1IFNA

Two forms of pf1 inovirus: x-ray diffraction studies on a structural phase transition and a calculated libration normal mode of the asymmetric unit
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOVIRUS
publication title Two Forms of Pf1 Inovirus: X-Ray Diffraction Studies on a Structural Phase Transition and a Calculated Libration Normal Mode of the Asymmetric Unit
pubmed rcsb
source organism Pseudomonas phage pf1
molecule tags Virus
total genus 21
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1994-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ifnA00
1ZN5A 2XKMA 1PFIA 1QL2A 1QL1A 2KLVA 2IFNA 3IFMA 2IFMA 1IFMA 2KSJA 1IFNA 4IFMA
chains in the Genus database with same CATH superfamily
2R44A 3A5TA 1ZP0C 3RL0B 1RH5B 2AEMA 2I1JA 3L36A 1KB9D 1PFIA 1XTGB 1Y8AA 5AVZB 2W6JH 1SFCC 3RL0C 4H13D 5KJ7C 2ZT9C 3CWBD 1PP9J 2RH0A 3TF5A 2GUVA 1IZNB 2KZJA 1J1DB 3H1HG 3M06A 3Q1MA 3BCCJ 1JY2P 1RY3A 1G2CA 2KLUA 1AV1A 3TNUB 1JUNA 1OW6A 1FDOA 1RF1A 1FJKA 1LGHB 3EWKA 4WY4A 3AE8C 3CXHE 3K5BA 1KILE 5H2FH 3WUTA 4L75A 1AFOA 1S72P 1BGYE 5AW9B 2CK3H 3CCLP 3AEDC 1SQXK 3B5NC 3VN0A 2KS1B 3H1JJ 1FDIA 1BE3J 4A7PA 3M91A 3GF3A 2WPRA 1P84E 2JR8A 3CI9A 1G1JA 1DEBA 4U3FG 3CXHD 1KILD 3NTNA 1KQFB 1NTZE 2E76D 1BGYD 3L73G 1LWUB 5BU5A 1A02F 5AW8B 5K5GB 1ZRTE 4H0LB 3LW5H 2M3BA 3H1IE 3LIDA 4H44B 3RK3C 3CPWO 2KZIA 5KAIE 1P84D 3JSVC 3MHVA 1IFIA 5AW6B 2IBZG 1MFZA 1P84H 3CX5I 4NPEA 1JOCA 1PGPA 3E1RA 1NTZD 1LTGC 5TISH 1N7LA 4HYTB 1NTKK 2J58A 3CC4P 3B4SA 1UIXA 1S4XA 2K9JA 1ZRTD 3AE3C 3H1ID 3C9IA 1SQBE 3H32B 3AE7C 3H1HJ 3P8CD 1L0NE 1RF1C 4Y99B 3EQ2A 5KAIH 2IFNA 5AW0B 2NRGA 3TYYA 5CJ4A 1MZ9A 3V4QA 2QJYC 2N1TD 4WY4C 1W2BO 1S5LE 1L0NK 2E42A 1VQ6P 4JBZA 4Y99C 1R8EA 4HJGH 1NOHA 1HTLC 2D2CB 4JYBA 1SQBD 2IYOA 3RK2D 2K3RA 1N8RQ 1JCCA 4DJGA 1GDTA 1KZUB 1FZCB 1KILA 1E5WA 1HF9A 3AEAC 2JKVA 3PTZA 4XFJA 2D2CC 4OVNF 2I1KA 2K9YA 1W2EA 2QA4P 1EXIA 3LIEA 5APWA 3RBXA 3FWNA 4KJMA 4OH8B 4U3FJ 4ZKPA 4D6TE 1ZOYC 4MN4C 1JY2O 1RQUA 5B66E 1RQVA 2QVAA 3L73J 2LR2A 2W6BA 3KHUA 4AQRD 2PRRA 2IBZI 4R4LA 4PV1C 1LTJB 5CCGD 4L73A 1ZR4A 2B9BA 2OYHB 2JWAA 4K3AA 2JO1A 1YTZT 2K1AA 3AEGC 1L4AD 1VQ9P 1URQD 1IK7A 3H1LG 1NTMG 3F89A 2LXBA 3D6YA 1Y9BA 3G9RA 3I56P 1GW3A 1KYOE 1CI6A 2IX7C 2N1TA 3BCCE 1M1JB 3AECC 1SS1A 1QEXA 2KUBA 2WSCH 4L76A 1HH0A 4RESB 2ZYAA 1OVUA 3MZWB 4I6MC 3WMM0 1OW8A 2K37A 1VQKP 3E1IA 1GW4A 2BCCG 1J1EB 3M9HA 1K8AQ 3V2NA 1IK9A 1FOSE 1L0LE 1SQPG 1KYOD 2OYIA 2ITAA 3H1KE 4UB8E 2E75D 4PJ0E 1KYOH 1J1EC 2M0BA 2C9LY 2PGDA 1RE4A 5B5EE 1FAVA 3HTKB 3U1CA 2FBWC 5GTHE 1K73Q 1MV8A 1EDJA 3L71D 3IN6A 1H89A 2IDBA 2XNXA 1M8OB 1DD3A 4QMAA 1FU1A 4WB4A 5KLVG 1L0LD 1JY3N 1SQVE 4CPGA 1PGJA 4N78E 4Z1MH 3H1KD 1DD4A 3HD7B 3G3ZA 2ZYDA 4UB8H 3R4YA 4H0LD 4PJ0H 4EYYQ 2R3CA 1YHQP 1L4AA 2G8YA 4LC1A 1URQA 3CC7P 1YJNP 3GHGB 5DJTB 2J59M 1QL2A 1S5LX 1QL1A 3HD7C 3KXDA 3HE4A 2H8PD 1ZN5A 5B5EH 4JF7A 2E74C 2JWDA 5GTHH 1HGZA 1NVOA 4OGQB 3B8EB 2BASA 4HH2A 1SQVD 4N78D 4GKGA 2W27A 2I8DA 3SWKA 5GTIH 4WVZA 3H1LJ 1N73B 1NTMJ 2FYNB 1X79B 1H0TB 2N1TC 4RJTA 1Q82Q 1SQQG 3OJAB 1GK4A 1BCCD 2Y0EA 1EZVD 2YXRB 2N9BA 2AEJA 3L72G 2M5AA 2OTLP 1OX3A 3WUUA 1VQNP 3O6QB 1VF5D 2FY8A 1FS0E 1PPJG 1PGOA 4EOTA 4C7NA 3TDKA 3QWOC 1IFJA 3TGUD 1AQTA 2OYIC 1FBMA 4EDFA 3PLNA 2WT7A 3L74E 2JDIH 1NHLA 2BCCJ 3L70G 4L74A 2FXOA 4EIJA 2A45G 5AVYB 2NPSD 3CX5H 3FXDA 1SFCB 1NU1G 1SQPJ 2L91A 1LJ2A 3VYIA 3CCRP 2YXQB 2P1JA 2FYUE 2ZT9B 2Q3EA 1KFNA 5CHXA 2WSFJ 3CCSP 4BWNA 4I7ZC 1PGQA 2FYUK 2SPZA 5H2FE 4ZMDA 1EZVG 1LP1A 1JMMA 3IAOA 2FYZA 2V7QJ 3L74D 2WZ7A 3AE6C 1GL2A 4W80A 1YYCA 2HLOA 5KLVJ 3U59A 4LLHA 3PRJA 1LT9A 3NFQA 1GMJA 2FYUD 1L4AC 2P58A 2B87A 1NO4A 1PV3A 1AVOA 5CCHD 1OWAA 4BRYB 1Y47A 1N7SD 3JCUH 1T6AA 1MKMA 3B5NB 1JTHB 1SQXE 3S9OA 1KC8Q 3HUSA 3KQGA 2IBZE 2O01J 3N7NA 2IZ1A 3CWBG 1JCDA 3ABVC 2Z4EA 2Q3IA 3KZIE 1NAFA 3D6ZA 1KFMA 3CLQA 5APTA 3RGUA 2JJLA 3AE4C 1KQGB 1JNMA 2A06E 5E79E 1X8YA 3SFEC 1SQQJ 3HE5A 3P32A 5TISE 1ZW0A 3M9BA 3GG2A 1SQXD 1NGMB 3PJSK 1EQ7A 2P67A 1ZLLA 3RK3B 3L72J 2W83C 2NPSA 2A45I 2WPQA 3Q2YA 2N9YB 3D70A 1PZQA 3M0DC 3GW6A 3C8VA 3KZIH 1QVGO 1NJIQ 3CMAP 3A7OA 1QGKB 5AVXB 2FFDA 2A06D 3OAKA 3R2PA 4O9BA 3MTUE 3L70J 3SSUA 2V4HA 5E79H 2Z5HA 1IC2A 1T2KC 2MJZA 2KSEA 1CSBA 3TK1A 1NU1J 3F5HA 3BRVB 3AE9C 1NTKE 1GL2B 3T97A 1G2CB 1LT9B 1NH4A 1GD2E 4W7ZA 1IFDA 1BGYG 1OVVA 1RF1B 2KNCA 2XDJA 1GL2C 1X22A 5CCHA 3PHLA 2UWJE 1LT9C 5TJHA 2JEEA 2YIUC 2QJYB 4WY4B 1N7SA 3OA7A 1KB9I 3E7KA 3CCUP 2XU6A 2O01N 5APSA 1NTKD 1QLED 2IFMA 3VMZA 1VQLP 1IFNA 4PD4E 1NTZG 2FXMA 1Q90D 3AE2C 2WQYC 4R4MA 2KI7B 1UIIA 2E5TA 3USSA 2KXPB 4OGQD 3MUDA 5APXA 5AW2B 1BSNA 2YNYA 1KN7A 3HRNA 3L75E 4IFMA 1M56D 3CWBJ 3ITKA 1YQ3C 3H1IG 4TT3H 1NTME 1L0ND 1HVVA 2QEXP 5L8RJ 4N6JA 2OYOA 3VMYA 3SWYA 1NTMK 1VQ7P 4DCKA 4PD4D 1DEEG 1LNQA 2H43A 4ASVA 2ZVOB 4PD4H 2O1JA 3P7KA 2NPSC 2YKQA 1AA0A 2WVRA 4PV1B 3W67A 4H13B 3IFMA 3L75D 2WPVB 3FXEA 4TLFA 1T3UA 1K05A 2QM8A 3VTPC 1VQ8P 1SQBG 1WMKA 4YXWH 1G1IA 4H13C 3RBZA 2XZRA 4ZNCA 1ZR2A 2YKPA 4YTPC 3CXHI 3RL0D 2QE7H 5KJ7D 2K9JB 2ZT9D 4UB6E 1NYHA 1D7MA 1GK6A 2L5GB 4D6TD 3V4WA 2WSEH 1KTMA 1PP9E 1JY2N 1HBWA 2C0WA 1FDMA 4IFDK 1BGYJ 1VPCA 1P84I 1H8AA 2Z5IA 3LW5J 1X9VA 2AXCA 1EC5A 2GM4A 1JMBA 5KLVK 2Q9IA 4UB6H 2WSFH 3AE1C 1YITP 1PP9D 1KILB 3B5ND 3MUDC 3GF7A 1NTZJ 2WSSH 4EI2A 1WT6A 3RK3E 1XTCC 2Y0DA 3BCCD 5DJUB 5CJ0A 1QX8A 2V7QH 4GT1A 4C7RA 1KILC 3AEFC 5AVWB 3H1JE 2E76C 2Q5UA 1BE3E 1JO5A 1JY3O 1USDA 3H1IJ 1VQPP 2ZFCA 1R5LA 2QJKB 2KK7A 5APYA 2KLVA 3B71A 1AVYA 5EFWB 1NKZB 3GMAA 4IL6H 1VQMP 1S9KE 4JYCA 1NAYA 5GTIE 1SQQK 3A2AA 4YPCA 1VL2A 5CCGA 2QJKC 4C46A 3GLMA 1PPJE 1ZXGA 3H1JD 1BE3D 2E74B 1Q7YQ 1NKNA 3CCJP 4H44D 1JEKA 1SQBJ 3L70E 1JM0A 3BATA 3N4XA 3Q5SA 1BDCA 1Z56A 2RN0A 5AVRB 5AVQB 1CI6B 1U57A 2IYPA 2N1TB 1EXJA 3V6IA 5AW5B 4K35A 1EDIA 1NU1K 3L71G 1M7LA 2B89A 3TNUA 1L0LG 2P10A 2Q6QA 1K04A 3H1KG 3CX5E 2R32A 3AE5C 3Q5PA 3CL3D 2HPCA 2QM7A 4KHXA 1AJYA 3WU2E 5KAFE 3H1HE 1Q2NA 1FOSF 2XKMA 5CBNA 4B86A 4BXLA 2KB7P 2A45H 2OYIB 2QIWA 2XNDH 2B88A 3RK2C 2RKLA 3S4RA 4RKUJ 5KLIC 1HJ0A 2HG5D 1QVFO 4OWFA 1KB9E 2O3JA 2KS1A 1SQVG 3CX5D 4I7ZB 2D2CD 1TU3F 2GA1A 3H1HD 2Y9YA 5M1BA 3CCQP 3WU2H 1VQOP 2JP3A 5KAFH 1RE4C 1H88A 1AQ5A 1KV4A 4NPDA 3JCUE 1MUUA 1BCCG 1RE3A 1LWUA 1L2PA 2WSCJ 4JQ0D 5AW7B 3A0HE 2P2UA 3D71A 1L4AB 1DX7A 1URQB 4U3FE 1KYOI 5CCGC 2W8ZA 1YJWP 2OARA 1KB9H 3TGUG 4PV1D 4AUWA 3HE4B 2OTJP 5APUA 1MFTA 3L73E 5AVUB 1N2DC 2LXCB 2J5UA 1URQC 2WMMA 2KP8A 3KYQA 2KOGA 1YQ4C 4HKZH 1FZAA 3H25A 1EDKA 2HODA 1FZBA 1GZLA 4IL6X 3G71P 3P8MC 2OQQA 3H6PA 1J1DC 3L37A 1DIPA 4U3FD 2HPCB 4GOEA 3A0HH 1LTBC 2PP6A 3H32A 3BVHA 5APVA 1KORA 3V2RA 3L73D 3L74G 1YJ9P 3G4SP 1VQ5P 2C0XA 1GU4A 3L71J 1ZMEC 4WBAA 2M5AB 1R5SA 1L0LJ 2AXTE 2Y9ZA 1S1CX 2FYUG 2YMKA 3H1KJ 2WTYA 2E75B 5AW1B 4C7NB 1SVFA 3CC2P 2PFXA 2WT7B 2ZAEB 2WWWA 2YO2A 3Q3DA 2DW3A 2IBZD 1NWQA 2E75C 2RMZA 1LTTC 2M3EA 1N86A 1FZCA 2QG4A 4W7YA 3CXHH 1LP1B 1SQVJ 3MP7B 4N3YB 1S2EA 1CW5A 2AXTH 2CPSA 3I5CA 1EZVI 2M8RA 1NTZK 2OGUA 3MIWA 3A0BE 2AEFA 1KMIZ 1RE3C 1JY3P 1LWUC 1VDFA 1RF0A 2YIUB 1BCCJ 1SQXG 3P8CE 2E5YA 4KT0J 4H0LC 2B87B 4M3LA 2KIKA 3ZDMA 1USEA 4H44C 2Q7CA 4I1LA 2HODB 1LT1A 1LTJA 3HD7D 4IOIH 3TGUJ 2A06G 2OYHA 3HUSB 2H7HA 2E74D 5AW3B 4NPFX 5BVZA 3A0BH 3CD6P 1YTZI 5APQA 3AEBC 2W6AA 1ZV8A 3RL0g 3HUSC 3V2QA 1BSHA 1SQBK 4AYCA 1BDDA 1IO4A 3L4FA 3I55P 1VF5B 1S3JA 3HE5B 1M1JA 1K9MQ 1JB0J 1OVRA 3H1LE 1U7JA 3C1LA 2ZJSE 1W5CE 2K88A 4LGDE 4RO0A 3L74J 1VF5C 1PIXA 1YI2P 1E79H 2NPSB 3A3YB 1OW7A 2R5DA 2WPSA 2BEZF 4ZKUA 2FXPA 2FYUJ 3VP8A 1NTKG 1FC2C 4DOJA 2G3AA 4HB1A 4DT0A 1PL5A 2W90A 1Q86Q 2FFDB 5CMZA 1YBKA 2QSIA 3M9QA 4IFFA 2KYVA 2QJPB 1FZCC 1M90Q 1OFCX 1FJPA 5CBOA 1S5LH 4WWIA 3H1LD 4GIFA 1NTMD 1A02J 2FFDC 2BCCE 4DZOA 3T97B 2QJPC 3O8ZA 4YXDC 2CPBA 1L0NG 3HTKA 3KDPB 1SQPE 1SFCD 4Y28J 1EDLA 3EFFK 2LKMA 2KNCB 1HGVA 1RF0C 2QRXA 1CZQA 1SQPK 2GUSA 2XV5A 3FX0A 2H88C 3IF4A 1N7SB 1VQ4P 1KQSO 4XA4A 1SLQA 3CCMP 3KPEA 1Q81Q 3HD7A 5CCHC 1FZEA 1SQXJ 2HR3A 3L75G 1J2JB 1OMIA 2BCCD 1LTJC 1N7SC 2P7JA 3GHGA 1HJBA 3BASA 2ZXEB 5KLVE 1SQPD 2OYHC 3NXSA 1X0TA 5B66H 3MD0A 1RHZB 1FZFA 3BRTB 1YIJP 3VMAA 3JC22 4IL6E 2FKWB 1FZGA 2VRSA 3S1KA 4D6TG 3SWFA 3CCVP 3SFDC 1N73A 1H0TA 2E76B 5AVTB 3UIAA 1T8ZA 1HUCA 1M1JC 5AW4B 5KKZB 4GDOA 1GTWA 5KLVD 2POHA 3W68A 2O1KA 2H89C 3L71E 1OIPA 2PAJA 5KKZC 2MKVA 3G6EP 3O6QA 4ASWA 4JPZB 1SQQE 2ZXXA 1IFMA 2R5BA 1L0LK 1KD1Q 1HWTC 3NMDA 2R3SA 3EFGA 3IR9A 1LTSC 1NTKJ 2IPPA 1PP9G 3L72E 3CMEP 3RK3D 3Q5RA 2O01H 1SFCA 3M0AA 5KJ7A 3PP5A 1GU5A 4XE5B 1M1KQ 3BCCG 3FGAD 5C39A 1T2KD 1LTAC 1LTIC 4GOFA 1SP4A 3CCEP 4PD4I 5BU8B 1OZHA 1SQQD 4I2LC 3PH0A 1L0NJ 1KQLA 1NU1E 1SQVK 3U1AA 1S9KD 3MGNA 1FE6A 1U7MA 3FWLA 1GL2D 3L72D 1OXZA 3TSIA 1BCCE 2NZ2A 4U7JA 3QH9A 2BEQD 2Q1KA 1EZVE 3V5BA 1PPJD 4GODA 1IFPA 3GHGC 2OTKE 4BRYA 3H1JG 2ZVNB 4WY4D 3L75J 3RK2B 3L70D 1BE3G 3AEEC 3TGUE 5KLIB 2C9NY 2WITA 3OW2O 4OGQC 1NU1D 3B5NA 5KTBA 3WUVA 2YO3A 1JTHA 2IZ0A 1WRGA 2YMYA 2HFED 1IJDB 1M57D 3II6A 2ZYGA 3VP9A 5AVSB 1N73C 2FYNC 2KSJA 2WSEJ 4D6TJ 1DH3A 3VMXA 3V2PA 2Y0CA 2YKOA 3CWBE 2HYNA 1T3JA 2E43A 5AVVB 3M0DA 3VOPA 3L35A
chains in the Genus database with same CATH topology
1FAVA 3HTKB 3U1CA 3A5TA 3IFMA 4N3YB 3RL0B 1CW5A 2CPSA 3I5CA 2M8RA 1NTZK 2I1JA 3L36A 3MIWA 1T3UA 2QM8A 1MV8A 3VTPC 1PFIA 1H89A 1RE3C 1XTGB 2XNXA 1JY3P 1FU1A 1LWUC 4WB4A 5AVZB 1G1IA 1VDFA 1SFCC 1RF0A 1JY3N 2XZRA 3RL0C 4N78E 1ZR2A 2YKPA 5KJ7C 3RL0D 3P8CE 5KJ7D 3HD7B 3G3ZA 4M3LA 2GUVA 2R3CA 2Q7CA 1L4AA 1GK6A 2L5GB 4LC1A 1URQA 1J1DB 4I1LA 3GHGB 3M06A 2J59M 3V4WA 2HODB 1JY2P 1LTJA 1QL2A 1QL1A 2WSEH 3HD7C 1RY3A 1G2CA 3HE4A 2H8PD 3TNUB 1ZN5A 3HD7D 1JY2N 1HBWA 2C0WA 4JF7A 2OYHA 1HGZA 3HUSB 2H7HA 1JUNA 1RF1A 1FJKA 1FDMA 5AW3B 3B8EB 4IFDK 2BASA 5BVZA 4HH2A 1LGHB 1YTZI 1VPCA 5APQA 4N78D 4GKGA 2W27A 4WY4A 1H8AA 2W6AA 1ZV8A 2Z5IA 3HUSC 1X9VA 1N73B 3V2QA 1X79B 2GM4A 1SQBK 4AYCA 2N1TC 1AFOA 5KLVK 2Q9IA 1IO4A 3L4FA 5AW9B 2WSFH 3OJAB 1GK4A 1SQXK 3HE5B 3B5NC 1M1JA 1KILB 3VN0A 3B5ND 2N9BA 4LGDE 3M91A 1WT6A 2WPRA 1XTCC 2NPSB 3A3YB 5CJ0A 2R5DA 4GT1A 3CI9A 4C7RA 1KILC 2WPSA 1G1JA 1DEBA 4EOTA 4ZKUA 4C7NA 5AVWB 1KILD 3VP8A 1IFJA 2Q5UA 3NTNA 2OYIC 4DOJA 1FBMA 1JO5A 2WT7A 1JY3O 1NHLA 2FFDB 5CMZA 3M9QA 1LWUB 4EIJA 2A45G 4IFFA 5BU5A 2KYVA 5AVYB 1A02F 2NPSD 1SFCB 2ZFCA 3VYIA 1FZCC 2P1JA 5APYA 5AW8B 2KLVA 1FJPA 4GIFA 1NKZB 1KFNA 5CHXA 1A02J 1S9KE 2FFDC 4JYCA 3LW5H 2M3BA 4DZOA 3LIDA 1SQQK 3RK3C 3A2AA 2FYUK 3O8ZA 2CPBA 5CCGA 3HTKA 3KDPB 1JMMA 1SFCD 4C46A 1IFIA 5AW6B 1MFZA 2LKMA 2FYZA 1HGVA 1RF0C 1CZQA 1JOCA 1NKNA 1SQPK 1LTGC 2GUSA 2XV5A 2WZ7A 1N7LA 1GL2A 4W80A 1YYCA 1N7SB 2HLOA 3U59A 4LLHA 1LT9A 3NFQA 4XA4A 1SLQA 3BATA 3KPEA 1NTKK 3N4XA 2J58A 1L4AC 3HD7A 1Z56A 4HYTB 5CCHC 5AVRB 1NO4A 1FZEA 5CCHD 5AVQB 1J2JB 1OWAA 1LTJC 1CI6B 2N1TB 3C9IA 1N7SC 2P7JA 5AW5B 3GHGA 1HJBA 3BASA 2ZXEB 3H32B 1NU1K 1N7SD 2OYHC 1M7LA 3NXSA 3P8CD 1RF1C 3TNUA 3B5NB 4Y99B 3EQ2A 1JTHB 2IFNA 3MD0A 5AW0B 3TYYA 5CJ4A 3HUSA 3KQGA 2R32A 1MZ9A 3V4QA 3N7NA 2N1TD 3CL3D 1FZFA 4WY4C 2HPCA 3BRTB 1JCDA 2QM7A 1L0NK 4KHXA 2E42A 2Z4EA 2Q3IA 1FOSF 1NAFA 2FKWB 4Y99C 1FZGA 2VRSA 2XKMA 1KFMA 3CLQA 5APTA 3SWFA 4B86A 2JJLA 1N73A 1JNMA 2KB7P 2A45H 2OYIB 5AVTB 3UIAA 1T8ZA 1NOHA 1HUCA 1X8YA 1HTLC 3RK2C 1M1JC 4JYBA 5AW4B 1GTWA 3RK2D 1JCCA 2POHA 1GDTA 1KZUB 3HE5A 1FZCB 3P32A 2HG5D 2O1KA 1KILA 1E5WA 3M9BA 1EQ7A 2P67A 2PAJA 1ZLLA 2I1KA 3RK3B 2NPSA 1W2EA 2A45I 2WPQA 1IFMA 2R5BA 3M0DC 1L0LK 1HWTC 3LIEA 1RE4C 3NMDA 5APWA 1H88A 1AQ5A 3A7OA 3EFGA 4OH8B 4ZKPA 5AVXB 3IR9A 1LTSC 1MUUA 2IPPA 2FFDA 1RE3A 1LWUA 3OAKA 3R2PA 3RK3D 1JY2O 3MTUE 4O9BA 2O01H 1SFCA 2Z5HA 3M0AA 2W6BA 5KJ7A 1IC2A 3PP5A 1T2KC 2MJZA 4AQRD 1CSBA 5AW7B 3TK1A 1GU5A 4XE5B 2P2UA 1L4AB 1DX7A 1URQB 1T2KD 3BRVB 5CCGC 1LTAC 2OARA 1LTIC 1GL2B 1SP4A 3T97A 1LTJB 5CCGD 1G2CB 4AUWA 1LT9B 1NH4A 5BU8B 3HE4B 5APUA 1GD2E 4I2LC 1ZR4A 5AVUB 1N2DC 2OYHB 4W7ZA 1IFDA 1KQLA 1URQC 2KP8A 1YTZT 1SQVK 3KYQA 1RF1B 3U1AA 1L4AD 2KOGA 2XDJA 1URQD 1S9KD 3MGNA 1GL2C 5CCHA 1FZAA 1GL2D 1LT9C 2JEEA 4WY4B 2HODA 1FZBA 1OXZA 3TSIA 1GZLA 1N7SA 3P8MC 3OA7A 2XU6A 3V5BA 3H6PA 1J1DC 3L37A 3GHGC 1GW3A 2HPCB 5APSA 2IFMA 3VMZA 1CI6A 2IX7C 2N1TA 1LTBC 2PP6A 4WY4D 3H32A 3RK2B 3BVHA 1M1JB 1IFNA 5APVA 3V2RA 2FXMA 2C9NY 2WITA 2C0XA 1GU4A 3B5NA 5KTBA 2YO3A 1JTHA 2WSCH 4WBAA 1WRGA 2YMYA 2HFED 3MUDA 1IJDB 1HH0A 4RESB 5APXA 5AW2B 2YNYA 3II6A 4I6MC 3WMM0 2WTYA 3HRNA 4IFMA 5AW1B 4C7NB 1SVFA 3VP9A 5AVSB 3E1IA 1GW4A 1N73C 2KSJA 1J1EB 3M9HA 3V2NA 2WT7B 2WWWA 1HVVA 2YO2A 1IK9A 1FOSE 2OYIA 4N6JA 3VMYA 1NWQA 3SWYA 1DH3A 3VMXA 3V2PA 1NTMK 2YKOA 1J1EC 1LTTC 2HYNA 1N86A 1T3JA 1FZCA 2H43A 2E43A 5AVVB 2C9LY 3M0DA 4W7YA 3VOPA 3L35A 1RE4A 2O1JA 2NPSC 3P7KA 2YKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZN5 A;  2XKM A;  1PFI A;  1QL2 A;  1QL1 A;  2KLV A;  2IFN A;  3IFM A;  2IFM A;  1IFM A;  2KSJ A;  1IFN A;  4IFM A; 
#chains in the Genus database with same CATH topology
 2R44 A;  3A5T A;  1ZP0 C;  3RL0 B;  1RH5 B;  2AEM A;  2I1J A;  3L36 A;  1KB9 D;  1PFI A;  1XTG B;  1Y8A A;  5AVZ B;  2W6J H;  1SFC C;  3RL0 C;  4H13 D;  5KJ7 C;  2ZT9 C;  3CWB D;  1PP9 J;  2RH0 A;  3TF5 A;  2GUV A;  1IZN B;  2KZJ A;  1J1D B;  3H1H G;  3M06 A;  3Q1M A;  3BCC J;  1JY2 P;  1RY3 A;  1G2C A;  2KLU A;  1AV1 A;  3TNU B;  1JUN A;  1OW6 A;  1FDO A;  1RF1 A;  1FJK A;  1LGH B;  3EWK A;  4WY4 A;  3AE8 C;  3CXH E;  3K5B A;  1KIL E;  5H2F H;  3WUT A;  4L75 A;  1AFO A;  1S72 P;  1BGY E;  5AW9 B;  2CK3 H;  3CCL P;  3AED C;  1SQX K;  3B5N C;  3VN0 A;  2KS1 B;  3H1J J;  1FDI A;  1BE3 J;  4A7P A;  3M91 A;  3GF3 A;  2WPR A;  1P84 E;  2JR8 A;  3CI9 A;  1G1J A;  1DEB A;  4U3F G;  3CXH D;  1KIL D;  3NTN A;  1KQF B;  1NTZ E;  2E76 D;  1BGY D;  3L73 G;  1LWU B;  5BU5 A;  1A02 F;  5AW8 B;  5K5G B;  1ZRT E;  4H0L B;  3LW5 H;  2M3B A;  3H1I E;  3LID A;  4H44 B;  3RK3 C;  3CPW O;  2KZI A;  5KAI E;  1P84 D;  3JSV C;  3MHV A;  1IFI A;  5AW6 B;  2IBZ G;  1MFZ A;  1P84 H;  3CX5 I;  4NPE A;  1JOC A;  1PGP A;  3E1R A;  1NTZ D;  1LTG C;  5TIS H;  1N7L A;  4HYT B;  1NTK K;  2J58 A;  3CC4 P;  3B4S A;  1UIX A;  1S4X A;  2K9J A;  1ZRT D;  3AE3 C;  3H1I D;  3C9I A;  1SQB E;  3H32 B;  3AE7 C;  3H1H J;  3P8C D;  1L0N E;  1RF1 C;  4Y99 B;  3EQ2 A;  5KAI H;  2IFN A;  5AW0 B;  2NRG A;  3TYY A;  5CJ4 A;  1MZ9 A;  3V4Q A;  2QJY C;  2N1T D;  4WY4 C;  1W2B O;  1S5L E;  1L0N K;  2E42 A;  1VQ6 P;  4JBZ A;  4Y99 C;  1R8E A;  4HJG H;  1NOH A;  1HTL C;  2D2C B;  4JYB A;  1SQB D;  2IYO A;  3RK2 D;  2K3R A;  1N8R Q;  1JCC A;  4DJG A;  1GDT A;  1KZU B;  1FZC B;  1KIL A;  1E5W A;  1HF9 A;  3AEA C;  2JKV A;  3PTZ A;  4XFJ A;  2D2C C;  4OVN F;  2I1K A;  2K9Y A;  1W2E A;  2QA4 P;  1EXI A;  3LIE A;  5APW A;  3RBX A;  3FWN A;  4KJM A;  4OH8 B;  4U3F J;  4ZKP A;  4D6T E;  1ZOY C;  4MN4 C;  1JY2 O;  1RQU A;  5B66 E;  1RQV A;  2QVA A;  3L73 J;  2LR2 A;  2W6B A;  3KHU A;  4AQR D;  2PRR A;  2IBZ I;  4R4L A;  4PV1 C;  1LTJ B;  5CCG D;  4L73 A;  1ZR4 A;  2B9B A;  2OYH B;  2JWA A;  4K3A A;  2JO1 A;  1YTZ T;  2K1A A;  3AEG C;  1L4A D;  1VQ9 P;  1URQ D;  1IK7 A;  3H1L G;  1NTM G;  3F89 A;  2LXB A;  3D6Y A;  1Y9B A;  3G9R A;  3I56 P;  1GW3 A;  1KYO E;  1CI6 A;  2IX7 C;  2N1T A;  3BCC E;  1M1J B;  3AEC C;  1SS1 A;  1QEX A;  2KUB A;  2WSC H;  4L76 A;  1HH0 A;  4RES B;  2ZYA A;  1OVU A;  3MZW B;  4I6M C;  3WMM 0;  1OW8 A;  2K37 A;  1VQK P;  3E1I A;  1GW4 A;  2BCC G;  1J1E B;  3M9H A;  1K8A Q;  3V2N A;  1IK9 A;  1FOS E;  1L0L E;  1SQP G;  1KYO D;  2OYI A;  2ITA A;  3H1K E;  4UB8 E;  2E75 D;  4PJ0 E;  1KYO H;  1J1E C;  2M0B A;  2C9L Y;  2PGD A;  1RE4 A;  5B5E E;  1FAV A;  3HTK B;  3U1C A;  2FBW C;  5GTH E;  1K73 Q;  1MV8 A;  1EDJ A;  3L71 D;  3IN6 A;  1H89 A;  2IDB A;  2XNX A;  1M8O B;  1DD3 A;  4QMA A;  1FU1 A;  4WB4 A;  5KLV G;  1L0L D;  1JY3 N;  1SQV E;  4CPG A;  1PGJ A;  4N78 E;  4Z1M H;  3H1K D;  1DD4 A;  3HD7 B;  3G3Z A;  2ZYD A;  4UB8 H;  3R4Y A;  4H0L D;  4PJ0 H;  4EYY Q;  2R3C A;  1YHQ P;  1L4A A;  2G8Y A;  4LC1 A;  1URQ A;  3CC7 P;  1YJN P;  3GHG B;  5DJT B;  2J59 M;  1QL2 A;  1S5L X;  1QL1 A;  3HD7 C;  3KXD A;  3HE4 A;  2H8P D;  1ZN5 A;  5B5E H;  4JF7 A;  2E74 C;  2JWD A;  5GTH H;  1HGZ A;  1NVO A;  4OGQ B;  3B8E B;  2BAS A;  4HH2 A;  1SQV D;  4N78 D;  4GKG A;  2W27 A;  2I8D A;  3SWK A;  5GTI H;  4WVZ A;  3H1L J;  1N73 B;  1NTM J;  2FYN B;  1X79 B;  1H0T B;  2N1T C;  4RJT A;  1Q82 Q;  1SQQ G;  3OJA B;  1GK4 A;  1BCC D;  2Y0E A;  1EZV D;  2YXR B;  2N9B A;  2AEJ A;  3L72 G;  2M5A A;  2OTL P;  1OX3 A;  3WUU A;  1VQN P;  3O6Q B;  1VF5 D;  2FY8 A;  1FS0 E;  1PPJ G;  1PGO A;  4EOT A;  4C7N A;  3TDK A;  3QWO C;  1IFJ A;  3TGU D;  1AQT A;  2OYI C;  1FBM A;  4EDF A;  3PLN A;  2WT7 A;  3L74 E;  2JDI H;  1NHL A;  2BCC J;  3L70 G;  4L74 A;  2FXO A;  4EIJ A;  2A45 G;  5AVY B;  2NPS D;  3CX5 H;  3FXD A;  1SFC B;  1NU1 G;  1SQP J;  2L91 A;  1LJ2 A;  3VYI A;  3CCR P;  2YXQ B;  2P1J A;  2FYU E;  2ZT9 B;  2Q3E A;  1KFN A;  5CHX A;  2WSF J;  3CCS P;  4BWN A;  4I7Z C;  1PGQ A;  2FYU K;  2SPZ A;  5H2F E;  4ZMD A;  1EZV G;  1LP1 A;  1JMM A;  3IAO A;  2FYZ A;  2V7Q J;  3L74 D;  2WZ7 A;  3AE6 C;  1GL2 A;  4W80 A;  1YYC A;  2HLO A;  5KLV J;  3U59 A;  4LLH A;  3PRJ A;  1LT9 A;  3NFQ A;  1GMJ A;  2FYU D;  1L4A C;  2P58 A;  2B87 A;  1NO4 A;  1PV3 A;  1AVO A;  5CCH D;  1OWA A;  4BRY B;  1Y47 A;  1N7S D;  3JCU H;  1T6A A;  1MKM A;  3B5N B;  1JTH B;  1SQX E;  3S9O A;  1KC8 Q;  3HUS A;  3KQG A;  2IBZ E;  2O01 J;  3N7N A;  2IZ1 A;  3CWB G;  1JCD A;  3ABV C;  2Z4E A;  2Q3I A;  3KZI E;  1NAF A;  3D6Z A;  1KFM A;  3CLQ A;  5APT A;  3RGU A;  2JJL A;  3AE4 C;  1KQG B;  1JNM A;  2A06 E;  5E79 E;  1X8Y A;  3SFE C;  1SQQ J;  3HE5 A;  3P32 A;  5TIS E;  1ZW0 A;  3M9B A;  3GG2 A;  1SQX D;  1NGM B;  3PJS K;  1EQ7 A;  2P67 A;  1ZLL A;  3RK3 B;  3L72 J;  2W83 C;  2NPS A;  2A45 I;  2WPQ A;  3Q2Y A;  2N9Y B;  3D70 A;  1PZQ A;  3M0D C;  3GW6 A;  3C8V A;  3KZI H;  1QVG O;  1NJI Q;  3CMA P;  3A7O A;  1QGK B;  5AVX B;  2FFD A;  2A06 D;  3OAK A;  3R2P A;  4O9B A;  3MTU E;  3L70 J;  3SSU A;  2V4H A;  5E79 H;  2Z5H A;  1IC2 A;  1T2K C;  2MJZ A;  2KSE A;  1CSB A;  3TK1 A;  1NU1 J;  3F5H A;  3BRV B;  3AE9 C;  1NTK E;  1GL2 B;  3T97 A;  1G2C B;  1LT9 B;  1NH4 A;  1GD2 E;  4W7Z A;  1IFD A;  1BGY G;  1OVV A;  1RF1 B;  2KNC A;  2XDJ A;  1GL2 C;  1X22 A;  5CCH A;  3PHL A;  2UWJ E;  1LT9 C;  5TJH A;  2JEE A;  2YIU C;  2QJY B;  4WY4 B;  1N7S A;  3OA7 A;  1KB9 I;  3E7K A;  3CCU P;  2XU6 A;  2O01 N;  5APS A;  1NTK D;  1QLE D;  2IFM A;  3VMZ A;  1VQL P;  1IFN A;  4PD4 E;  1NTZ G;  2FXM A;  1Q90 D;  3AE2 C;  2WQY C;  4R4M A;  2KI7 B;  1UII A;  2E5T A;  3USS A;  2KXP B;  4OGQ D;  3MUD A;  5APX A;  5AW2 B;  1BSN A;  2YNY A;  1KN7 A;  3HRN A;  3L75 E;  4IFM A;  1M56 D;  3CWB J;  3ITK A;  1YQ3 C;  3H1I G;  4TT3 H;  1NTM E;  1L0N D;  1HVV A;  2QEX P;  5L8R J;  4N6J A;  2OYO A;  3VMY A;  3SWY A;  1NTM K;  1VQ7 P;  4DCK A;  4PD4 D;  1DEE G;  1LNQ A;  2H43 A;  4ASV A;  2ZVO B;  4PD4 H;  2O1J A;  3P7K A;  2NPS C;  2YKQ A;  1AA0 A;  2WVR A;  4PV1 B;  3W67 A;  4H13 B;  3IFM A;  3L75 D;  2WPV B;  3FXE A;  4TLF A;  1T3U A;  1K05 A;  2QM8 A;  3VTP C;  1VQ8 P;  1SQB G;  1WMK A;  4YXW H;  1G1I A;  4H13 C;  3RBZ A;  2XZR A;  4ZNC A;  1ZR2 A;  2YKP A;  4YTP C;  3CXH I;  3RL0 D;  2QE7 H;  5KJ7 D;  2K9J B;  2ZT9 D;  4UB6 E;  1NYH A;  1D7M A;  1GK6 A;  2L5G B;  4D6T D;  3V4W A;  2WSE H;  1KTM A;  1PP9 E;  1JY2 N;  1HBW A;  2C0W A;  1FDM A;  4IFD K;  1BGY J;  1VPC A;  1P84 I;  1H8A A;  2Z5I A;  3LW5 J;  1X9V A;  2AXC A;  1EC5 A;  2GM4 A;  1JMB A;  5KLV K;  2Q9I A;  4UB6 H;  2WSF H;  3AE1 C;  1YIT P;  1PP9 D;  1KIL B;  3B5N D;  3MUD C;  3GF7 A;  1NTZ J;  2WSS H;  4EI2 A;  1WT6 A;  3RK3 E;  1XTC C;  2Y0D A;  3BCC D;  5DJU B;  5CJ0 A;  1QX8 A;  2V7Q H;  4GT1 A;  4C7R A;  1KIL C;  3AEF C;  5AVW B;  3H1J E;  2E76 C;  2Q5U A;  1BE3 E;  1JO5 A;  1JY3 O;  1USD A;  3H1I J;  1VQP P;  2ZFC A;  1R5L A;  2QJK B;  2KK7 A;  5APY A;  2KLV A;  3B71 A;  1AVY A;  5EFW B;  1NKZ B;  3GMA A;  4IL6 H;  1VQM P;  1S9K E;  4JYC A;  1NAY A;  5GTI E;  1SQQ K;  3A2A A;  4YPC A;  1VL2 A;  5CCG A;  2QJK C;  4C46 A;  3GLM A;  1PPJ E;  1ZXG A;  3H1J D;  1BE3 D;  2E74 B;  1Q7Y Q;  1NKN A;  3CCJ P;  4H44 D;  1JEK A;  1SQB J;  3L70 E;  1JM0 A;  3BAT A;  3N4X A;  3Q5S A;  1BDC A;  1Z56 A;  2RN0 A;  5AVR B;  5AVQ B;  1CI6 B;  1U57 A;  2IYP A;  2N1T B;  1EXJ A;  3V6I A;  5AW5 B;  4K35 A;  1EDI A;  1NU1 K;  3L71 G;  1M7L A;  2B89 A;  3TNU A;  1L0L G;  2P10 A;  2Q6Q A;  1K04 A;  3H1K G;  3CX5 E;  2R32 A;  3AE5 C;  3Q5P A;  3CL3 D;  2HPC A;  2QM7 A;  4KHX A;  1AJY A;  3WU2 E;  5KAF E;  3H1H E;  1Q2N A;  1FOS F;  2XKM A;  5CBN A;  4B86 A;  4BXL A;  2KB7 P;  2A45 H;  2OYI B;  2QIW A;  2XND H;  2B88 A;  3RK2 C;  2RKL A;  3S4R A;  4RKU J;  5KLI C;  1HJ0 A;  2HG5 D;  1QVF O;  4OWF A;  1KB9 E;  2O3J A;  2KS1 A;  1SQV G;  3CX5 D;  4I7Z B;  2D2C D;  1TU3 F;  2GA1 A;  3H1H D;  2Y9Y A;  5M1B A;  3CCQ P;  3WU2 H;  1VQO P;  2JP3 A;  5KAF H;  1RE4 C;  1H88 A;  1AQ5 A;  1KV4 A;  4NPD A;  3JCU E;  1MUU A;  1BCC G;  1RE3 A;  1LWU A;  1L2P A;  2WSC J;  4JQ0 D;  5AW7 B;  3A0H E;  2P2U A;  3D71 A;  1L4A B;  1DX7 A;  1URQ B;  4U3F E;  1KYO I;  5CCG C;  2W8Z A;  1YJW P;  2OAR A;  1KB9 H;  3TGU G;  4PV1 D;  4AUW A;  3HE4 B;  2OTJ P;  5APU A;  1MFT A;  3L73 E;  5AVU B;  1N2D C;  2LXC B;  2J5U A;  1URQ C;  2WMM A;  2KP8 A;  3KYQ A;  2KOG A;  1YQ4 C;  4HKZ H;  1FZA A;  3H25 A;  1EDK A;  2HOD A;  1FZB A;  1GZL A;  4IL6 X;  3G71 P;  3P8M C;  2OQQ A;  3H6P A;  1J1D C;  3L37 A;  1DIP A;  4U3F D;  2HPC B;  4GOE A;  3A0H H;  1LTB C;  2PP6 A;  3H32 A;  3BVH A;  5APV A;  1KOR A;  3V2R A;  3L73 D;  3L74 G;  1YJ9 P;  3G4S P;  1VQ5 P;  2C0X A;  1GU4 A;  3L71 J;  1ZME C;  4WBA A;  2M5A B;  1R5S A;  1L0L J;  2AXT E;  2Y9Z A;  1S1C X;  2FYU G;  2YMK A;  3H1K J;  2WTY A;  2E75 B;  5AW1 B;  4C7N B;  1SVF A;  3CC2 P;  2PFX A;  2WT7 B;  2ZAE B;  2WWW A;  2YO2 A;  3Q3D A;  2DW3 A;  2IBZ D;  1NWQ A;  2E75 C;  2RMZ A;  1LTT C;  2M3E A;  1N86 A;  1FZC A;  2QG4 A;  4W7Y A;  3CXH H;  1LP1 B;  1SQV J;  3MP7 B;  4N3Y B;  1S2E A;  1CW5 A;  2AXT H;  2CPS A;  3I5C A;  1EZV I;  2M8R A;  1NTZ K;  2OGU A;  3MIW A;  3A0B E;  2AEF A;  1KMI Z;  1RE3 C;  1JY3 P;  1LWU C;  1VDF A;  1RF0 A;  2YIU B;  1BCC J;  1SQX G;  3P8C E;  2E5Y A;  4KT0 J;  4H0L C;  2B87 B;  4M3L A;  2KIK A;  3ZDM A;  1USE A;  4H44 C;  2Q7C A;  4I1L A;  2HOD B;  1LT1 A;  1LTJ A;  3HD7 D;  4IOI H;  3TGU J;  2A06 G;  2OYH A;  3HUS B;  2H7H A;  2E74 D;  5AW3 B;  4NPF X;  5BVZ A;  3A0B H;  3CD6 P;  1YTZ I;  5APQ A;  3AEB C;  2W6A A;  1ZV8 A;  3RL0 g;  3HUS C;  3V2Q A;  1BSH A;  1SQB K;  4AYC A;  1BDD A;  1IO4 A;  3L4F A;  3I55 P;  1VF5 B;  1S3J A;  3HE5 B;  1M1J A;  1K9M Q;  1JB0 J;  1OVR A;  3H1L E;  1U7J A;  3C1L A;  2ZJS E;  1W5C E;  2K88 A;  4LGD E;  4RO0 A;  3L74 J;  1VF5 C;  1PIX A;  1YI2 P;  1E79 H;  2NPS B;  3A3Y B;  1OW7 A;  2R5D A;  2WPS A;  2BEZ F;  4ZKU A;  2FXP A;  2FYU J;  3VP8 A;  1NTK G;  1FC2 C;  4DOJ A;  2G3A A;  4HB1 A;  4DT0 A;  1PL5 A;  2W90 A;  1Q86 Q;  2FFD B;  5CMZ A;  1YBK A;  2QSI A;  3M9Q A;  4IFF A;  2KYV A;  2QJP B;  1FZC C;  1M90 Q;  1OFC X;  1FJP A;  5CBO A;  1S5L H;  4WWI A;  3H1L D;  4GIF A;  1NTM D;  1A02 J;  2FFD C;  2BCC E;  4DZO A;  3T97 B;  2QJP C;  3O8Z A;  4YXD C;  2CPB A;  1L0N G;  3HTK A;  3KDP B;  1SQP E;  1SFC D;  4Y28 J;  1EDL A;  3EFF K;  2LKM A;  2KNC B;  1HGV A;  1RF0 C;  2QRX A;  1CZQ A;  1SQP K;  2GUS A;  2XV5 A;  3FX0 A;  2H88 C;  3IF4 A;  1N7S B;  1VQ4 P;  1KQS O;  4XA4 A;  1SLQ A;  3CCM P;  3KPE A;  1Q81 Q;  3HD7 A;  5CCH C;  1FZE A;  1SQX J;  2HR3 A;  3L75 G;  1J2J B;  1OMI A;  2BCC D;  1LTJ C;  1N7S C;  2P7J A;  3GHG A;  1HJB A;  3BAS A;  2ZXE B;  5KLV E;  1SQP D;  2OYH C;  3NXS A;  1X0T A;  5B66 H;  3MD0 A;  1RHZ B;  1FZF A;  3BRT B;  1YIJ P;  3VMA A;  3JC2 2;  4IL6 E;  2FKW B;  1FZG A;  2VRS A;  3S1K A;  4D6T G;  3SWF A;  3CCV P;  3SFD C;  1N73 A;  1H0T A;  2E76 B;  5AVT B;  3UIA A;  1T8Z A;  1HUC A;  1M1J C;  5AW4 B;  5KKZ B;  4GDO A;  1GTW A;  5KLV D;  2POH A;  3W68 A;  2O1K A;  2H89 C;  3L71 E;  1OIP A;  2PAJ A;  5KKZ C;  2MKV A;  3G6E P;  3O6Q A;  4ASW A;  4JPZ B;  1SQQ E;  2ZXX A;  1IFM A;  2R5B A;  1L0L K;  1KD1 Q;  1HWT C;  3NMD A;  2R3S A;  3EFG A;  3IR9 A;  1LTS C;  1NTK J;  2IPP A;  1PP9 G;  3L72 E;  3CME P;  3RK3 D;  3Q5R A;  2O01 H;  1SFC A;  3M0A A;  5KJ7 A;  3PP5 A;  1GU5 A;  4XE5 B;  1M1K Q;  3BCC G;  3FGA D;  5C39 A;  1T2K D;  1LTA C;  1LTI C;  4GOF A;  1SP4 A;  3CCE P;  4PD4 I;  5BU8 B;  1OZH A;  1SQQ D;  4I2L C;  3PH0 A;  1L0N J;  1KQL A;  1NU1 E;  1SQV K;  3U1A A;  1S9K D;  3MGN A;  1FE6 A;  1U7M A;  3FWL A;  1GL2 D;  3L72 D;  1OXZ A;  3TSI A;  1BCC E;  2NZ2 A;  4U7J A;  3QH9 A;  2BEQ D;  2Q1K A;  1EZV E;  3V5B A;  1PPJ D;  4GOD A;  1IFP A;  3GHG C;  2OTK E;  4BRY A;  3H1J G;  2ZVN B;  4WY4 D;  3L75 J;  3RK2 B;  3L70 D;  1BE3 G;  3AEE C;  3TGU E;  5KLI B;  2C9N Y;  2WIT A;  3OW2 O;  4OGQ C;  1NU1 D;  3B5N A;  5KTB A;  3WUV A;  2YO3 A;  1JTH A;  2IZ0 A;  1WRG A;  2YMY A;  2HFE D;  1IJD B;  1M57 D;  3II6 A;  2ZYG A;  3VP9 A;  5AVS B;  1N73 C;  2FYN C;  2KSJ A;  2WSE J;  4D6T J;  1DH3 A;  3VMX A;  3V2P A;  2Y0C A;  2YKO A;  3CWB E;  2HYN A;  1T3J A;  2E43 A;  5AVV B;  3M0D A;  3VOP A;  3L35 A; 
#chains in the Genus database with same CATH homology
 1FAV A;  3HTK B;  3U1C A;  3A5T A;  3IFM A;  4N3Y B;  3RL0 B;  1CW5 A;  2CPS A;  3I5C A;  2M8R A;  1NTZ K;  2I1J A;  3L36 A;  3MIW A;  1T3U A;  2QM8 A;  1MV8 A;  3VTP C;  1PFI A;  1H89 A;  1RE3 C;  1XTG B;  2XNX A;  1JY3 P;  1FU1 A;  1LWU C;  4WB4 A;  5AVZ B;  1G1I A;  1VDF A;  1SFC C;  1RF0 A;  1JY3 N;  2XZR A;  3RL0 C;  4N78 E;  1ZR2 A;  2YKP A;  5KJ7 C;  3RL0 D;  3P8C E;  5KJ7 D;  3HD7 B;  3G3Z A;  4M3L A;  2GUV A;  2R3C A;  2Q7C A;  1L4A A;  1GK6 A;  2L5G B;  4LC1 A;  1URQ A;  1J1D B;  4I1L A;  3GHG B;  3M06 A;  2J59 M;  3V4W A;  2HOD B;  1JY2 P;  1LTJ A;  1QL2 A;  1QL1 A;  2WSE H;  3HD7 C;  1RY3 A;  1G2C A;  3HE4 A;  2H8P D;  3TNU B;  1ZN5 A;  3HD7 D;  1JY2 N;  1HBW A;  2C0W A;  4JF7 A;  2OYH A;  1HGZ A;  3HUS B;  2H7H A;  1JUN A;  1RF1 A;  1FJK A;  1FDM A;  5AW3 B;  3B8E B;  4IFD K;  2BAS A;  5BVZ A;  4HH2 A;  1LGH B;  1YTZ I;  1VPC A;  5APQ A;  4N78 D;  4GKG A;  2W27 A;  4WY4 A;  1H8A A;  2W6A A;  1ZV8 A;  2Z5I A;  3HUS C;  1X9V A;  1N73 B;  3V2Q A;  1X79 B;  2GM4 A;  1SQB K;  4AYC A;  2N1T C;  1AFO A;  5KLV K;  2Q9I A;  1IO4 A;  3L4F A;  5AW9 B;  2WSF H;  3OJA B;  1GK4 A;  1SQX K;  3HE5 B;  3B5N C;  1M1J A;  1KIL B;  3VN0 A;  3B5N D;  2N9B A;  4LGD E;  3M91 A;  1WT6 A;  2WPR A;  1XTC C;  2NPS B;  3A3Y B;  5CJ0 A;  2R5D A;  4GT1 A;  3CI9 A;  4C7R A;  1KIL C;  2WPS A;  1G1J A;  1DEB A;  4EOT A;  4ZKU A;  4C7N A;  5AVW B;  1KIL D;  3VP8 A;  1IFJ A;  2Q5U A;  3NTN A;  2OYI C;  4DOJ A;  1FBM A;  1JO5 A;  2WT7 A;  1JY3 O;  1NHL A;  2FFD B;  5CMZ A;  3M9Q A;  1LWU B;  4EIJ A;  2A45 G;  4IFF A;  5BU5 A;  2KYV A;  5AVY B;  1A02 F;  2NPS D;  1SFC B;  2ZFC A;  3VYI A;  1FZC C;  2P1J A;  5APY A;  5AW8 B;  2KLV A;  1FJP A;  4GIF A;  1NKZ B;  1KFN A;  5CHX A;  1A02 J;  1S9K E;  2FFD C;  4JYC A;  3LW5 H;  2M3B A;  4DZO A;  3LID A;  1SQQ K;  3RK3 C;  3A2A A;  2FYU K;  3O8Z A;  2CPB A;  5CCG A;  3HTK A;  3KDP B;  1JMM A;  1SFC D;  4C46 A;  1IFI A;  5AW6 B;  1MFZ A;  2LKM A;  2FYZ A;  1HGV A;  1RF0 C;  1CZQ A;  1JOC A;  1NKN A;  1SQP K;  1LTG C;  2GUS A;  2XV5 A;  2WZ7 A;  1N7L A;  1GL2 A;  4W80 A;  1YYC A;  1N7S B;  2HLO A;  3U59 A;  4LLH A;  1LT9 A;  3NFQ A;  4XA4 A;  1SLQ A;  3BAT A;  3KPE A;  1NTK K;  3N4X A;  2J58 A;  1L4A C;  3HD7 A;  1Z56 A;  4HYT B;  5CCH C;  5AVR B;  1NO4 A;  1FZE A;  5CCH D;  5AVQ B;  1J2J B;  1OWA A;  1LTJ C;  1CI6 B;  2N1T B;  3C9I A;  1N7S C;  2P7J A;  5AW5 B;  3GHG A;  1HJB A;  3BAS A;  2ZXE B;  3H32 B;  1NU1 K;  1N7S D;  2OYH C;  1M7L A;  3NXS A;  3P8C D;  1RF1 C;  3TNU A;  3B5N B;  4Y99 B;  3EQ2 A;  1JTH B;  2IFN A;  3MD0 A;  5AW0 B;  3TYY A;  5CJ4 A;  3HUS A;  3KQG A;  2R32 A;  1MZ9 A;  3V4Q A;  3N7N A;  2N1T D;  3CL3 D;  1FZF A;  4WY4 C;  2HPC A;  3BRT B;  1JCD A;  2QM7 A;  1L0N K;  4KHX A;  2E42 A;  2Z4E A;  2Q3I A;  1FOS F;  1NAF A;  2FKW B;  4Y99 C;  1FZG A;  2VRS A;  2XKM A;  1KFM A;  3CLQ A;  5APT A;  3SWF A;  4B86 A;  2JJL A;  1N73 A;  1JNM A;  2KB7 P;  2A45 H;  2OYI B;  5AVT B;  3UIA A;  1T8Z A;  1NOH A;  1HUC A;  1X8Y A;  1HTL C;  3RK2 C;  1M1J C;  4JYB A;  5AW4 B;  1GTW A;  3RK2 D;  1JCC A;  2POH A;  1GDT A;  1KZU B;  3HE5 A;  1FZC B;  3P32 A;  2HG5 D;  2O1K A;  1KIL A;  1E5W A;  3M9B A;  1EQ7 A;  2P67 A;  2PAJ A;  1ZLL A;  2I1K A;  3RK3 B;  2NPS A;  1W2E A;  2A45 I;  2WPQ A;  1IFM A;  2R5B A;  3M0D C;  1L0L K;  1HWT C;  3LIE A;  1RE4 C;  3NMD A;  5APW A;  1H88 A;  1AQ5 A;  3A7O A;  3EFG A;  4OH8 B;  4ZKP A;  5AVX B;  3IR9 A;  1LTS C;  1MUU A;  2IPP A;  2FFD A;  1RE3 A;  1LWU A;  3OAK A;  3R2P A;  3RK3 D;  1JY2 O;  3MTU E;  4O9B A;  2O01 H;  1SFC A;  2Z5H A;  3M0A A;  2W6B A;  5KJ7 A;  1IC2 A;  3PP5 A;  1T2K C;  2MJZ A;  4AQR D;  1CSB A;  5AW7 B;  3TK1 A;  1GU5 A;  4XE5 B;  2P2U A;  1L4A B;  1DX7 A;  1URQ B;  1T2K D;  3BRV B;  5CCG C;  1LTA C;  2OAR A;  1LTI C;  1GL2 B;  1SP4 A;  3T97 A;  1LTJ B;  5CCG D;  1G2C B;  4AUW A;  1LT9 B;  1NH4 A;  5BU8 B;  3HE4 B;  5APU A;  1GD2 E;  4I2L C;  1ZR4 A;  5AVU B;  1N2D C;  2OYH B;  4W7Z A;  1IFD A;  1KQL A;  1URQ C;  2KP8 A;  1YTZ T;  1SQV K;  3KYQ A;  1RF1 B;  3U1A A;  1L4A D;  2KOG A;  2XDJ A;  1URQ D;  1S9K D;  3MGN A;  1GL2 C;  5CCH A;  1FZA A;  1GL2 D;  1LT9 C;  2JEE A;  4WY4 B;  2HOD A;  1FZB A;  1OXZ A;  3TSI A;  1GZL A;  1N7S A;  3P8M C;  3OA7 A;  2XU6 A;  3V5B A;  3H6P A;  1J1D C;  3L37 A;  3GHG C;  1GW3 A;  2HPC B;  5APS A;  2IFM A;  3VMZ A;  1CI6 A;  2IX7 C;  2N1T A;  1LTB C;  2PP6 A;  4WY4 D;  3H32 A;  3RK2 B;  3BVH A;  1M1J B;  1IFN A;  5APV A;  3V2R A;  2FXM A;  2C9N Y;  2WIT A;  2C0X A;  1GU4 A;  3B5N A;  5KTB A;  2YO3 A;  1JTH A;  2WSC H;  4WBA A;  1WRG A;  2YMY A;  2HFE D;  3MUD A;  1IJD B;  1HH0 A;  4RES B;  5APX A;  5AW2 B;  2YNY A;  3II6 A;  4I6M C;  3WMM 0;  2WTY A;  3HRN A;  4IFM A;  5AW1 B;  4C7N B;  1SVF A;  3VP9 A;  5AVS B;  3E1I A;  1GW4 A;  1N73 C;  2KSJ A;  1J1E B;  3M9H A;  3V2N A;  2WT7 B;  2WWW A;  1HVV A;  2YO2 A;  1IK9 A;  1FOS E;  2OYI A;  4N6J A;  3VMY A;  1NWQ A;  3SWY A;  1DH3 A;  3VMX A;  3V2P A;  1NTM K;  2YKO A;  1J1E C;  1LTT C;  2HYN A;  1N86 A;  1T3J A;  1FZC A;  2H43 A;  2E43 A;  5AVV B;  2C9L Y;  3M0D A;  4W7Y A;  3VOP A;  3L35 A;  1RE4 A;  2O1J A;  2NPS C;  3P7K A;  2YKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...