3SWK A;  3BAT A;  3V5B A;  1K04 A;  5CBN A;  5GTH H;  1LJ2 A;  1OXZ A;  1KFM A;  3B5N C;  3HD7 D;  4WY4 B;  1NTM G;  2M5A A;  1PGJ A;  1URQ C;  2FYZ A;  2AEM A;  5AW6 B;  2V4H A;  3OA7 A;  2G3A A;  1USE A;  1AQT A;  1G1I A;  3PHL A;  1KC8 Q;  2R3S A;  2P1J A;  5E79 E;  4KHX A;  1WT6 A;  4Z1M H;  2IFM A;  1KTM A;  1M8O B;  2WPR A;  3G3Z A;  4H13 B;  3GLM A;  3H1I G;  1RQU A;  3VTP C;  2ZVN B;  3KDP B;  4JYB A;  2QM7 A;  1IFJ A;  2G8Y A;  2Y9Z A;  5KJ7 D;  2OQQ A;  1WMK A;  1DD3 A;  1JNM A;  3T97 A;  4D6T G;  4DT0 A;  1OX3 A;  4IL6 H;  1R8E A;  1UIX A;  2KI7 B;  3B5N D;  2AEF A;  1S1C X;  3FX0 A;  3L36 A;  1VQ8 P;  2NPS B;  4WWI A;  1L2P A;  3NTN A;  4U3F J;  2E74 B;  2XV5 A;  1IFM A;  2R44 A;  4OGQ D;  2W83 C;  1ZXG A;  4DOJ A;  1LT9 A;  1ZRT D;  2YMY A;  2HPC A;  3R2P A;  3PLN A;  5AVR B;  3BRV B;  2RH0 A;  3GF7 A;  3CX5 D;  2RMZ A;  3L70 G;  2PP6 A;  1KYO H;  2O3J A;  3II6 A;  1TU3 F;  1MFZ A;  1GL2 D;  1FBM A;  3TGU D;  3EWK A;  2IZ0 A;  1JY2 P;  3H1H G;  3WUU A;  3VYI A;  3Q2Y A;  1ZR4 A;  2KUB A;  2W90 A;  3H1K E;  4I7Z C;  1BE3 D;  1OIP A;  1WRG A;  1BE3 E;  3BAS A;  1GU5 A;  3V4W A;  4I2L C;  1QGK B;  2QJP C;  3L4F A;  5AVY B;  1SQP K;  2FYU G;  3G6E P;  2P67 A;  1LTG C;  1S3J A;  2N1T B;  4NPE A;  2LXB A;  2BEQ D;  1PGQ A;  2P10 A;  1SQB E;  1LT9 C;  5AW2 B;  3O8Z A;  1PP9 D;  2FYN B;  3TSI A;  1PP9 E;  1SQV G;  3BVH A;  2FKW B;  2XDJ A;  4IOI H;  4YTP C;  3VN0 A;  1T6A A;  3FGA D;  5AW1 B;  1K9M Q;  4KJM A;  3VMZ A;  3L72 D;  3HD7 B;  4UB8 E;  3L72 E;  4MN4 C;  2XND H;  3L73 J;  5E79 H;  4ZKU A;  2IYO A;  3K5B A;  4K35 A;  2E42 A;  2HG5 D;  1W5C E;  3IF4 A;  3MZW B;  5APV A;  4N6J A;  3H6P A;  1IO4 A;  1CI6 A;  1GK4 A;  4JYC A;  5APW A;  1NHL A;  1NKZ B;  2OYI A;  1NTZ K;  2A45 G;  2M8R A;  2OTK E;  5B5E E;  1L0N D;  4JBZ A;  3PJS K;  2OTL P;  2K9J B;  2WT7 B;  2P7J A;  1G2C A;  5KLI C;  1H0T B;  3CCV P;  5GTI E;  2WPQ A;  2QSI A;  2KXP B;  1BCC D;  1FZA A;  1SQX G;  3KXD A;  1J1E C;  1NOH A;  3B5N B;  1ZW0 A;  1AV1 A;  1URQ B;  1OW7 A;  1X79 B;  1SFC D;  4O9B A;  4GOF A;  2B87 B;  2IYP A;  1NTM J;  3LW5 H;  5AVQ B;  1N8R Q;  1GTW A;  3L75 J;  1PGO A;  3BCC D;  4L73 A;  3BCC E;  1L0L G;  4XE5 B;  1IFI A;  1VQN P;  2E76 C;  2M3E A;  3W68 A;  3L35 A;  2O01 N;  2W6A A;  2MJZ A;  3CXH I;  1SS1 A;  2OYI C;  3CD6 P;  1P84 I;  5CJ4 A;  2KS1 B;  3CWB J;  2QJY C;  1HH0 A;  4TT3 H;  1SQQ D;  4WY4 D;  1EZV D;  1SQQ E;  2OYO A;  2ZFC A;  4Y28 J;  1EZV E;  2GA1 A;  3A5T A;  3AEE C;  1HJ0 A;  1BDC A;  2AXT E;  5B66 E;  4JPZ B;  1E5W A; 
#chains in the Genus database with same CATH homology
 1JUN A;  3OJA B;  1SFC B;  5CMZ A;  1SP4 A;  3U1C A;  3OAK A;  2C9L Y;  4DZO A;  2O1K A;  3TNU A;  2Z4E A;  4AUW A;  1J1D B;  3LIE A;  5AW7 B;  1X8Y A;  3KPE A;  4W80 A;  5CCG C;  1LTI C;  1NKN A;  2C9N Y;  2R32 A;  2O01 H;  4XA4 A;  2Q9I A;  2M3B A;  1KIL D;  3BRT B;  1L4A C;  2IFN A;  1FOS F;  2YNY A;  3N7N A;  1W2E A;  3GHG A;  3C9I A;  3P7K A;  1N7S B;  2A45 H;  3VMY A;  5BU5 A;  3EQ2 A;  3B8E B;  5KLV K;  1FZC A;  3BAT A;  3V5B A;  1YTZ I;  4AYC A;  1LWU A;  3TK1 A;  5BU8 B;  1T3U A;  4C7N B;  1OXZ A;  1KFM A;  3B5N C;  3HD7 D;  2HOD B;  1M7L A;  4WY4 B;  1SFC A;  5CCH A;  1URQ C;  1JTH B;  2FYZ A;  1GU4 A;  1AFO A;  4C46 A;  1S9K D;  1FZF A;  1LTJ B;  2NPS D;  4LC1 A;  5AW6 B;  1LTA C;  3OA7 A;  1NAF A;  1RE3 C;  1S9K E;  2Z5I A;  1KQL A;  3A2A A;  1G1I A;  4IFD K;  3RK3 C;  1JOC A;  3NMD A;  3EFG A;  2P1J A;  4ZKP A;  3RL0 C;  4KHX A;  1RF1 B;  1WT6 A;  2IFM A;  1H8A A;  1DX7 A;  1N7L A;  1N7S A;  2GM4 A;  2WWW A;  2WPR A;  3G3Z A;  2WPS A;  5CCG D;  2FYU K;  1IC2 A;  1KIL B;  3VTP C;  1LT9 B;  3HUS B;  4C7N A;  3V2Q A;  3KDP B;  2HOD A;  2GUV A;  1SVF A;  1L4A D;  4JYB A;  2QM7 A;  4WY4 A;  1CSB A;  1IFJ A;  2I1J A;  2HPC B;  1LTT C;  1JTH A;  3HRN A;  5AW8 B;  1T2K C;  1L0N K;  1LTJ A;  3GHG C;  5KJ7 D;  2KOG A;  4HH2 A;  2WIT A;  1SQV K;  1JNM A;  2YKP A;  1HVV A;  1X9V A;  1HTL C;  3T97 A;  1FZC C;  1LWU C;  2CPS A;  5BVZ A;  2L5G B;  5AW5 B;  3P32 A;  1H89 A;  4M3L A;  1RF1 A;  3B5N D;  2JJL A;  1JY3 N;  5AVS B;  1IJD B;  3L36 A;  3P8M C;  1J2J B;  1JY2 O;  1SFC C;  2NPS B;  3I5C A;  5CCH C;  4W7Y A;  3NTN A;  2XV5 A;  1N73 B;  2YKQ A;  1J1D C;  1IFM A;  1KZU B;  3MIW A;  1FAV A;  2FFD B;  1FZE A;  2N1T D;  4RES B;  1KIL A;  4DOJ A;  1LT9 A;  3HUS A;  3LID A;  3M0A A;  2PAJ A;  3M9Q A;  2YMY A;  1SQB K;  3R2P A;  2HPC A;  3RL0 D;  3E1I A;  1FDM A;  1QL2 A;  5APY A;  5AVX B;  2C0W A;  5AVR B;  4C7R A;  4EIJ A;  1YTZ T;  3BRV B;  4IFF A;  1N7S C;  2O1J A;  1DEB A;  2HLO A;  2R5D A;  5AW4 B;  1M1J B;  5APU A;  2FXM A;  2OYH B;  2PP6 A;  3V4Q A;  1HJB A;  3II6 A;  2P2U A;  3UIA A;  3MD0 A;  3RK2 D;  1HGV A;  1MFZ A;  4WY4 C;  1GL2 D;  2NPS A;  2R3C A;  2A45 I;  1FBM A;  4GIF A;  3NXS A;  1T2K D;  1N73 A;  5APX A;  1RF0 A;  1H88 A;  1LTJ C;  4N78 D;  1JY2 P;  2FFD A;  3VYI A;  4N78 E;  2J58 A;  3WMM 0;  1ZR4 A;  3H32 B;  5AVW B;  3M9H A;  2LKM A;  2WSF H;  1JMM A;  2XU6 A;  2HFE D;  1LTB C;  1HWT C;  4Y99 B;  3CLQ A;  3MTU E;  1WRG A;  3BAS A;  1SQX K;  1GU5 A;  3V4W A;  1RF1 C;  4I2L C;  3L4F A;  5AVV B;  5AVY B;  1SLQ A;  1SQP K;  3P8C D;  2Q7C A;  3VOP A;  1M1J A;  5CJ0 A;  2P67 A;  1NTM K;  3P8C E;  1LTG C;  2N1T B;  2KYV A;  2OYH A;  2YO3 A;  2HYN A;  1XTC C;  1PFI A;  1A02 F;  1GW4 A;  1L4A A;  1KIL C;  1LT9 C;  1VDF A;  5AW2 B;  3O8Z A;  3HUS C;  2WT7 A;  3KYQ A;  3NFQ A;  3TSI A;  2WSE H;  1JO5 A;  5KJ7 A;  3BVH A;  1IFD A;  5AVZ B;  2FKW B;  5AW0 B;  3SWF A;  2Q3I A;  2E43 A;  2POH A;  2XDJ A;  1CI6 B;  1YYC A;  1L0L K;  1FZG A;  3VN0 A;  1MZ9 A;  3KQG A;  3H32 A;  2ZXE B;  5AW1 B;  2OYI B;  3HE4 B;  3VMZ A;  4JF7 A;  3U59 A;  3RK2 B;  1RY3 A;  3MUD A;  3HD7 B;  2XZR A;  3A3Y B;  2R5B A;  2BAS A;  1GL2 B;  5APS A;  3VP8 A;  3HTK B;  3VMX A;  3A7O A;  1XTG B;  3HE5 A;  2Z5H A;  1G2C B;  5AW3 B;  2NPS C;  1GDT A;  2JEE A;  4N3Y B;  1URQ D;  3IFM A;  4W7Z A;  1IK9 A;  1N73 C;  2N1T A;  1RF0 C;  1NO4 A;  4LGD E;  2FFD C;  4ZKU A;  1Z56 A;  3M0D A;  3V2R A;  1FU1 A;  2I1K A;  3RK3 D;  2XNX A;  2YKO A;  2E42 A;  2WSC H;  2HG5 D;  4EOT A;  1FZB A;  2YO2 A;  5APV A;  4N6J A;  3H6P A;  1JCC A;  1IO4 A;  2KSJ A;  2W27 A;  1CI6 A;  1GK4 A;  4JYC A;  3U1A A;  5APW A;  1MV8 A;  1M1J C;  1N86 A;  4I6M C;  5APQ A;  1NHL A;  1T8Z A;  1NKZ B;  2OYI A;  3IR9 A;  3HE4 A;  5CHX A;  1NTZ K;  2OYH C;  2A45 G;  2M8R A;  5AW9 B;  2VRS A;  4LLH A;  1EQ7 A;  3HD7 A;  2OAR A;  1L4A B;  1GL2 A;  1T3J A;  3HTK A;  2WT7 B;  4WB4 A;  1FJP A;  2H43 A;  2H7H A;  2P7J A;  1G2C A;  5KJ7 C;  5AVU B;  2QM8 A;  3V2P A;  1LGH B;  2WPQ A;  1SQQ K;  4B86 A;  3SWY A;  2Q5U A;  4WBA A;  1FZA A;  1ZV8 A;  2IX7 C;  1RE4 A;  1NWQ A;  1GW3 A;  1KFN A;  1J1E C;  1NOH A;  1FJK A;  1J1E B;  3B5N B;  4GKG A;  2KB7 P;  4Y99 C;  1JY3 O;  2KLV A;  2IPP A;  1GK6 A;  4I1L A;  3MGN A;  1URQ B;  3TYY A;  1JY2 N;  1X79 B;  2WZ7 A;  1SFC D;  3HE5 B;  1HUC A;  1A02 J;  4O9B A;  5CCH D;  3N4X A;  1N2D C;  5CCG A;  1OWA A;  3LW5 H;  3M06 A;  3L37 A;  4OH8 B;  2N1T C;  1NH4 A;  5AVQ B;  5AVT B;  2CPB A;  4AQR D;  2KP8 A;  3RK3 B;  2W6B A;  1NU1 K;  3M0D C;  1DH3 A;  2XKM A;  4IFM A;  1GTW A;  1ZN5 A;  3RL0 B;  1QL1 A;  3CI9 A;  4XE5 B;  3PP5 A;  3VP9 A;  1IFI A;  1FOS E;  1CZQ A;  1LTS C;  1VPC A;  3L35 A;  3TNU B;  2W6A A;  3CL3 D;  1N7S D;  1ZLL A;  2WTY A;  2MJZ A;  1HGZ A;  5KTB A;  1MUU A;  2GUS A;  2OYI C;  1HBW A;  3V2N A;  1IFN A;  3RK2 C;  3B5N A;  1NTK K;  3HD7 C;  5CJ4 A;  4GT1 A;  1GL2 C;  1HH0 A;  1GD2 E;  1URQ A;  1G1J A;  5APT A;  1AQ5 A;  4WY4 D;  3GHG B;  2ZFC A;  2H8P D;  2N9B A;  1JCD A;  1JY3 P;  1RE3 A;  3A5T A;  1GZL A;  1FZC B;  1LWU B;  2C0X A;  1RE4 C;  1CW5 A;  4HYT B;  3M91 A;  2J59 M;  3M9B A;  1ZR2 A;  1E5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...