1IFNA

Two forms of pf1 inovirus: x-ray diffraction studies on a structural phase transition and a calculated libration normal mode of the asymmetric unit
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Forms of Pf1 Inovirus: X-Ray Diffraction Studies on a Structural Phase Transition and a Calculated Libration Normal Mode of the Asymmetric Unit
pubmed rcsb
source organism Pseudomonas phage pf1
molecule tags Virus
molecule keywords INOVIRUS
total genus 21
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1994-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ifnA00
1QL1A 1ZN5A 2IFNA 4IFMA 2KLVA 2KSJA 3IFMA 2IFMA 1IFMA 2XKMA 1PFIA 1IFNA 1QL2A
chains in the Genus database with same CATH superfamily
1L0LG 1FBMA 1OW8A 5APSA 1EZVD 5AW3B 1J1EB 1CI6A 1YYCA 1ZRTE 1VF5C 2G8YA 2W27A 2R3CA 4AYCA 1YI2P 3H1KD 2OYOA 2QA4P 2KP8A 2QSIA 2BEZF 5CCGA 2OTJP 1JO5A 1N73A 3HE5B 5AW7B 4C46A 1PPJD 4DOJA 1SQVE 4Y99C 1JB0J 1NU1D 1WRGA 1RQUA 3C1LA 3C8VA 4HB1A 2LR2A 2WZ7A 1U7MA 4NPEA 2BCCG 2YIUB 1LTAC 2BEQD 2M5AB 1EDKA 1SQPE 2FYUK 1LWUB 2QJKC 1HGVA 3JCUH 1EZVG 4H44C 5KLVE 1JTHA 1URQA 2WSEH 2C0WA 4WY4D 2Z5HA 4W80A 3TYYA 2QJPB 3CWBJ 3N7NA 2ZJSE 5B5EE 3H1JJ 2YIUC 3L71G 4W7ZA 2YKQA 5KLVG 1QLED 2CPSA 2KSJA 4TLFA 1U7JA 4H44B 2Y0DA 3H1KE 4LLHA 1GL2D 1LJ2A 1NTKG 3RL0C 1M8OB 2O1JA 2YXRB 3H6PA 5CCGC 3W67A 2WPRA 3EFFK 4ASVA 1YJWP 2ZYGA 3TK1A 3A2AA 2M3EA 1CSBA 1K05A 2Y0EA 3GLMA 3FX0A 5AW0B 3GF3A 2P2UA 3QH9A 3L70D 1Y9BA 2BCCJ 2FXPA 2E74B 2FXOA 2L5GB 1LTJA 1N7SA 2RKLA 3KZIE 4U3FG 1RF0C 1Y47A 5AVWB 3T97B 1NTKJ 1AA0A 2IPPA 5BVZA 1UIIA 2JWAA 3M91A 2KIKA 4M3LA 3H1HE 3HUSB 2E74D 3R2PA 1SFCA 3VYIA 4GT1A 1VQ8P 3CXHH 4L73A 4PV1D 3D71A 1FZCA 3AE3C 4UB8H 2WT7B 3AEFC 1BCCD 1KILE 2YXQB 3OAKA 3Q2YA 1GU4A 2OYIA 3RK2B 4BRYA 3F5HA 1K73Q 4PD4I 1KQSO 2XNXA 1LP1B 3IR9A 4JYBA 3RK3C 3CCQP 1T2KD 2QJPC 3AE1C 2KS1A 3S1KA 3Q3DA 1RF1B 3HTKA 1T6AA 3EFGA 3PLNA 3A5TA 3BASA 4HYTB 3E1RA 2FBWC 2ZAEB 4IL6E 5DJTB 1KD1Q 4WB4A 2W6JH 1Q81Q 1EDIA 4MN4C 1NAYA 3P32A 1RQVA 5AVQB 2OYHB 1GZLA 1NH4A 3H1KJ 2Q9IA 4AUWA 1QX8A 2IYOA 1M7LA 3L71D 3VN0A 1JY3P 4WY4C 1H0TA 2Z4EA 2IX7C 1BDDA 1KYOH 1EZVI 2YNYA 3D70A 1FJKA 4IL6X 2YMYA 2QM7A 4U7JA 4U3FE 3L74G 4ZKPA 1VDFA 2FXMA 2E42A 1MV8A 1NTZG 1R8EA 2J58A 1AQ5A 2AEJA 1L2PA 2AXTE 2ZYAA 2ZT9C 1YHQP 1BCCJ 5H2FH 2KI7B 1OX3A 1G2CB 1KILC 1D7MA 1OZHA 2N1TC 4IOIH 3I55P 3M0DA 2NPSA 3TGUG 3D6ZA 1SLQA 1KQGB 4DZOA 3V4QA 1T3JA 2JDIH 4ZKUA 1RE3A 3PRJA 3NFQA 2I8DA 2Q7CA 3H1KG 3Q5RA 2A06D 3A0HE 1NWQA 2Q3EA 2R44A 1GU5A 1LTBC 1RF1C 2KNCA 1IFNA 3FWNA 5AW6B 5BU5A 5KKZB 1DH3A 4UB8E 1AQTA 1MUUA 2IBZI 1L0NG 2B87A 3BRTB 1EZVE 2QG4A 2O01N 1NAFA 2WMMA 1ZRTD 4PD4D 2Q3IA 1W2BO 1RY3A 2FYUG 1RHZB 3QWOC 3II6A 4L76A 2PFXA 5KAFE 3WUVA 1VQ9P 2PRRA 1L0LJ 5CBOA 1NO4A 1P84I 1RH5B 1KB9I 3I5CA 3GHGC 5KLIB 1L4AB 2WPSA 3K5BA 1AVOA 1HGZA 2H8PD 2P58A 2YO2A 1FDOA 3A7OA 3IN6A 2A45H 2NPSD 2WSFH 1L0NK 2IZ1A 4JBZA 4JYCA 4RKUJ 1NTKK 1NU1K 2CK3H 2JEEA 1PGJA 1S9KD 3NTNA 1M1KQ 3BCCD 3MUDC 1SS1A 1VQKP 3PJSK 1LNQA 4U3FJ 1QL2A 1KB9D 5AVSB 5KJ7A 3CC2P 1URQD 1IFJA 3USSA 3KPEA 2YKPA 2LXBA 5CMZA 3G4SP 5CCGD 1BCCE 2W83C 3CX5H 2M3BA 1FZEA 4WBAA 2C0XA 2IBZE 4B86A 2OGUA 4C7RA 4JF7A 2E5TA 4EIJA 1VQOP 2E76C 1H88A 2H88C 1KB9H 4I1LA 3VMZA 1NTZE 2J59M 5B5EH 3T97A 2N9YB 3TF5A 1SQXG 1PIXA 4NPFX 1FE6A 3PP5A 2OTKE 4OWFA 2GUSA 1AV1A 1PP9G 2PAJA 2K1AA 1N73B 3CCMP 1JTHB 1VQMP 1PP9E 1BGYJ 1OXZA 3GF7A 3L73J 4RJTA 3Q5SA 3TNUA 3B5NC 1OFCX 2GA1A 3NXSA 2AEMA 1LT9B 2KS1B 1PL5A 1GMJA 2W8ZA 3AE9C 4H13C 1DIPA 3TSIA 1NTME 1SQQE 2E74C 4AQRD 2E76D 2M0BA 3L70J 1R5SA 1OIPA 1XTCC 2WQYC 2XV5A 3H32B 2JKVA 1IFDA 1EDJA 2IBZG 3AEAC 4K35A 1NU1G 3P7KA 5AVUB 1GTWA 1IO4A 1BDCA 1EQ7A 5AW2B 1S5LE 1GW4A 3IFMA 1JY2N 2QJYB 5KAFH 1DEEG 1ZP0C 3M9QA 2HYNA 2NPSC 5E79H 2FYUJ 2Q1KA 1NTZK 2C9LY 2VRSA 3RK2C 1L4AD 2C9NY 1GL2B 1EDLA 1LGHB 3L71E 1VQ4P 1IFMA 1T3UA 3B5ND 3CL3D 1ZOYC 3Q1MA 2QRXA 1K8AQ 4DT0A 1LWUC 1PGQA 3AE8C 3LIEA 4H13D 5TJHA 1KQFB 4EI2A 1KV4A 1IZNB 2LKMA 5AW8B 2I1JA 3H1IJ 1JNMA 1DD3A 2FYNC 1IJDB 3IAOA 1OVVA 3HE4A 4H44D 4EOTA 2KSEA 1NTKE 2MJZA 2A45G 4PD4H 1L0NE 1S4XA 2J5UA 2MKVA 3LIDA 2AXTH 4C7NB 2HLOA 2FKWB 3CCUP 3L74J 4N78D 4PJ0H 1HH0A 2KLUA 4H13B 1Q86Q 1NKZB 2B87B 1KZUB 3LW5J 3KDPB 5KTBA 3CXHI 3B8EB 1SFCD 1SQQJ 1L4AC 1NTMJ 2BCCD 3H1IG 1YTZI 5KLIC 3RL0g 2OYHC 1UIXA 1K9MQ 3AEDC 4IFMA 3TGUE 2W90A 4K3AA 1DD4A 4WY4B 5APVA 3CWBD 2ZFCA 5M1BA 4ZNCA 2JP3A 1M1JC 1OW6A 1WMKA 1AVYA 3RBZA 1PPJE 3V2PA 1LTIC 4GKGA 3CCJP 1FZCC 1FZAA 3B71A 2E75D 1ZW0A 3CCSP 2UWJE 1SFCC 3L72G 5E79E 1R5LA 2R3SA 2QIWA 3NMDA 1HJ0A 1N86A 3H1ID 2CPBA 2E76B 3BCCG 4GDOA 1IK7A 1NKNA 3L74D 4R4LA 5CJ4A 3MP7B 1YIJP 5B66E 2G3AA 3L75J 3FWLA 4H0LB 2HPCA 1DX7A 1M57D 3L70G 4BWNA 3KZIH 1JY3O 2E75B 4NPDA 1N2DC 2Q6QA 3N4XA 1BSHA 1JY2P 5APYA 5K5GB 2JWDA 1YITP 2KLVA 3D6YA 4HJGH 1CW5A 1NHLA 2POHA 1L0NJ 2V4HA 2R5DA 2KYVA 2Z5IA 2QE7H 1PV3A 4EDFA 1Q82Q 1E79H 1KYOD 1JOCA 1SQXE 2YO3A 3B5NB 1SQVD 1P84D 1X8YA 4EYYQ 1HBWA 1VQ5P 3CX5I 2DW3A 3BCCJ 3H1JD 3TNUB 3G3ZA 3KQGA 3MD0A 5KAIH 1NVOA 3MZWB 1FAVA 2ZYDA 3IF4A 3BRVB 5KLVJ 4XA4A 1J1DB 1SQVK 3MHVA 2ZT9D 2FYZA 1SFCB 1GDTA 3ITKA 2A45I 1KILA 2KK7A 2KUBA 1BGYE 3L73E 2QJYC 4H0LD 1PPJG 3H1LJ 2WPQA 5CBNA 1OWAA 3RK2D 3L71J 2NPSB 2QJKB 2XZRA 3ABVC 1S5LH 2HODA 1KFNA 3O8ZA 3WUUA 3ZDMA 2M5AA 4ZMDA 2WSEJ 1DEBA 2K9JA 3SWKA 1USEA 1NGMB 2D2CD 1N7SD 4LC1A 3S9OA 3CCEP 1YTZT 1URQB 4GIFA 2KOGA 1H89A 3WU2H 3H1IE 2ITAA 3SWYA 1ZMEC 3AECC 1LT9C 3P8CE 2W6BA 1PGOA 1RE4A 2XU6A 3EWKA 1SQXK 5GTIE 4BRYB 1JUNA 3H1LE 1BGYD 1PZQA 3L73D 5KLVD 3VP8A 4YTPC 2RMZA 3GHGB 1OMIA 3HE4B 3R4YA 5AVVB 3HTKB 2P10A 1U57A 3VTPC 2WTYA 1JCDA 1EXJA 3SSUA 1PFIA 3H1LD 1NTZD 1QEXA 1CI6B 1SQVG 1NU1E 1KTMA 1Q7YQ 3CCVP 3WU2E 3L72J 3RL0B 3AEBC 4L75A 2KZJA 2ZXEB 3HD7D 4OVNF 1OW7A 1ZR4A 3CMAP 2IFNA 3A3YB 4I7ZC 2W6AA 1BSNA 1J1DC 3FXDA 1H0TB 3B4SA 1GL2C 3RL0D 1HTLC 3P8MC 1EXIA 1KB9E 2FYUD 1FZGA 3V4WA 3M06A 2P1JA 1X79B 1SQBE 1FZCB 1PP9D 4Y99B 1GK4A 1RF0A 3FXEA 1XTGB 3RK3E 3HUSA 1ZV8A 3HE5A 4N78E 5APUA 3A0HH 3CXHD 4XE5B 4R4MA 5AW4B 1GD2E 2R5BA 3JC22 1FU1A 1P84H 3L37A 2IYPA 1S5LX 3A0BE 2NRGA 3CLQA 1KFMA 4PD4E 2E75C 3AE6C 3SFEC 1VL2A 4D6TD 4DJGA 1M90Q 5AVRB 3M0DC 3H1JE 2GM4A 4L74A 2KNCB 1YJ9P 1BE3G 4GOEA 1P84E 3G71P 2YKOA 1BCCG 4I2LC 1X0TA 1LTTC 2A06E 2ZVOB 5AVXB 3G6EP 1HF9A 1LTJB 1N7SB 4KJMA 3H25A 2IFMA 1JEKA 1M56D 2RH0A 2XKMA 3BCCE 3H1HG 1NTMD 1SQQD 4PV1C 4IL6H 1LTGC 2OQQA 3L72E 4HKZH 2Y9ZA 2Y0CA 3PHLA 4LGDE 2I1KA 2HR3A 3L75G 2FY8A 1SP4A 3KXDA 3CX5D 3TDKA 1FJPA 5AW1B 4N3YB 1N8RQ 5BU8B 2BASA 5GTHE 1KC8Q 2WVRA 5GTIH 4IFDK 1SQPK 1FC2C 1KYOI 2FYUE 2NZ2A 3MIWA 3C9IA 1RF1A 2WSSH 3M0AA 5CCHA 2N9BA 4OGQC 1ZR2A 1JY2O 1ZLLA 3AE7C 3HD7A 1W5CE 5AVZB 4PJ0E 2OYIC 1JMMA 1LWUA 3U59A 1LTSC 1T8ZA 3OA7A 2V7QH 4OGQB 3L72D 1LP1A 2YMKA 3CWBE 3GMAA 3OJAB 1J2JB 2HFED 3MGNA 1KORA 1S3JA 4TT3H 1A02F 1KQLA 4ASWA 4D6TE 1IFIA 1SQBK 1IC2A 1M1JA 5TISE 4D6TG 2WPVB 3BVHA 2FFDA 1FOSF 2N1TA 5EFWB 2WSFJ 3EQ2A 3V5BA 1S9KE 2B9BA 2IBZD 1SQVJ 4YPCA 2WWWA 2JO1A 3H32A 1EC5A 3L75E 5CJ0A 3AE2C 1BGYG 1JMBA 2QVAA 3L73G 3SWFA 5C39A 1USDA 4CPGA 3HD7C 1VQ7P 3RBXA 2QEXP 4XFJA 1NJIQ 2K88A 3GW6A 3I56P 3BATA 1QGKB 5DJUB 1NYHA 1YQ4C 2L91A 1W2EA 1OVUA 2N1TB 3B5NA 1SQBJ 4JQ0D 3CXHE 1Y8AA 1Q2NA 4A7PA 1VPCA 2H89C 3JSVC 3JCUE 5KAIE 1VQNP 3L75D 1G1JA 1FDIA 2WITA 2RN0A 3CX5E 1J1EC 1Q90D 4WWIA 5KLVK 2K3RA 3CCLP 2JR8A 3PH0A 4KT0J 2H43A 1JCCA 1NU1J 3V2QA 2KXPB 4N6JA 2JJLA 2O01J 2K9JB 2OARA 2ZVNB 3AEEC 3W68A 2A06G 2QM8A 5AVYB 1AJYA 4BXLA 2FYNB 2FFDC 1FS0E 1L4AA 3PTZA 1BE3E 1KMIZ 5APQA 3VMXA 1QVFO 1KN7A 4OGQD 1CZQA 1S1CX 1MKMA 3VOPA 3H1JG 3OW2O 1SQBG 4U3FD 5CCHD 1NTZJ 1S2EA 5B66H 3RGUA 2E5YA 4I7ZB 5AVTB 1E5WA 2Y9YA 3Q5PA 1X22A 1YJNP 3AEGC 1A02J 1VQLP 4OH8B 1AFOA 2HG5D 3TGUJ 3CPWO 3MUDA 2B89A 2O3JA 2K37A 2IDBA 3V2RA 1VQ6P 2K9YA 5APWA 3WMM0 1NTKD 5CCHC 4HH2A 3CCRP 1N73C 1L0ND 1PP9J 4RO0A 3AE4C 3VP9A 1FOSE 1GK6A 4UB6H 1N7LA 4Z1MH 4RESB 1KILB 1MZ9A 3L4FA 1JY3N 4GODA 3U1CA 4GOFA 5H2FE 2P7JA 1ZXGA 2P67A 2XNDH 1ZN5A 2OYHA 1URQC 1S72P 2KZIA 2O01H 3A0BH 1MFTA 3VMAA 3CC7P 1MFZA 3G9RA 1VQPP 2WSCH 1Z56A 1KYOE 1PGPA 1SQPJ 1SQXD 2BCCE 2PGDA 3E7KA 3M9BA 4Y28J 5GTHH 2N1TD 3LW5H 3H1HD 1L0LK 1TU3F 3MTUE 5KKZC 1HJBA 3CWBG 4D6TJ 2HPCB 1BE3J 3H1LG 2LXCB 3L36A 3RK3B 4DCKA 3UIAA 1IFPA 5AW5B 5KJ7D 4O9BA 3RK3D 1T2KC 1SQPG 2WSCJ 1NTMK 1L0LD 1SQQK 1M1JB 4IFFA 1HUCA 3KYQA 4YXDC 1YQ3C 2ZXXA 3U1AA 1OVRA 3WUTA 3CD6P 1QVGO 1FDMA 5L8RJ 2WT7A 1SVFA 1QL1A 2XDJA 3GG2A 3HUSC 4WY4A 2H7HA 3L74E 1GW3A 1VF5B 2D2CB 3CI9A 4JPZB 1LT1A 3H1HJ 3S4RA 2GUVA 1NTMG 1SQQG 4UB6E 5CHXA 2OYIB 3F89A 1L0LE 1SQXJ 1SQPD 3O6QA 2PP6A 3KHUA 2AEFA 5APTA 1GL2A 3V6IA 3HRNA 4YXWH 2R32A 5AW9B 2D2CC 2AXCA 4C7NA 1BE3D 3E1IA 5KJ7C 1FZBA 1RE3C 3V2NA 4QMAA 1VF5D 2KB7P 1KILD 3M9HA 3P8CD 1K04A 1FZFA 2HODB 3TGUD 2FFDB 1HWTC 1YBKA 4H0LC 4KHXA 1NOHA 2B88A 4I6MC 3AE5C 5APXA 1RE4C 3O6QB 1G1IA 3GHGA 1JM0A 1WT6A 1LT9A 3L35A 2OTLP 1X9VA 3HD7B 1LTJC 1N7SC 2M8RA 2Q5UA 4PV1B 5TISH 3SFDC 3CMEP 1HVVA 3L70E 2V7QJ 4W7YA 1G2CA 1H8AA 2IZ0A 1IK9A 2E43A 4WVZA 3CC4P 2O1KA 3FGAD 3VMYA 2SPZA 1SQBD 2ZT9B
chains in the Genus database with same CATH topology
5APSA 1FBMA 1J1EB 1CI6A 1YYCA 4AYCA 2W27A 2R3CA 2KP8A 1JO5A 5CCGA 1N73A 3HE5B 5AW7B 4C46A 4DOJA 4Y99C 1WRGA 2WZ7A 1LTAC 2FYUK 1LWUB 1HGVA 1JTHA 1URQA 2WSEH 2C0WA 4WY4D 2Z5HA 4W80A 3TYYA 3N7NA 4W7ZA 2YKQA 2CPSA 2KSJA 4LLHA 1GL2D 3RL0C 2FFDB 2O1JA 5CCGC 3H6PA 2WPRA 3TK1A 3A2AA 1CSBA 5AW0B 2P2UA 2L5GB 1LTJA 1N7SA 5BVZA 1RF0C 5AVWB 2IPPA 3M91A 4M3LA 3HUSB 3R2PA 1SFCA 3VYIA 4GT1A 1FZCA 2WT7B 3OAKA 1GU4A 2OYIA 3RK2B 2XNXA 3IR9A 4JYBA 3RK3C 1T2KD 1RF1B 3HTKA 3EFGA 3A5TA 3BASA 4HYTB 4WB4A 3P32A 5AVQB 2OYHB 1GZLA 1NH4A 2Q9IA 4AUWA 3VN0A 1M7LA 1JY3P 4WY4C 2Z4EA 2IX7C 2YNYA 1FJKA 2YMYA 2QM7A 4ZKPA 1VDFA 2FXMA 2E42A 1MV8A 1AQ5A 2J58A 1G2CB 1KILC 2N1TC 3M0DA 2NPSA 1SLQA 4DZOA 3V4QA 1T3JA 4ZKUA 1RE3A 3NFQA 2Q7CA 1NWQA 1GU5A 1LTBC 1RF1C 1DH3A 1IFNA 5AW6B 5BU5A 1MUUA 3BRTB 1NAFA 2Q3IA 1RY3A 3II6A 3I5CA 1NO4A 3GHGC 1L4AB 2WPSA 1HGZA 2H8PD 2YO2A 3A7OA 4JYCA 2A45H 2NPSD 2WSFH 1L0NK 1NTKK 1NU1K 2JEEA 1S9KD 3NTNA 5KJ7A 1QL2A 5AVSB 1URQD 1IFJA 3KPEA 2YKPA 5CMZA 5CCGD 4B86A 2M3BA 1FZEA 4WBAA 2C0XA 4C7RA 4EIJA 4JF7A 1H88A 3VMZA 4I1LA 2J59M 3T97A 3PP5A 2GUSA 2PAJA 1N73B 1JTHB 1OXZA 3TNUA 3B5NC 3NXSA 1LT9B 3TSIA 4AQRD 1XTCC 2XV5A 3H32B 1IFDA 5AVUB 3P7KA 1IO4A 1GTWA 1EQ7A 5AW2B 3IFMA 1GW4A 1JY2N 3M9QA 2HYNA 2NPSC 2C9LY 2C9NY 1NTZK 2VRSA 3RK2C 1L4AD 1GL2B 1LGHB 1IFMA 1T3UA 3B5ND 3CL3D 1LWUC 3LIEA 2LKMA 5AW8B 2I1JA 1JNMA 1IJDB 3HE4A 4EOTA 2MJZA 2A45G 4C7NB 3LIDA 2HLOA 2FKWB 4N78D 1HH0A 1NKZB 1KZUB 3KDPB 5KTBA 3B8EB 1SFCD 1L4AC 1YTZI 2OYHC 4IFMA 4WY4B 5APVA 2ZFCA 1M1JC 3V2PA 1LTIC 4GKGA 1FZCC 1FZAA 1SFCC 3NMDA 1N86A 2CPBA 5CJ4A 1NKNA 1DX7A 2HPCA 1JY3O 1N2DC 3N4XA 1JY2P 5APYA 2KLVA 1CW5A 1NHLA 2POHA 2R5DA 2KYVA 2Z5IA 2YO3A 1JOCA 3B5NB 1X8YA 1HBWA 3TNUB 3G3ZA 3KQGA 3MD0A 1FAVA 3BRVB 4XA4A 1J1DB 1SQVK 2FYZA 1SFCB 1GDTA 2A45I 1KILA 2WPQA 1OWAA 3RK2D 2NPSB 2XZRA 2HODA 1KFNA 3O8ZA 1DEBA 4LC1A 1N7SD 1YTZT 1URQB 4GIFA 2KOGA 1H89A 3SWYA 1LT9C 3P8CE 2W6BA 1RE4A 2XU6A 1JUNA 1SQXK 3VP8A 3GHGB 3HE4B 3VTPC 5AVVB 3HTKB 2WTYA 1PFIA 1JCDA 1CI6B 3RL0B 2ZXEB 3HD7D 1ZR4A 2IFNA 3A3YB 2W6AA 1J1DC 1GL2C 3RL0D 1HTLC 3P8MC 1FZGA 3V4WA 3M06A 2P1JA 1X79B 1FZCB 4Y99B 1GK4A 1RF0A 1XTGB 3HUSA 1ZV8A 3HE5A 4N78E 5APUA 4XE5B 5AW4B 2R5BA 1FU1A 3L37A 3CLQA 1KFMA 5AVRB 3M0DC 2GM4A 2YKOA 4I2LC 1LTTC 5AVXB 1LTJB 1N7SB 2IFMA 2XKMA 1LTGC 4LGDE 2I1KA 1SP4A 1FJPA 5AW1B 4N3YB 5BU8B 2BASA 4IFDK 1SQPK 3MIWA 3C9IA 1RF1A 3M0AA 5CCHA 2N9BA 1ZR2A 1JY2O 1ZLLA 3HD7A 5AVZB 2OYIC 1JMMA 1LWUA 3U59A 1LTSC 1T8ZA 3OA7A 3OJAB 1J2JB 2HFED 1A02F 1KQLA 1IFIA 1SQBK 1IC2A 1M1JA 2FFDA 3BVHA 1FOSF 2N1TA 3EQ2A 3V5BA 1S9KE 2WWWA 5CJ0A 3H32A 3SWFA 3HD7C 3BATA 2N1TB 1W2EA 3B5NA 1VPCA 1G1JA 2WITA 1J1EC 5KLVK 2H43A 1JCCA 3V2QA 4N6JA 2JJLA 2OARA 2QM8A 5AVYB 2FFDC 1L4AA 5APQA 3VMXA 1CZQA 3VOPA 5CCHD 5AVTB 1E5WA 1AFOA 1A02J 4OH8B 2HG5D 3MUDA 3V2RA 5APWA 3WMM0 5CCHC 4HH2A 3VP9A 1FOSE 1GK6A 1N7LA 4RESB 1KILB 1MZ9A 3L4FA 1JY3N 3U1CA 2P7JA 2P67A 2OYHA 1ZN5A 1URQC 2O01H 1MFZA 2WSCH 1Z56A 3M9BA 5AW3B 1N73C 1HJBA 2N1TD 3LW5H 1L0LK 3MTUE 2HPCB 3L36A 3RK3B 3UIAA 5AW5B 5KJ7D 4O9BA 3RK3D 1T2KC 1NTMK 1SQQK 1M1JB 4IFFA 1HUCA 3KYQA 3U1AA 1FDMA 2WT7A 1SVFA 1QL1A 2XDJA 3HUSC 4WY4A 2H7HA 1GW3A 3CI9A 2OYIB 2GUVA 5CHXA 2PP6A 5APTA 1GL2A 3HRNA 2R32A 5AW9B 4C7NA 3E1IA 5KJ7C 1FZBA 1RE3C 3V2NA 1GD2E 2KB7P 1KILD 3M9HA 3P8CD 1FZFA 2HODB 1HWTC 4KHXA 1NOHA 4I6MC 5APXA 1RE4C 1G1IA 3GHGA 1WT6A 3L35A 1LT9A 1X9VA 3HD7B 1LTJC 1N7SC 2M8RA 2Q5UA 1HVVA 4W7YA 1G2CA 1H8AA 1IK9A 2E43A 2O1KA 3VMYA 3MGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QL1 A;  1ZN5 A;  2IFN A;  4IFM A;  2KLV A;  2KSJ A;  3IFM A;  2IFM A;  1IFM A;  2XKM A;  1PFI A;  1IFN A;  1QL2 A; 
#chains in the Genus database with same CATH topology
 1L0L G;  1FBM A;  1OW8 A;  5APS A;  1EZV D;  5AW3 B;  1J1E B;  1CI6 A;  1YYC A;  1ZRT E;  1VF5 C;  2G8Y A;  2W27 A;  2R3C A;  4AYC A;  1YI2 P;  3H1K D;  2OYO A;  2QA4 P;  2KP8 A;  2QSI A;  2BEZ F;  5CCG A;  2OTJ P;  1JO5 A;  1N73 A;  3HE5 B;  5AW7 B;  4C46 A;  1PPJ D;  4DOJ A;  1SQV E;  4Y99 C;  1JB0 J;  1NU1 D;  1WRG A;  1RQU A;  3C1L A;  3C8V A;  4HB1 A;  2LR2 A;  2WZ7 A;  1U7M A;  4NPE A;  2BCC G;  2YIU B;  1LTA C;  2BEQ D;  2M5A B;  1EDK A;  1SQP E;  2FYU K;  1LWU B;  2QJK C;  1HGV A;  3JCU H;  1EZV G;  4H44 C;  5KLV E;  1JTH A;  1URQ A;  2WSE H;  2C0W A;  4WY4 D;  2Z5H A;  4W80 A;  3TYY A;  2QJP B;  3CWB J;  3N7N A;  2ZJS E;  5B5E E;  3H1J J;  2YIU C;  3L71 G;  4W7Z A;  2YKQ A;  5KLV G;  1QLE D;  2CPS A;  2KSJ A;  4TLF A;  1U7J A;  4H44 B;  2Y0D A;  3H1K E;  4LLH A;  1GL2 D;  1LJ2 A;  1NTK G;  3RL0 C;  1M8O B;  2O1J A;  2YXR B;  3H6P A;  5CCG C;  3W67 A;  2WPR A;  3EFF K;  4ASV A;  1YJW P;  2ZYG A;  3TK1 A;  3A2A A;  2M3E A;  1CSB A;  1K05 A;  2Y0E A;  3GLM A;  3FX0 A;  5AW0 B;  3GF3 A;  2P2U A;  3QH9 A;  3L70 D;  1Y9B A;  2BCC J;  2FXP A;  2E74 B;  2FXO A;  2L5G B;  1LTJ A;  1N7S A;  2RKL A;  3KZI E;  4U3F G;  1RF0 C;  1Y47 A;  5AVW B;  3T97 B;  1NTK J;  1AA0 A;  2IPP A;  5BVZ A;  1UII A;  2JWA A;  3M91 A;  2KIK A;  4M3L A;  3H1H E;  3HUS B;  2E74 D;  3R2P A;  1SFC A;  3VYI A;  4GT1 A;  1VQ8 P;  3CXH H;  4L73 A;  4PV1 D;  3D71 A;  1FZC A;  3AE3 C;  4UB8 H;  2WT7 B;  3AEF C;  1BCC D;  1KIL E;  2YXQ B;  3OAK A;  3Q2Y A;  1GU4 A;  2OYI A;  3RK2 B;  4BRY A;  3F5H A;  1K73 Q;  4PD4 I;  1KQS O;  2XNX A;  1LP1 B;  3IR9 A;  4JYB A;  3RK3 C;  3CCQ P;  1T2K D;  2QJP C;  3AE1 C;  2KS1 A;  3S1K A;  3Q3D A;  1RF1 B;  3HTK A;  1T6A A;  3EFG A;  3PLN A;  3A5T A;  3BAS A;  4HYT B;  3E1R A;  2FBW C;  2ZAE B;  4IL6 E;  5DJT B;  1KD1 Q;  4WB4 A;  2W6J H;  1Q81 Q;  1EDI A;  4MN4 C;  1NAY A;  3P32 A;  1RQV A;  5AVQ B;  2OYH B;  1GZL A;  1NH4 A;  3H1K J;  2Q9I A;  4AUW A;  1QX8 A;  2IYO A;  1M7L A;  3L71 D;  3VN0 A;  1JY3 P;  4WY4 C;  1H0T A;  2Z4E A;  2IX7 C;  1BDD A;  1KYO H;  1EZV I;  2YNY A;  3D70 A;  1FJK A;  4IL6 X;  2YMY A;  2QM7 A;  4U7J A;  4U3F E;  3L74 G;  4ZKP A;  1VDF A;  2FXM A;  2E42 A;  1MV8 A;  1NTZ G;  1R8E A;  2J58 A;  1AQ5 A;  2AEJ A;  1L2P A;  2AXT E;  2ZYA A;  2ZT9 C;  1YHQ P;  1BCC J;  5H2F H;  2KI7 B;  1OX3 A;  1G2C B;  1KIL C;  1D7M A;  1OZH A;  2N1T C;  4IOI H;  3I55 P;  3M0D A;  2NPS A;  3TGU G;  3D6Z A;  1SLQ A;  1KQG B;  4DZO A;  3V4Q A;  1T3J A;  2JDI H;  4ZKU A;  1RE3 A;  3PRJ A;  3NFQ A;  2I8D A;  2Q7C A;  3H1K G;  3Q5R A;  2A06 D;  3A0H E;  1NWQ A;  2Q3E A;  2R44 A;  1GU5 A;  1LTB C;  1RF1 C;  2KNC A;  1IFN A;  3FWN A;  5AW6 B;  5BU5 A;  5KKZ B;  1DH3 A;  4UB8 E;  1AQT A;  1MUU A;  2IBZ I;  1L0N G;  2B87 A;  3BRT B;  1EZV E;  2QG4 A;  2O01 N;  1NAF A;  2WMM A;  1ZRT D;  4PD4 D;  2Q3I A;  1W2B O;  1RY3 A;  2FYU G;  1RHZ B;  3QWO C;  3II6 A;  4L76 A;  2PFX A;  5KAF E;  3WUV A;  1VQ9 P;  2PRR A;  1L0L J;  5CBO A;  1NO4 A;  1P84 I;  1RH5 B;  1KB9 I;  3I5C A;  3GHG C;  5KLI B;  1L4A B;  2WPS A;  3K5B A;  1AVO A;  1HGZ A;  2H8P D;  2P58 A;  2YO2 A;  1FDO A;  3A7O A;  3IN6 A;  2A45 H;  2NPS D;  2WSF H;  1L0N K;  2IZ1 A;  4JBZ A;  4JYC A;  4RKU J;  1NTK K;  1NU1 K;  2CK3 H;  2JEE A;  1PGJ A;  1S9K D;  3NTN A;  1M1K Q;  3BCC D;  3MUD C;  1SS1 A;  1VQK P;  3PJS K;  1LNQ A;  4U3F J;  1QL2 A;  1KB9 D;  5AVS B;  5KJ7 A;  3CC2 P;  1URQ D;  1IFJ A;  3USS A;  3KPE A;  2YKP A;  2LXB A;  5CMZ A;  3G4S P;  5CCG D;  1BCC E;  2W83 C;  3CX5 H;  2M3B A;  1FZE A;  4WBA A;  2C0X A;  2IBZ E;  4B86 A;  2OGU A;  4C7R A;  4JF7 A;  2E5T A;  4EIJ A;  1VQO P;  2E76 C;  1H88 A;  2H88 C;  1KB9 H;  4I1L A;  3VMZ A;  1NTZ E;  2J59 M;  5B5E H;  3T97 A;  2N9Y B;  3TF5 A;  1SQX G;  1PIX A;  4NPF X;  1FE6 A;  3PP5 A;  2OTK E;  4OWF A;  2GUS A;  1AV1 A;  1PP9 G;  2PAJ A;  2K1A A;  1N73 B;  3CCM P;  1JTH B;  1VQM P;  1PP9 E;  1BGY J;  1OXZ A;  3GF7 A;  3L73 J;  4RJT A;  3Q5S A;  3TNU A;  3B5N C;  1OFC X;  2GA1 A;  3NXS A;  2AEM A;  1LT9 B;  2KS1 B;  1PL5 A;  1GMJ A;  2W8Z A;  3AE9 C;  4H13 C;  1DIP A;  3TSI A;  1NTM E;  1SQQ E;  2E74 C;  4AQR D;  2E76 D;  2M0B A;  3L70 J;  1R5S A;  1OIP A;  1XTC C;  2WQY C;  2XV5 A;  3H32 B;  2JKV A;  1IFD A;  1EDJ A;  2IBZ G;  3AEA C;  4K35 A;  1NU1 G;  3P7K A;  5AVU B;  1GTW A;  1IO4 A;  1BDC A;  1EQ7 A;  5AW2 B;  1S5L E;  1GW4 A;  3IFM A;  1JY2 N;  2QJY B;  5KAF H;  1DEE G;  1ZP0 C;  3M9Q A;  2HYN A;  2NPS C;  5E79 H;  2FYU J;  2Q1K A;  1NTZ K;  2C9L Y;  2VRS A;  3RK2 C;  1L4A D;  2C9N Y;  1GL2 B;  1EDL A;  1LGH B;  3L71 E;  1VQ4 P;  1IFM A;  1T3U A;  3B5N D;  3CL3 D;  1ZOY C;  3Q1M A;  2QRX A;  1K8A Q;  4DT0 A;  1LWU C;  1PGQ A;  3AE8 C;  3LIE A;  4H13 D;  5TJH A;  1KQF B;  4EI2 A;  1KV4 A;  1IZN B;  2LKM A;  5AW8 B;  2I1J A;  3H1I J;  1JNM A;  1DD3 A;  2FYN C;  1IJD B;  3IAO A;  1OVV A;  3HE4 A;  4H44 D;  4EOT A;  2KSE A;  1NTK E;  2MJZ A;  2A45 G;  4PD4 H;  1L0N E;  1S4X A;  2J5U A;  2MKV A;  3LID A;  2AXT H;  4C7N B;  2HLO A;  2FKW B;  3CCU P;  3L74 J;  4N78 D;  4PJ0 H;  1HH0 A;  2KLU A;  4H13 B;  1Q86 Q;  1NKZ B;  2B87 B;  1KZU B;  3LW5 J;  3KDP B;  5KTB A;  3CXH I;  3B8E B;  1SFC D;  1SQQ J;  1L4A C;  1NTM J;  2BCC D;  3H1I G;  1YTZ I;  5KLI C;  3RL0 g;  2OYH C;  1UIX A;  1K9M Q;  3AED C;  4IFM A;  3TGU E;  2W90 A;  4K3A A;  1DD4 A;  4WY4 B;  5APV A;  3CWB D;  2ZFC A;  5M1B A;  4ZNC A;  2JP3 A;  1M1J C;  1OW6 A;  1WMK A;  1AVY A;  3RBZ A;  1PPJ E;  3V2P A;  1LTI C;  4GKG A;  3CCJ P;  1FZC C;  1FZA A;  3B71 A;  2E75 D;  1ZW0 A;  3CCS P;  2UWJ E;  1SFC C;  3L72 G;  5E79 E;  1R5L A;  2R3S A;  2QIW A;  3NMD A;  1HJ0 A;  1N86 A;  3H1I D;  2CPB A;  2E76 B;  3BCC G;  4GDO A;  1IK7 A;  1NKN A;  3L74 D;  4R4L A;  5CJ4 A;  3MP7 B;  1YIJ P;  5B66 E;  2G3A A;  3L75 J;  3FWL A;  4H0L B;  2HPC A;  1DX7 A;  1M57 D;  3L70 G;  4BWN A;  3KZI H;  1JY3 O;  2E75 B;  4NPD A;  1N2D C;  2Q6Q A;  3N4X A;  1BSH A;  1JY2 P;  5APY A;  5K5G B;  2JWD A;  1YIT P;  2KLV A;  3D6Y A;  4HJG H;  1CW5 A;  1NHL A;  2POH A;  1L0N J;  2V4H A;  2R5D A;  2KYV A;  2Z5I A;  2QE7 H;  1PV3 A;  4EDF A;  1Q82 Q;  1E79 H;  1KYO D;  1JOC A;  1SQX E;  2YO3 A;  3B5N B;  1SQV D;  1P84 D;  1X8Y A;  4EYY Q;  1HBW A;  1VQ5 P;  3CX5 I;  2DW3 A;  3BCC J;  3H1J D;  3TNU B;  3G3Z A;  3KQG A;  3MD0 A;  5KAI H;  1NVO A;  3MZW B;  1FAV A;  2ZYD A;  3IF4 A;  3BRV B;  5KLV J;  4XA4 A;  1J1D B;  1SQV K;  3MHV A;  2ZT9 D;  2FYZ A;  1SFC B;  1GDT A;  3ITK A;  2A45 I;  1KIL A;  2KK7 A;  2KUB A;  1BGY E;  3L73 E;  2QJY C;  4H0L D;  1PPJ G;  3H1L J;  2WPQ A;  5CBN A;  1OWA A;  3RK2 D;  3L71 J;  2NPS B;  2QJK B;  2XZR A;  3ABV C;  1S5L H;  2HOD A;  1KFN A;  3O8Z A;  3WUU A;  3ZDM A;  2M5A A;  4ZMD A;  2WSE J;  1DEB A;  2K9J A;  3SWK A;  1USE A;  1NGM B;  2D2C D;  1N7S D;  4LC1 A;  3S9O A;  3CCE P;  1YTZ T;  1URQ B;  4GIF A;  2KOG A;  1H89 A;  3WU2 H;  3H1I E;  2ITA A;  3SWY A;  1ZME C;  3AEC C;  1LT9 C;  3P8C E;  2W6B A;  1PGO A;  1RE4 A;  2XU6 A;  3EWK A;  1SQX K;  5GTI E;  4BRY B;  1JUN A;  3H1L E;  1BGY D;  1PZQ A;  3L73 D;  5KLV D;  3VP8 A;  4YTP C;  2RMZ A;  3GHG B;  1OMI A;  3HE4 B;  3R4Y A;  5AVV B;  3HTK B;  2P10 A;  1U57 A;  3VTP C;  2WTY A;  1JCD A;  1EXJ A;  3SSU A;  1PFI A;  3H1L D;  1NTZ D;  1QEX A;  1CI6 B;  1SQV G;  1NU1 E;  1KTM A;  1Q7Y Q;  3CCV P;  3WU2 E;  3L72 J;  3RL0 B;  3AEB C;  4L75 A;  2KZJ A;  2ZXE B;  3HD7 D;  4OVN F;  1OW7 A;  1ZR4 A;  3CMA P;  2IFN A;  3A3Y B;  4I7Z C;  2W6A A;  1BSN A;  1J1D C;  3FXD A;  1H0T B;  3B4S A;  1GL2 C;  3RL0 D;  1HTL C;  3P8M C;  1EXI A;  1KB9 E;  2FYU D;  1FZG A;  3V4W A;  3M06 A;  2P1J A;  1X79 B;  1SQB E;  1FZC B;  1PP9 D;  4Y99 B;  1GK4 A;  1RF0 A;  3FXE A;  1XTG B;  3RK3 E;  3HUS A;  1ZV8 A;  3HE5 A;  4N78 E;  5APU A;  3A0H H;  3CXH D;  4XE5 B;  4R4M A;  5AW4 B;  1GD2 E;  2R5B A;  3JC2 2;  1FU1 A;  1P84 H;  3L37 A;  2IYP A;  1S5L X;  3A0B E;  2NRG A;  3CLQ A;  1KFM A;  4PD4 E;  2E75 C;  3AE6 C;  3SFE C;  1VL2 A;  4D6T D;  4DJG A;  1M90 Q;  5AVR B;  3M0D C;  3H1J E;  2GM4 A;  4L74 A;  2KNC B;  1YJ9 P;  1BE3 G;  4GOE A;  1P84 E;  3G71 P;  2YKO A;  1BCC G;  4I2L C;  1X0T A;  1LTT C;  2A06 E;  2ZVO B;  5AVX B;  3G6E P;  1HF9 A;  1LTJ B;  1N7S B;  4KJM A;  3H25 A;  2IFM A;  1JEK A;  1M56 D;  2RH0 A;  2XKM A;  3BCC E;  3H1H G;  1NTM D;  1SQQ D;  4PV1 C;  4IL6 H;  1LTG C;  2OQQ A;  3L72 E;  4HKZ H;  2Y9Z A;  2Y0C A;  3PHL A;  4LGD E;  2I1K A;  2HR3 A;  3L75 G;  2FY8 A;  1SP4 A;  3KXD A;  3CX5 D;  3TDK A;  1FJP A;  5AW1 B;  4N3Y B;  1N8R Q;  5BU8 B;  2BAS A;  5GTH E;  1KC8 Q;  2WVR A;  5GTI H;  4IFD K;  1SQP K;  1FC2 C;  1KYO I;  2FYU E;  2NZ2 A;  3MIW A;  3C9I A;  1RF1 A;  2WSS H;  3M0A A;  5CCH A;  2N9B A;  4OGQ C;  1ZR2 A;  1JY2 O;  1ZLL A;  3AE7 C;  3HD7 A;  1W5C E;  5AVZ B;  4PJ0 E;  2OYI C;  1JMM A;  1LWU A;  3U59 A;  1LTS C;  1T8Z A;  3OA7 A;  2V7Q H;  4OGQ B;  3L72 D;  1LP1 A;  2YMK A;  3CWB E;  3GMA A;  3OJA B;  1J2J B;  2HFE D;  3MGN A;  1KOR A;  1S3J A;  4TT3 H;  1A02 F;  1KQL A;  4ASW A;  4D6T E;  1IFI A;  1SQB K;  1IC2 A;  1M1J A;  5TIS E;  4D6T G;  2WPV B;  3BVH A;  2FFD A;  1FOS F;  2N1T A;  5EFW B;  2WSF J;  3EQ2 A;  3V5B A;  1S9K E;  2B9B A;  2IBZ D;  1SQV J;  4YPC A;  2WWW A;  2JO1 A;  3H32 A;  1EC5 A;  3L75 E;  5CJ0 A;  3AE2 C;  1BGY G;  1JMB A;  2QVA A;  3L73 G;  3SWF A;  5C39 A;  1USD A;  4CPG A;  3HD7 C;  1VQ7 P;  3RBX A;  2QEX P;  4XFJ A;  1NJI Q;  2K88 A;  3GW6 A;  3I56 P;  3BAT A;  1QGK B;  5DJU B;  1NYH A;  1YQ4 C;  2L91 A;  1W2E A;  1OVU A;  2N1T B;  3B5N A;  1SQB J;  4JQ0 D;  3CXH E;  1Y8A A;  1Q2N A;  4A7P A;  1VPC A;  2H89 C;  3JSV C;  3JCU E;  5KAI E;  1VQN P;  3L75 D;  1G1J A;  1FDI A;  2WIT A;  2RN0 A;  3CX5 E;  1J1E C;  1Q90 D;  4WWI A;  5KLV K;  2K3R A;  3CCL P;  2JR8 A;  3PH0 A;  4KT0 J;  2H43 A;  1JCC A;  1NU1 J;  3V2Q A;  2KXP B;  4N6J A;  2JJL A;  2O01 J;  2K9J B;  2OAR A;  2ZVN B;  3AEE C;  3W68 A;  2A06 G;  2QM8 A;  5AVY B;  1AJY A;  4BXL A;  2FYN B;  2FFD C;  1FS0 E;  1L4A A;  3PTZ A;  1BE3 E;  1KMI Z;  5APQ A;  3VMX A;  1QVF O;  1KN7 A;  4OGQ D;  1CZQ A;  1S1C X;  1MKM A;  3VOP A;  3H1J G;  3OW2 O;  1SQB G;  4U3F D;  5CCH D;  1NTZ J;  1S2E A;  5B66 H;  3RGU A;  2E5Y A;  4I7Z B;  5AVT B;  1E5W A;  2Y9Y A;  3Q5P A;  1X22 A;  1YJN P;  3AEG C;  1A02 J;  1VQL P;  4OH8 B;  1AFO A;  2HG5 D;  3TGU J;  3CPW O;  3MUD A;  2B89 A;  2O3J A;  2K37 A;  2IDB A;  3V2R A;  1VQ6 P;  2K9Y A;  5APW A;  3WMM 0;  1NTK D;  5CCH C;  4HH2 A;  3CCR P;  1N73 C;  1L0N D;  1PP9 J;  4RO0 A;  3AE4 C;  3VP9 A;  1FOS E;  1GK6 A;  4UB6 H;  1N7L A;  4Z1M H;  4RES B;  1KIL B;  1MZ9 A;  3L4F A;  1JY3 N;  4GOD A;  3U1C A;  4GOF A;  5H2F E;  2P7J A;  1ZXG A;  2P67 A;  2XND H;  1ZN5 A;  2OYH A;  1URQ C;  1S72 P;  2KZI A;  2O01 H;  3A0B H;  1MFT A;  3VMA A;  3CC7 P;  1MFZ A;  3G9R A;  1VQP P;  2WSC H;  1Z56 A;  1KYO E;  1PGP A;  1SQP J;  1SQX D;  2BCC E;  2PGD A;  3E7K A;  3M9B A;  4Y28 J;  5GTH H;  2N1T D;  3LW5 H;  3H1H D;  1L0L K;  1TU3 F;  3MTU E;  5KKZ C;  1HJB A;  3CWB G;  4D6T J;  2HPC B;  1BE3 J;  3H1L G;  2LXC B;  3L36 A;  3RK3 B;  4DCK A;  3UIA A;  1IFP A;  5AW5 B;  5KJ7 D;  4O9B A;  3RK3 D;  1T2K C;  1SQP G;  2WSC J;  1NTM K;  1L0L D;  1SQQ K;  1M1J B;  4IFF A;  1HUC A;  3KYQ A;  4YXD C;  1YQ3 C;  2ZXX A;  3U1A A;  1OVR A;  3WUT A;  3CD6 P;  1QVG O;  1FDM A;  5L8R J;  2WT7 A;  1SVF A;  1QL1 A;  2XDJ A;  3GG2 A;  3HUS C;  4WY4 A;  2H7H A;  3L74 E;  1GW3 A;  1VF5 B;  2D2C B;  3CI9 A;  4JPZ B;  1LT1 A;  3H1H J;  3S4R A;  2GUV A;  1NTM G;  1SQQ G;  4UB6 E;  5CHX A;  2OYI B;  3F89 A;  1L0L E;  1SQX J;  1SQP D;  3O6Q A;  2PP6 A;  3KHU A;  2AEF A;  5APT A;  1GL2 A;  3V6I A;  3HRN A;  4YXW H;  2R32 A;  5AW9 B;  2D2C C;  2AXC A;  4C7N A;  1BE3 D;  3E1I A;  5KJ7 C;  1FZB A;  1RE3 C;  3V2N A;  4QMA A;  1VF5 D;  2KB7 P;  1KIL D;  3M9H A;  3P8C D;  1K04 A;  1FZF A;  2HOD B;  3TGU D;  2FFD B;  1HWT C;  1YBK A;  4H0L C;  4KHX A;  1NOH A;  2B88 A;  4I6M C;  3AE5 C;  5APX A;  1RE4 C;  3O6Q B;  1G1I A;  3GHG A;  1JM0 A;  1WT6 A;  1LT9 A;  3L35 A;  2OTL P;  1X9V A;  3HD7 B;  1LTJ C;  1N7S C;  2M8R A;  2Q5U A;  4PV1 B;  5TIS H;  3SFD C;  3CME P;  1HVV A;  3L70 E;  2V7Q J;  4W7Y A;  1G2C A;  1H8A A;  2IZ0 A;  1IK9 A;  2E43 A;  4WVZ A;  3CC4 P;  2O1K A;  3FGA D;  3VMY A;  2SPZ A;  1SQB D;  2ZT9 B; 
#chains in the Genus database with same CATH homology
 5APS A;  1FBM A;  1J1E B;  1CI6 A;  1YYC A;  4AYC A;  2W27 A;  2R3C A;  2KP8 A;  1JO5 A;  5CCG A;  1N73 A;  3HE5 B;  5AW7 B;  4C46 A;  4DOJ A;  4Y99 C;  1WRG A;  2WZ7 A;  1LTA C;  2FYU K;  1LWU B;  1HGV A;  1JTH A;  1URQ A;  2WSE H;  2C0W A;  4WY4 D;  2Z5H A;  4W80 A;  3TYY A;  3N7N A;  4W7Z A;  2YKQ A;  2CPS A;  2KSJ A;  4LLH A;  1GL2 D;  3RL0 C;  2FFD B;  2O1J A;  5CCG C;  3H6P A;  2WPR A;  3TK1 A;  3A2A A;  1CSB A;  5AW0 B;  2P2U A;  2L5G B;  1LTJ A;  1N7S A;  5BVZ A;  1RF0 C;  5AVW B;  2IPP A;  3M91 A;  4M3L A;  3HUS B;  3R2P A;  1SFC A;  3VYI A;  4GT1 A;  1FZC A;  2WT7 B;  3OAK A;  1GU4 A;  2OYI A;  3RK2 B;  2XNX A;  3IR9 A;  4JYB A;  3RK3 C;  1T2K D;  1RF1 B;  3HTK A;  3EFG A;  3A5T A;  3BAS A;  4HYT B;  4WB4 A;  3P32 A;  5AVQ B;  2OYH B;  1GZL A;  1NH4 A;  2Q9I A;  4AUW A;  3VN0 A;  1M7L A;  1JY3 P;  4WY4 C;  2Z4E A;  2IX7 C;  2YNY A;  1FJK A;  2YMY A;  2QM7 A;  4ZKP A;  1VDF A;  2FXM A;  2E42 A;  1MV8 A;  1AQ5 A;  2J58 A;  1G2C B;  1KIL C;  2N1T C;  3M0D A;  2NPS A;  1SLQ A;  4DZO A;  3V4Q A;  1T3J A;  4ZKU A;  1RE3 A;  3NFQ A;  2Q7C A;  1NWQ A;  1GU5 A;  1LTB C;  1RF1 C;  1DH3 A;  1IFN A;  5AW6 B;  5BU5 A;  1MUU A;  3BRT B;  1NAF A;  2Q3I A;  1RY3 A;  3II6 A;  3I5C A;  1NO4 A;  3GHG C;  1L4A B;  2WPS A;  1HGZ A;  2H8P D;  2YO2 A;  3A7O A;  4JYC A;  2A45 H;  2NPS D;  2WSF H;  1L0N K;  1NTK K;  1NU1 K;  2JEE A;  1S9K D;  3NTN A;  5KJ7 A;  1QL2 A;  5AVS B;  1URQ D;  1IFJ A;  3KPE A;  2YKP A;  5CMZ A;  5CCG D;  4B86 A;  2M3B A;  1FZE A;  4WBA A;  2C0X A;  4C7R A;  4EIJ A;  4JF7 A;  1H88 A;  3VMZ A;  4I1L A;  2J59 M;  3T97 A;  3PP5 A;  2GUS A;  2PAJ A;  1N73 B;  1JTH B;  1OXZ A;  3TNU A;  3B5N C;  3NXS A;  1LT9 B;  3TSI A;  4AQR D;  1XTC C;  2XV5 A;  3H32 B;  1IFD A;  5AVU B;  3P7K A;  1IO4 A;  1GTW A;  1EQ7 A;  5AW2 B;  3IFM A;  1GW4 A;  1JY2 N;  3M9Q A;  2HYN A;  2NPS C;  2C9L Y;  2C9N Y;  1NTZ K;  2VRS A;  3RK2 C;  1L4A D;  1GL2 B;  1LGH B;  1IFM A;  1T3U A;  3B5N D;  3CL3 D;  1LWU C;  3LIE A;  2LKM A;  5AW8 B;  2I1J A;  1JNM A;  1IJD B;  3HE4 A;  4EOT A;  2MJZ A;  2A45 G;  4C7N B;  3LID A;  2HLO A;  2FKW B;  4N78 D;  1HH0 A;  1NKZ B;  1KZU B;  3KDP B;  5KTB A;  3B8E B;  1SFC D;  1L4A C;  1YTZ I;  2OYH C;  4IFM A;  4WY4 B;  5APV A;  2ZFC A;  1M1J C;  3V2P A;  1LTI C;  4GKG A;  1FZC C;  1FZA A;  1SFC C;  3NMD A;  1N86 A;  2CPB A;  5CJ4 A;  1NKN A;  1DX7 A;  2HPC A;  1JY3 O;  1N2D C;  3N4X A;  1JY2 P;  5APY A;  2KLV A;  1CW5 A;  1NHL A;  2POH A;  2R5D A;  2KYV A;  2Z5I A;  2YO3 A;  1JOC A;  3B5N B;  1X8Y A;  1HBW A;  3TNU B;  3G3Z A;  3KQG A;  3MD0 A;  1FAV A;  3BRV B;  4XA4 A;  1J1D B;  1SQV K;  2FYZ A;  1SFC B;  1GDT A;  2A45 I;  1KIL A;  2WPQ A;  1OWA A;  3RK2 D;  2NPS B;  2XZR A;  2HOD A;  1KFN A;  3O8Z A;  1DEB A;  4LC1 A;  1N7S D;  1YTZ T;  1URQ B;  4GIF A;  2KOG A;  1H89 A;  3SWY A;  1LT9 C;  3P8C E;  2W6B A;  1RE4 A;  2XU6 A;  1JUN A;  1SQX K;  3VP8 A;  3GHG B;  3HE4 B;  3VTP C;  5AVV B;  3HTK B;  2WTY A;  1PFI A;  1JCD A;  1CI6 B;  3RL0 B;  2ZXE B;  3HD7 D;  1ZR4 A;  2IFN A;  3A3Y B;  2W6A A;  1J1D C;  1GL2 C;  3RL0 D;  1HTL C;  3P8M C;  1FZG A;  3V4W A;  3M06 A;  2P1J A;  1X79 B;  1FZC B;  4Y99 B;  1GK4 A;  1RF0 A;  1XTG B;  3HUS A;  1ZV8 A;  3HE5 A;  4N78 E;  5APU A;  4XE5 B;  5AW4 B;  2R5B A;  1FU1 A;  3L37 A;  3CLQ A;  1KFM A;  5AVR B;  3M0D C;  2GM4 A;  2YKO A;  4I2L C;  1LTT C;  5AVX B;  1LTJ B;  1N7S B;  2IFM A;  2XKM A;  1LTG C;  4LGD E;  2I1K A;  1SP4 A;  1FJP A;  5AW1 B;  4N3Y B;  5BU8 B;  2BAS A;  4IFD K;  1SQP K;  3MIW A;  3C9I A;  1RF1 A;  3M0A A;  5CCH A;  2N9B A;  1ZR2 A;  1JY2 O;  1ZLL A;  3HD7 A;  5AVZ B;  2OYI C;  1JMM A;  1LWU A;  3U59 A;  1LTS C;  1T8Z A;  3OA7 A;  3OJA B;  1J2J B;  2HFE D;  1A02 F;  1KQL A;  1IFI A;  1SQB K;  1IC2 A;  1M1J A;  2FFD A;  3BVH A;  1FOS F;  2N1T A;  3EQ2 A;  3V5B A;  1S9K E;  2WWW A;  5CJ0 A;  3H32 A;  3SWF A;  3HD7 C;  3BAT A;  2N1T B;  1W2E A;  3B5N A;  1VPC A;  1G1J A;  2WIT A;  1J1E C;  5KLV K;  2H43 A;  1JCC A;  3V2Q A;  4N6J A;  2JJL A;  2OAR A;  2QM8 A;  5AVY B;  2FFD C;  1L4A A;  5APQ A;  3VMX A;  1CZQ A;  3VOP A;  5CCH D;  5AVT B;  1E5W A;  1AFO A;  1A02 J;  4OH8 B;  2HG5 D;  3MUD A;  3V2R A;  5APW A;  3WMM 0;  5CCH C;  4HH2 A;  3VP9 A;  1FOS E;  1GK6 A;  1N7L A;  4RES B;  1KIL B;  1MZ9 A;  3L4F A;  1JY3 N;  3U1C A;  2P7J A;  2P67 A;  2OYH A;  1ZN5 A;  1URQ C;  2O01 H;  1MFZ A;  2WSC H;  1Z56 A;  3M9B A;  5AW3 B;  1N73 C;  1HJB A;  2N1T D;  3LW5 H;  1L0L K;  3MTU E;  2HPC B;  3L36 A;  3RK3 B;  3UIA A;  5AW5 B;  5KJ7 D;  4O9B A;  3RK3 D;  1T2K C;  1NTM K;  1SQQ K;  1M1J B;  4IFF A;  1HUC A;  3KYQ A;  3U1A A;  1FDM A;  2WT7 A;  1SVF A;  1QL1 A;  2XDJ A;  3HUS C;  4WY4 A;  2H7H A;  1GW3 A;  3CI9 A;  2OYI B;  2GUV A;  5CHX A;  2PP6 A;  5APT A;  1GL2 A;  3HRN A;  2R32 A;  5AW9 B;  4C7N A;  3E1I A;  5KJ7 C;  1FZB A;  1RE3 C;  3V2N A;  1GD2 E;  2KB7 P;  1KIL D;  3M9H A;  3P8C D;  1FZF A;  2HOD B;  1HWT C;  4KHX A;  1NOH A;  4I6M C;  5APX A;  1RE4 C;  1G1I A;  3GHG A;  1WT6 A;  3L35 A;  1LT9 A;  1X9V A;  3HD7 B;  1LTJ C;  1N7S C;  2M8R A;  2Q5U A;  1HVV A;  4W7Y A;  1G2C A;  1H8A A;  1IK9 A;  2E43 A;  2O1K A;  3VMY A;  3MGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...