1IFPA

Inovirus (filamentous bacteriophage) strain pf3 major coat protein assembly
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
44
structure length
44
Chain Sequence
MQSVITDVTGQLTAVQADITTIGGAIIVLAAVVLGIRWIKAQFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the capsid of Pf3 filamentous phage determined from X-ray fibre diffraction data at 3.1 A resolution.
pubmed doi rcsb
source organism Pseudomonas phage pf3
molecule tags Virus
molecule keywords MAJOR COAT PROTEIN ASSEMBLY
total genus 12
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 1998-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10389 CoatB Bacteriophage coat protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 1ifpA00
2XNDH 1FS0E 3USSA 3PJSK 4YXWH 1IFPA 2CK3H 2WSSH 2W6JH 2E5TA 2E5YA 1JEKA 4QMAA 1BSHA 4TLFA 2QE7H 3EFFK 1E79H 2JDIH 4WVZA 2V7QH 4DJGA 1BSNA 1AQTA
chains in the Genus database with same CATH superfamily
1K8AQ 1BCCE 2OARA 3H6PA 2ZT9D 3CCVP 4HKZH 5AW9B 3WU2E 3IAOA 1CI6A 3BRTB 2ZXXA 4UB6E 1H88A 1RQVA 1M7LA 3CX5I 3AEAC 1L4AA 3WMM0 1PGJA 1VQ7P 2HR3A 1VF5D 3FGAD 3WUUA 4AQRD 1DIPA 1ZR4A 5AW2B 1KILA 4EIJA 1DEBA 1USDA 4L75A 1SQXJ 3L70G 3GF3A 5AVUB 3A0BE 4RJTA 1NTZK 1GU4A 3CC2P 1EZVD 1OW7A 1S4XA 1MUUA 2Y0EA 3VMZA 1X0TA 2WZ7A 1SQVJ 4PV1C 3VYIA 3BCCE 1RF1C 2XU6A 2B87A 1FOSE 1EZVE 1FAVA 2QRXA 1S72P 1AA0A 4OGQD 1NTKJ 2B88A 1SQVK 1T8ZA 2K9YA 1FZCA 1PP9J 1IFDA 3M9QA 1LT1A 4I1LA 4JYBA 1N7SB 3P8CD 1M1JC 1HJ0A 1XTCC 2XNXA 2OYIC 1PPJE 3GG2A 3L73D 1BGYJ 4H0LD 4K3AA 3USSA 1NYHA 5GTIH 3JCUE 3RL0g 1JOCA 5AVYB 1N7SA 1NH4A 1WT6A 2QIWA 3M0AA 1YJNP 3VMYA 2N1TC 1Y47A 1ZW0A 4JYCA 5C39A 1URQA 2JJLA 2JWAA 2B87B 3HE5A 2ZT9C 4EOTA 2OYHC 3IFMA 1HGVA 1HVVA 2K37A 1J1EC 1OWAA 2Y0DA 2IPPA 1RF0A 3L75G 3FXDA 4IL6H 2AXCA 5KLVE 1FZGA 1IJDB 4LC1A 1JMBA 3KXDA 2OGUA 2G3AA 3N4XA 2HODB 2J5UA 2W90A 1AVOA 5H2FE 2LXBA 1KORA 2C0WA 2WSFH 2W83C 3A5TA 3TF5A 1JY2O 3MZWB 2O01N 2M3EA 1AQTA 1LGHB 4W7ZA 4C7RA 1VQOP 5AW6B 1QVFO 3W68A 1GTWA 2IBZG 1HUCA 1SQBE 4ZKUA 1H0TA 1YBKA 1LTJB 3V2RA 2JEEA 1NTKG 5E79E 5AVWB 5CCGD 4L76A 2IYOA 4OVNF 1NTMG 3HTKB 1A02F 2POHA 2PAJA 2ZFCA 1M1KQ 1USEA 1LT9A 2QSIA 4HJGH 2WTYA 3B5NC 1L0NG 3JSVC 4QMAA 2KZIA 3LW5H 4U3FE 1FBMA 4PJ0E 1NHLA 2FBWC 3B8EB 1HGZA 3BCCD 2JO1A 1K73Q 3GMAA 1L0NK 2LKMA 1OFCX 4DOJA 3L4FA 1SQBD 2JR8A 3HUSC 3L72G 4H44C 3H25A 1N73A 2V7QH 1L0NE 3FXEA 1KMIZ 4H13B 2YMYA 4IFMA 3L35A 2QJKC 5CCGA 1LTJC 1L4AD 1FC2C 3HE4A 2DW3A 2V4HA 2UWJE 4UB8E 3U59A 3V5BA 1RE4A 2I1JA 2M5AA 4OGQB 3M91A 1IFMA 4HYTB 3TYYA 2PRRA 4KJMA 4U7JA 3H32A 2IX7C 3SFDC 5AVXB 3V2NA 3L71E 5CCGC 3CMAP 2IFMA 1BGYE 3H1JD 1PGOA 3RL0C 1GU5A 1S9KE 4ZKPA 2MKVA 4JQ0D 3H1IG 4TT3H 4ZNCA 2B9BA 3LW5J 1Q86Q 3E1IA 4Z1MH 1Q7YQ 3II6A 3V4QA 1U7JA 3LIDA 4N6JA 2HLOA 5L8RJ 2H8PD 1LTAC 1GL2D 1RF0C 1SLQA 1FJKA 2N1TB 3AE7C 4PJ0H 4GIFA 3VN0A 4A7PA 1WMKA 4HB1A 2FXOA 3W67A 2D2CB 2C9NY 1IFJA 4ZMDA 3AE6C 3F89A 4UB6H 1SFCA 1QX8A 3S9OA 5BU8B 3L36A 5DJTB 3I55P 3CCEP 5GTHH 2P10A 1ZRTE 3BRVB 3CCJP 5AVTB 2Y0CA 1VQPP 3CCMP 1N7SC 2FYZA 3C8VA 3VP8A 2ZVNB 1NKZB 3H1KJ 1MKMA 3U1CA 3HE5B 1L0LK 2E75D 2WSEH 2O3JA 2IZ0A 3KPEA 5H2FH 3H1JJ 1M8OB 1PPJG 2K1AA 2W8ZA 4I6MC 3ITKA 3TGUD 1HWTC 1EDKA 1YTZI 1N2DC 4RO0A 1FZAA 5KLVD 1BE3G 1ZXGA 3L72E 2E75C 1L0LJ 4DJGA 3SFEC 4JBZA 5APWA 5E79H 2KK7A 2M3BA 2OTKE 2YXQB 4N3YB 5KTBA 1PP9G 2Q5UA 2QM7A 3H1IE 4R4MA 5AW8B 3GHGC 2E76C 3G3ZA 2NPSC 3RGUA 3RK2C 1LTTC 5AVQB 4BRYA 4EYYQ 2A45H 2HYNA 3V2PA 5KKZB 1BGYG 1HTLC 3ABVC 3BASA 3G4SP 1Q82Q 1G2CA 2BCCE 2QEXP 2JWDA 4NPDA 3TK1A 1NJIQ 1SQBK 1JO5A 1EXJA 1U57A 2GUVA 3VP9A 1AV1A 1NTME 2Y9YA 5CBNA 1SQQD 1VF5C 5B5EH 3PJSK 2BCCD 1SQXD 2O1KA 2R32A 5GTHE 5K5GB 1VPCA 4I7ZB 5DJUB 1GK4A 1J1DB 1S9KD 2CK3H 3HUSB 2WSSH 3HUSA 4WY4D 1KYOE 3KZIH 3CPWO 1NU1G 1QGKB 3L75J 3TNUA 5AW4B 1OVRA 1QEXA 2RMZA 3QH9A 1ZR2A 1JY3N 1VQ8P 2E5YA 4IFFA 1DEEG 1QLED 4YPCA 1SQPG 4U3FD 4H13D 3T97B 2MJZA 5TISH 3P8MC 2WQYC 1W2EA 1DX7A 1IK7A 3CX5D 3AE5C 4WB4A 4IFDK 2Y9ZA 3D6ZA 1LT9C 1JUNA 1NTZD 1FZBA 2RKLA 1EC5A 2KNCB 3M0DC 5AW1B 3NTNA 1YQ4C 1SQPK 1HBWA 2R44A 4BWNA 3CC4P 3H1HJ 1BE3J 4PV1B 3B4SA 1RE3C 1NO4A 2FYUD 1L0LG 2IYPA 1G2CB 3WUTA 1PGPA 3CXHI 2KLVA 1FU1A 3CCQP 2A06D 2Z5HA 2Z5IA 1UIXA 1G1JA 3CX5H 2WT7A 3CC7P 3L71D 3MUDA 1YI2P 2ZYGA 4Y99B 4YXWH 4MN4C 2E43A 1SQXE 4NPEA 3V2QA 5CCHC 3T97A 4D6TG 1RH5B 2QVAA 2YKPA 2QJYC 2E76D 3TNUB 2QM8A 3F5HA 1FZCC 1JM0A 2OYHB 2XV5A 1KYOH 4KHXA 2FYNC 4C7NB 1DD4A 2D2CD 1YITP 3HD7D 1D7MA 1EZVG 4U3FJ 2YIUB 1YQ3C 2R3CA 1VQ4P 1KFNA 1SFCD 2P7JA 3FWNA 1URQC 1VL2A 5AW5B 1KV4A 1URQB 3H1KD 1KB9E 1JMMA 2KSJA 3L74G 4C7NA 1YTZT 4CPGA 1LNQA 1KILB 3HRNA 1SQVD 4OH8B 3HD7B 3V4WA 2OYOA 1ZOYC 2WSEJ 2A45I 1M56D 3CXHE 1SFCB 3H1HD 1AVYA 2FYUE 4IL6X 5KAFE 3TGUJ 1FJPA 2Q1KA 1OMIA 1SS1A 2V7QJ 2XNDH 3NXSA 1BDCA 5KLVJ 3E7KA 1JB0J 4XE5B 1KYOI 3L71J 3R2PA 1RY3A 3AE8C 4YXDC 1NTMJ 2P2UA 2P1JA 3CX5E 1JY3O 5APQA 1H89A 5KJ7D 1BCCG 2YKQA 4WY4C 1NAYA 2A45G 3E1RA 1HJBA 1NVOA 1SP4A 1T2KC 1Q81Q 3H1LG 1H0TB 4W7YA 2WWWA 1ZV8A 1QL1A 1JCCA 5AVSB 3MD0A 3QWOC 1YHQP 2PP6A 3JC22 3L72J 1FOSF 1VQ9P 3KZIE 1E5WA 3H1LE 3C9IA 2KIKA 3A0BH 3TDKA 3HE4B 5B66E 1IZNB 1NTKK 3KQGA 2CPBA 3AE3C 4XA4A 4LLHA 5BVZA 3GLMA 3Q3DA 1FE6A 3KDPB 3RK3E 1J1DC 2CPSA 4PV1D 3CD6P 4ASWA 4OWFA 1LP1B 1NTZJ 1NTMD 1VQ6P 1OXZA 4C46A 1OZHA 4H44D 1LTGC 2W6JH 3MP7B 3G6EP 3CL3D 1FZCB 1KQGB 2Q3EA 2ZVOB 2KNCA 1Y8AA 3CWBE 1N7SD 5APUA 3L74E 2NPSA 1KQLA 1SQPE 3GHGB 1JY2P 1T3JA 3RK3B 1KFMA 3CMEP 2G8YA 4GOEA 3WU2H 5KJ7C 5CJ0A 1J2JB 3L72D 5EFWB 3D70A 2BEQD 2WSCJ 3H32B 1VQLP 3C1LA 3H1HE 3P7KA 1GL2C 2WITA 3EQ2A 1P84D 3L70D 2M8RA 1VQ5P 3L37A 1K9MQ 1ZP0C 4JF7A 3S1KA 4D6TE 3AEGC 1KILD 1W5CE 2AXTE 2M5AB 1YYCA 5APSA 2HG5D 1EDLA 1MFZA 1FZEA 5APYA 1YJ9P 2I8DA 1JCDA 3O8ZA 1HF9A 2YO2A 1PGQA 2A06E 3PHLA 3R4YA 3VMAA 3VTPC 3VMXA 3SWFA 2AEMA 3CCRP 2BEZF 1NKNA 1NGMB 5KAFH 3H1ID 2I1KA 1Q90D 1SFCC 1L4AB 1W2BO 2VRSA 1VQMP 3OJAB 1BSHA 3IN6A 2D2CC 1LTIC 1IFIA 1N86A 3L73G 3CWBD 5KLIC 2H7HA 2IBZD 2Q3IA 4WBAA 3G71P 2P67A 3PTZA 3CCUP 1E79H 2N9YB 5CHXA 1A02J 1K04A 2WSFJ 1RQUA 3P32A 2JDIH 2KI7B 1M57D 2XDJA 1SQQJ 2YIUC 2FKWB 1VQNP 2BCCJ 5CCHD 2FFDA 1T3UA 1LWUC 2WPRA 1L0NJ 3MUDC 1JY3P 3Q2YA 2AEJA 1KYOD 1X9VA 5KLIB 4AUWA 4H0LC 1JNMA 1SQQK 4I2LC 3AEBC 2GM4A 1L0LE 3D6YA 1RE3A 1OIPA 2E74C 4DCKA 5BU5A 4IL6E 1RHZB 2HPCB 1NTMK 1G1IA 4EDFA 3M0DA 3BVHA 2GA1A 4RKUJ 4UB8H 3I5CA 4DT0A 1FDIA 3WUVA 1GDTA 2H88C 1AQ5A 1GW4A 2QJKB 2ZXEB 2KSEA 4H13C 1Q2NA 1BE3D 2HFED 5AVRB 3H1KE 3GHGA 1FZFA 1CW5A 2IZ1A 3CXHH 1K05A 1X8YA 2FXPA 4L74A 5KAIH 3KYQA 1PP9D 4N78E 2KUBA 2IDBA 1IFNA 1OX3A 1X22A 3M9BA 1BE3E 2YNYA 3PLNA 4YTPC 1PV3A 3VOPA 3B5NA 1NTZE 1ZRTD 2NRGA 3IR9A 5AVZB 2OTJP 1LP1A 1L0ND 1WRGA 3HD7C 2PFXA 1MFTA 3HTKA 1KILE 2W27A 1RE4C 4JPZB 5AW7B 1BCCJ 4B86A 1SQQG 1YJWP 1HH0A 3CXHD 1KC8Q 2BCCG 2E74D 2KS1A 1KN7A 2W6AA 1VDFA 1BDDA 1SQBG 2AEFA 2IBZE 4D6TJ 2O1JA 3A0HE 3EFGA 1FDOA 2N1TD 2YKOA 3V6IA 5CBOA 4GOFA 1S1CX 2KXPB 1PP9E 2R3SA 4KT0J 4N78D 3SWYA 3CCSP 1N73B 1JEKA 3PRJA 2Q6QA 5TISE 1SQPD 2AXTH 3L75D 4U3FG 1NOHA 1SVFA 5KKZC 1GD2E 4L73A 2Q9IA 2E76B 1N7LA 5B66H 2KS1B 3OW2O 4PD4E 1EZVI 5TJHA 3H1JG 1UIIA 4K35A 3L74J 5M1BA 4BXLA 1JTHB 4WVZA 3L75E 4LGDE 2E75B 2OYHA 2KYVA 3CI9A 4OGQC 1MZ9A 2FFDB 1NAFA 3AE9C 3OA7A 2KB7P 3N7NA 2WMMA 1DH3A 2RN0A 1NTKE 4PD4D 3A7OA 3H1IJ 2N1TA 4M3LA 3Q5RA 2H43A 1FS0E 2A06G 1X79B 1RF1B 2WT7B 1GL2B 1NTKD 1SQXK 3L71G 1LT9B 2IBZI 3SWKA 3CLQA 1Y9BA 2FFDC 2E42A 1KD1Q 4D6TD 2N9BA 3HD7A 1M1JA 2WPVB 1BGYD 3B5NB 3H1JE 3D71A 1CZQA 3KHUA 1LTJA 3PH0A 1P84H 2O01J 5APXA 3H1LJ 4H0LB 2ITAA 2M0BA 1JY2N 2HPCA 1SQBJ 3BATA 1N73C 3BCCG 1M90Q 1LWUB 2RH0A 1LTBC 1MV8A 2ZJSE 5AVVB 3H1KG 1NU1J 1VF5B 2NPSD 1YIJP 1PPJD 2YMKA 2HODA 3L74D 3G9RA 2BASA 3MHVA 3RL0D 5KLVK 1PFIA 3M9HA 4EI2A 3RBZA 1EQ7A 2FYUK 2C0XA 2K9JB 1SQQE 1KQFB 3AE2C 3AECC 1H8AA 1EDJA 2ZYAA 3LIEA 2XZRA 2JP3A 1OW6A 1L4AC 2NPSB 3RL0B 5KAIE 1IFPA 1URQD 2P58A 1NTZG 2KOGA 3MTUE 3RK3D 1RF1A 4O9BA 3ZDMA 1KTMA 3U1AA 2ZT9B 1GK6A 2O01H 4Y99C 3AEEC 3JCUH 2LR2A 3K5BA 5AW3B 4BRYB 2FY8A 4TLFA 1JTHA 2R5DA 4H44B 1GW3A 1P84E 1R5SA 3EFFK 3GW6A 2K9JA 3L70E 2QJPC 3AE4C 4XFJA 4RESB 4GKGA 3M06A 1S5LH 4WY4B 2QG4A 4NPFX 1QL2A 4W80A 5APVA 5B5EE 1P84I 1AFOA 1EXIA 3L73E 2W6BA 1TU3F 2E74B 1R8EA 1T2KD 3RK3C 2K88A 2L5GB 1DD3A 3I56P 3BCCJ 4GT1A 3Q1MA 4WY4A 2H89C 2SPZA 2J59M 5APTA 2QA4P 4R4LA 1SQPJ 2ZAEB 1KB9H 2R5BA 5CMZA 2LXCB 1LWUA 2Z4EA 3CCLP 3CWBJ 2L91A 3A2AA 2K3RA 4I7ZC 3TGUG 4AYCA 2FYUG 1GZLA 1L0LD 1S2EA 3O6QA 1GL2A 3S4RA 1ZLLA 2YXRB 2ZYDA 3H1HG 2J58A 3L73J 4WWIA 4ASVA 3NFQA 5KLVG 3MIWA 2WSCH 2FYNB 3AE1C 1KB9I 5KJ7A 1KB9D 2KP8A 2PGDA 3B71A 3P8CE 1IC2A 2QJYB 5GTIE 4Y28J 3EWKA 2OQQA 1S3JA 4HH2A 2B89A 3OAKA 1J1EB 4PD4I 3RK2B 1CSBA 1PIXA 2YO3A 3FWLA 3GF7A 3Q5SA 2FXMA 1OW8A 1S5LE 2KZJA 3O6QB 3AEFC 4GODA 4IOIH 1IK9A 5CJ4A 1KZUB 3A0HH 1KQSO 3B5ND 3H1LD 1R5LA 1IO4A 1VQKP 2JKVA 3RK2D 1SQXG 3L70J 5CCHA 2OYIA 2C9LY 1AJYA 1L2PA 1S5LX 2WVRA 1FDMA 1LTSC 1PL5A 1NU1D 3PP5A 1SQVG 1LJ2A 3UIAA 1Z56A 1M1JB 1ZN5A 1ZMEC 4PD4H 2E5TA 5AW0B 2KLUA 3TSIA 2OYIB 1NWQA 3NMDA 2IFNA 3FX0A 1EDIA 2NZ2A 3CWBG 2WPSA 2Q7CA 2QE7H 3SSUA 1CI6B 3IF4A 4DZOA 2OTLP 2QJPB 1KILC 2FYUJ 1GMJA 3TGUE 3Q5PA 1BCCD 3A3YB 3AEDC 1U7MA 2XKMA 4GDOA 3RBXA 1OVUA 2WPQA 1QVGO 1NU1K 1OVVA 1BSNA 3MGNA 1XTGB 1N8RQ 1PZQA 2GUSA 1T6AA 1NU1E 1SQVE
chains in the Genus database with same CATH topology
2XNDH 1FS0E 3USSA 3PJSK 4YXWH 1IFPA 2CK3H 2WSSH 2W6JH 2E5TA 2E5YA 1JEKA 4QMAA 1BSHA 4TLFA 2QE7H 3EFFK 1E79H 2JDIH 4WVZA 2V7QH 4DJGA 1BSNA 1AQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XND H;  1FS0 E;  3USS A;  3PJS K;  4YXW H;  1IFP A;  2CK3 H;  2WSS H;  2W6J H;  2E5T A;  2E5Y A;  1JEK A;  4QMA A;  1BSH A;  4TLF A;  2QE7 H;  3EFF K;  1E79 H;  2JDI H;  4WVZ A;  2V7Q H;  4DJG A;  1BSN A;  1AQT A; 
#chains in the Genus database with same CATH topology
 1K8A Q;  1BCC E;  2OAR A;  3H6P A;  2ZT9 D;  3CCV P;  4HKZ H;  5AW9 B;  3WU2 E;  3IAO A;  1CI6 A;  3BRT B;  2ZXX A;  4UB6 E;  1H88 A;  1RQV A;  1M7L A;  3CX5 I;  3AEA C;  1L4A A;  3WMM 0;  1PGJ A;  1VQ7 P;  2HR3 A;  1VF5 D;  3FGA D;  3WUU A;  4AQR D;  1DIP A;  1ZR4 A;  5AW2 B;  1KIL A;  4EIJ A;  1DEB A;  1USD A;  4L75 A;  1SQX J;  3L70 G;  3GF3 A;  5AVU B;  3A0B E;  4RJT A;  1NTZ K;  1GU4 A;  3CC2 P;  1EZV D;  1OW7 A;  1S4X A;  1MUU A;  2Y0E A;  3VMZ A;  1X0T A;  2WZ7 A;  1SQV J;  4PV1 C;  3VYI A;  3BCC E;  1RF1 C;  2XU6 A;  2B87 A;  1FOS E;  1EZV E;  1FAV A;  2QRX A;  1S72 P;  1AA0 A;  4OGQ D;  1NTK J;  2B88 A;  1SQV K;  1T8Z A;  2K9Y A;  1FZC A;  1PP9 J;  1IFD A;  3M9Q A;  1LT1 A;  4I1L A;  4JYB A;  1N7S B;  3P8C D;  1M1J C;  1HJ0 A;  1XTC C;  2XNX A;  2OYI C;  1PPJ E;  3GG2 A;  3L73 D;  1BGY J;  4H0L D;  4K3A A;  3USS A;  1NYH A;  5GTI H;  3JCU E;  3RL0 g;  1JOC A;  5AVY B;  1N7S A;  1NH4 A;  1WT6 A;  2QIW A;  3M0A A;  1YJN P;  3VMY A;  2N1T C;  1Y47 A;  1ZW0 A;  4JYC A;  5C39 A;  1URQ A;  2JJL A;  2JWA A;  2B87 B;  3HE5 A;  2ZT9 C;  4EOT A;  2OYH C;  3IFM A;  1HGV A;  1HVV A;  2K37 A;  1J1E C;  1OWA A;  2Y0D A;  2IPP A;  1RF0 A;  3L75 G;  3FXD A;  4IL6 H;  2AXC A;  5KLV E;  1FZG A;  1IJD B;  4LC1 A;  1JMB A;  3KXD A;  2OGU A;  2G3A A;  3N4X A;  2HOD B;  2J5U A;  2W90 A;  1AVO A;  5H2F E;  2LXB A;  1KOR A;  2C0W A;  2WSF H;  2W83 C;  3A5T A;  3TF5 A;  1JY2 O;  3MZW B;  2O01 N;  2M3E A;  1AQT A;  1LGH B;  4W7Z A;  4C7R A;  1VQO P;  5AW6 B;  1QVF O;  3W68 A;  1GTW A;  2IBZ G;  1HUC A;  1SQB E;  4ZKU A;  1H0T A;  1YBK A;  1LTJ B;  3V2R A;  2JEE A;  1NTK G;  5E79 E;  5AVW B;  5CCG D;  4L76 A;  2IYO A;  4OVN F;  1NTM G;  3HTK B;  1A02 F;  2POH A;  2PAJ A;  2ZFC A;  1M1K Q;  1USE A;  1LT9 A;  2QSI A;  4HJG H;  2WTY A;  3B5N C;  1L0N G;  3JSV C;  4QMA A;  2KZI A;  3LW5 H;  4U3F E;  1FBM A;  4PJ0 E;  1NHL A;  2FBW C;  3B8E B;  1HGZ A;  3BCC D;  2JO1 A;  1K73 Q;  3GMA A;  1L0N K;  2LKM A;  1OFC X;  4DOJ A;  3L4F A;  1SQB D;  2JR8 A;  3HUS C;  3L72 G;  4H44 C;  3H25 A;  1N73 A;  2V7Q H;  1L0N E;  3FXE A;  1KMI Z;  4H13 B;  2YMY A;  4IFM A;  3L35 A;  2QJK C;  5CCG A;  1LTJ C;  1L4A D;  1FC2 C;  3HE4 A;  2DW3 A;  2V4H A;  2UWJ E;  4UB8 E;  3U59 A;  3V5B A;  1RE4 A;  2I1J A;  2M5A A;  4OGQ B;  3M91 A;  1IFM A;  4HYT B;  3TYY A;  2PRR A;  4KJM A;  4U7J A;  3H32 A;  2IX7 C;  3SFD C;  5AVX B;  3V2N A;  3L71 E;  5CCG C;  3CMA P;  2IFM A;  1BGY E;  3H1J D;  1PGO A;  3RL0 C;  1GU5 A;  1S9K E;  4ZKP A;  2MKV A;  4JQ0 D;  3H1I G;  4TT3 H;  4ZNC A;  2B9B A;  3LW5 J;  1Q86 Q;  3E1I A;  4Z1M H;  1Q7Y Q;  3II6 A;  3V4Q A;  1U7J A;  3LID A;  4N6J A;  2HLO A;  5L8R J;  2H8P D;  1LTA C;  1GL2 D;  1RF0 C;  1SLQ A;  1FJK A;  2N1T B;  3AE7 C;  4PJ0 H;  4GIF A;  3VN0 A;  4A7P A;  1WMK A;  4HB1 A;  2FXO A;  3W67 A;  2D2C B;  2C9N Y;  1IFJ A;  4ZMD A;  3AE6 C;  3F89 A;  4UB6 H;  1SFC A;  1QX8 A;  3S9O A;  5BU8 B;  3L36 A;  5DJT B;  3I55 P;  3CCE P;  5GTH H;  2P10 A;  1ZRT E;  3BRV B;  3CCJ P;  5AVT B;  2Y0C A;  1VQP P;  3CCM P;  1N7S C;  2FYZ A;  3C8V A;  3VP8 A;  2ZVN B;  1NKZ B;  3H1K J;  1MKM A;  3U1C A;  3HE5 B;  1L0L K;  2E75 D;  2WSE H;  2O3J A;  2IZ0 A;  3KPE A;  5H2F H;  3H1J J;  1M8O B;  1PPJ G;  2K1A A;  2W8Z A;  4I6M C;  3ITK A;  3TGU D;  1HWT C;  1EDK A;  1YTZ I;  1N2D C;  4RO0 A;  1FZA A;  5KLV D;  1BE3 G;  1ZXG A;  3L72 E;  2E75 C;  1L0L J;  4DJG A;  3SFE C;  4JBZ A;  5APW A;  5E79 H;  2KK7 A;  2M3B A;  2OTK E;  2YXQ B;  4N3Y B;  5KTB A;  1PP9 G;  2Q5U A;  2QM7 A;  3H1I E;  4R4M A;  5AW8 B;  3GHG C;  2E76 C;  3G3Z A;  2NPS C;  3RGU A;  3RK2 C;  1LTT C;  5AVQ B;  4BRY A;  4EYY Q;  2A45 H;  2HYN A;  3V2P A;  5KKZ B;  1BGY G;  1HTL C;  3ABV C;  3BAS A;  3G4S P;  1Q82 Q;  1G2C A;  2BCC E;  2QEX P;  2JWD A;  4NPD A;  3TK1 A;  1NJI Q;  1SQB K;  1JO5 A;  1EXJ A;  1U57 A;  2GUV A;  3VP9 A;  1AV1 A;  1NTM E;  2Y9Y A;  5CBN A;  1SQQ D;  1VF5 C;  5B5E H;  3PJS K;  2BCC D;  1SQX D;  2O1K A;  2R32 A;  5GTH E;  5K5G B;  1VPC A;  4I7Z B;  5DJU B;  1GK4 A;  1J1D B;  1S9K D;  2CK3 H;  3HUS B;  2WSS H;  3HUS A;  4WY4 D;  1KYO E;  3KZI H;  3CPW O;  1NU1 G;  1QGK B;  3L75 J;  3TNU A;  5AW4 B;  1OVR A;  1QEX A;  2RMZ A;  3QH9 A;  1ZR2 A;  1JY3 N;  1VQ8 P;  2E5Y A;  4IFF A;  1DEE G;  1QLE D;  4YPC A;  1SQP G;  4U3F D;  4H13 D;  3T97 B;  2MJZ A;  5TIS H;  3P8M C;  2WQY C;  1W2E A;  1DX7 A;  1IK7 A;  3CX5 D;  3AE5 C;  4WB4 A;  4IFD K;  2Y9Z A;  3D6Z A;  1LT9 C;  1JUN A;  1NTZ D;  1FZB A;  2RKL A;  1EC5 A;  2KNC B;  3M0D C;  5AW1 B;  3NTN A;  1YQ4 C;  1SQP K;  1HBW A;  2R44 A;  4BWN A;  3CC4 P;  3H1H J;  1BE3 J;  4PV1 B;  3B4S A;  1RE3 C;  1NO4 A;  2FYU D;  1L0L G;  2IYP A;  1G2C B;  3WUT A;  1PGP A;  3CXH I;  2KLV A;  1FU1 A;  3CCQ P;  2A06 D;  2Z5H A;  2Z5I A;  1UIX A;  1G1J A;  3CX5 H;  2WT7 A;  3CC7 P;  3L71 D;  3MUD A;  1YI2 P;  2ZYG A;  4Y99 B;  4YXW H;  4MN4 C;  2E43 A;  1SQX E;  4NPE A;  3V2Q A;  5CCH C;  3T97 A;  4D6T G;  1RH5 B;  2QVA A;  2YKP A;  2QJY C;  2E76 D;  3TNU B;  2QM8 A;  3F5H A;  1FZC C;  1JM0 A;  2OYH B;  2XV5 A;  1KYO H;  4KHX A;  2FYN C;  4C7N B;  1DD4 A;  2D2C D;  1YIT P;  3HD7 D;  1D7M A;  1EZV G;  4U3F J;  2YIU B;  1YQ3 C;  2R3C A;  1VQ4 P;  1KFN A;  1SFC D;  2P7J A;  3FWN A;  1URQ C;  1VL2 A;  5AW5 B;  1KV4 A;  1URQ B;  3H1K D;  1KB9 E;  1JMM A;  2KSJ A;  3L74 G;  4C7N A;  1YTZ T;  4CPG A;  1LNQ A;  1KIL B;  3HRN A;  1SQV D;  4OH8 B;  3HD7 B;  3V4W A;  2OYO A;  1ZOY C;  2WSE J;  2A45 I;  1M56 D;  3CXH E;  1SFC B;  3H1H D;  1AVY A;  2FYU E;  4IL6 X;  5KAF E;  3TGU J;  1FJP A;  2Q1K A;  1OMI A;  1SS1 A;  2V7Q J;  2XND H;  3NXS A;  1BDC A;  5KLV J;  3E7K A;  1JB0 J;  4XE5 B;  1KYO I;  3L71 J;  3R2P A;  1RY3 A;  3AE8 C;  4YXD C;  1NTM J;  2P2U A;  2P1J A;  3CX5 E;  1JY3 O;  5APQ A;  1H89 A;  5KJ7 D;  1BCC G;  2YKQ A;  4WY4 C;  1NAY A;  2A45 G;  3E1R A;  1HJB A;  1NVO A;  1SP4 A;  1T2K C;  1Q81 Q;  3H1L G;  1H0T B;  4W7Y A;  2WWW A;  1ZV8 A;  1QL1 A;  1JCC A;  5AVS B;  3MD0 A;  3QWO C;  1YHQ P;  2PP6 A;  3JC2 2;  3L72 J;  1FOS F;  1VQ9 P;  3KZI E;  1E5W A;  3H1L E;  3C9I A;  2KIK A;  3A0B H;  3TDK A;  3HE4 B;  5B66 E;  1IZN B;  1NTK K;  3KQG A;  2CPB A;  3AE3 C;  4XA4 A;  4LLH A;  5BVZ A;  3GLM A;  3Q3D A;  1FE6 A;  3KDP B;  3RK3 E;  1J1D C;  2CPS A;  4PV1 D;  3CD6 P;  4ASW A;  4OWF A;  1LP1 B;  1NTZ J;  1NTM D;  1VQ6 P;  1OXZ A;  4C46 A;  1OZH A;  4H44 D;  1LTG C;  2W6J H;  3MP7 B;  3G6E P;  3CL3 D;  1FZC B;  1KQG B;  2Q3E A;  2ZVO B;  2KNC A;  1Y8A A;  3CWB E;  1N7S D;  5APU A;  3L74 E;  2NPS A;  1KQL A;  1SQP E;  3GHG B;  1JY2 P;  1T3J A;  3RK3 B;  1KFM A;  3CME P;  2G8Y A;  4GOE A;  3WU2 H;  5KJ7 C;  5CJ0 A;  1J2J B;  3L72 D;  5EFW B;  3D70 A;  2BEQ D;  2WSC J;  3H32 B;  1VQL P;  3C1L A;  3H1H E;  3P7K A;  1GL2 C;  2WIT A;  3EQ2 A;  1P84 D;  3L70 D;  2M8R A;  1VQ5 P;  3L37 A;  1K9M Q;  1ZP0 C;  4JF7 A;  3S1K A;  4D6T E;  3AEG C;  1KIL D;  1W5C E;  2AXT E;  2M5A B;  1YYC A;  5APS A;  2HG5 D;  1EDL A;  1MFZ A;  1FZE A;  5APY A;  1YJ9 P;  2I8D A;  1JCD A;  3O8Z A;  1HF9 A;  2YO2 A;  1PGQ A;  2A06 E;  3PHL A;  3R4Y A;  3VMA A;  3VTP C;  3VMX A;  3SWF A;  2AEM A;  3CCR P;  2BEZ F;  1NKN A;  1NGM B;  5KAF H;  3H1I D;  2I1K A;  1Q90 D;  1SFC C;  1L4A B;  1W2B O;  2VRS A;  1VQM P;  3OJA B;  1BSH A;  3IN6 A;  2D2C C;  1LTI C;  1IFI A;  1N86 A;  3L73 G;  3CWB D;  5KLI C;  2H7H A;  2IBZ D;  2Q3I A;  4WBA A;  3G71 P;  2P67 A;  3PTZ A;  3CCU P;  1E79 H;  2N9Y B;  5CHX A;  1A02 J;  1K04 A;  2WSF J;  1RQU A;  3P32 A;  2JDI H;  2KI7 B;  1M57 D;  2XDJ A;  1SQQ J;  2YIU C;  2FKW B;  1VQN P;  2BCC J;  5CCH D;  2FFD A;  1T3U A;  1LWU C;  2WPR A;  1L0N J;  3MUD C;  1JY3 P;  3Q2Y A;  2AEJ A;  1KYO D;  1X9V A;  5KLI B;  4AUW A;  4H0L C;  1JNM A;  1SQQ K;  4I2L C;  3AEB C;  2GM4 A;  1L0L E;  3D6Y A;  1RE3 A;  1OIP A;  2E74 C;  4DCK A;  5BU5 A;  4IL6 E;  1RHZ B;  2HPC B;  1NTM K;  1G1I A;  4EDF A;  3M0D A;  3BVH A;  2GA1 A;  4RKU J;  4UB8 H;  3I5C A;  4DT0 A;  1FDI A;  3WUV A;  1GDT A;  2H88 C;  1AQ5 A;  1GW4 A;  2QJK B;  2ZXE B;  2KSE A;  4H13 C;  1Q2N A;  1BE3 D;  2HFE D;  5AVR B;  3H1K E;  3GHG A;  1FZF A;  1CW5 A;  2IZ1 A;  3CXH H;  1K05 A;  1X8Y A;  2FXP A;  4L74 A;  5KAI H;  3KYQ A;  1PP9 D;  4N78 E;  2KUB A;  2IDB A;  1IFN A;  1OX3 A;  1X22 A;  3M9B A;  1BE3 E;  2YNY A;  3PLN A;  4YTP C;  1PV3 A;  3VOP A;  3B5N A;  1NTZ E;  1ZRT D;  2NRG A;  3IR9 A;  5AVZ B;  2OTJ P;  1LP1 A;  1L0N D;  1WRG A;  3HD7 C;  2PFX A;  1MFT A;  3HTK A;  1KIL E;  2W27 A;  1RE4 C;  4JPZ B;  5AW7 B;  1BCC J;  4B86 A;  1SQQ G;  1YJW P;  1HH0 A;  3CXH D;  1KC8 Q;  2BCC G;  2E74 D;  2KS1 A;  1KN7 A;  2W6A A;  1VDF A;  1BDD A;  1SQB G;  2AEF A;  2IBZ E;  4D6T J;  2O1J A;  3A0H E;  3EFG A;  1FDO A;  2N1T D;  2YKO A;  3V6I A;  5CBO A;  4GOF A;  1S1C X;  2KXP B;  1PP9 E;  2R3S A;  4KT0 J;  4N78 D;  3SWY A;  3CCS P;  1N73 B;  1JEK A;  3PRJ A;  2Q6Q A;  5TIS E;  1SQP D;  2AXT H;  3L75 D;  4U3F G;  1NOH A;  1SVF A;  5KKZ C;  1GD2 E;  4L73 A;  2Q9I A;  2E76 B;  1N7L A;  5B66 H;  2KS1 B;  3OW2 O;  4PD4 E;  1EZV I;  5TJH A;  3H1J G;  1UII A;  4K35 A;  3L74 J;  5M1B A;  4BXL A;  1JTH B;  4WVZ A;  3L75 E;  4LGD E;  2E75 B;  2OYH A;  2KYV A;  3CI9 A;  4OGQ C;  1MZ9 A;  2FFD B;  1NAF A;  3AE9 C;  3OA7 A;  2KB7 P;  3N7N A;  2WMM A;  1DH3 A;  2RN0 A;  1NTK E;  4PD4 D;  3A7O A;  3H1I J;  2N1T A;  4M3L A;  3Q5R A;  2H43 A;  1FS0 E;  2A06 G;  1X79 B;  1RF1 B;  2WT7 B;  1GL2 B;  1NTK D;  1SQX K;  3L71 G;  1LT9 B;  2IBZ I;  3SWK A;  3CLQ A;  1Y9B A;  2FFD C;  2E42 A;  1KD1 Q;  4D6T D;  2N9B A;  3HD7 A;  1M1J A;  2WPV B;  1BGY D;  3B5N B;  3H1J E;  3D71 A;  1CZQ A;  3KHU A;  1LTJ A;  3PH0 A;  1P84 H;  2O01 J;  5APX A;  3H1L J;  4H0L B;  2ITA A;  2M0B A;  1JY2 N;  2HPC A;  1SQB J;  3BAT A;  1N73 C;  3BCC G;  1M90 Q;  1LWU B;  2RH0 A;  1LTB C;  1MV8 A;  2ZJS E;  5AVV B;  3H1K G;  1NU1 J;  1VF5 B;  2NPS D;  1YIJ P;  1PPJ D;  2YMK A;  2HOD A;  3L74 D;  3G9R A;  2BAS A;  3MHV A;  3RL0 D;  5KLV K;  1PFI A;  3M9H A;  4EI2 A;  3RBZ A;  1EQ7 A;  2FYU K;  2C0X A;  2K9J B;  1SQQ E;  1KQF B;  3AE2 C;  3AEC C;  1H8A A;  1EDJ A;  2ZYA A;  3LIE A;  2XZR A;  2JP3 A;  1OW6 A;  1L4A C;  2NPS B;  3RL0 B;  5KAI E;  1IFP A;  1URQ D;  2P58 A;  1NTZ G;  2KOG A;  3MTU E;  3RK3 D;  1RF1 A;  4O9B A;  3ZDM A;  1KTM A;  3U1A A;  2ZT9 B;  1GK6 A;  2O01 H;  4Y99 C;  3AEE C;  3JCU H;  2LR2 A;  3K5B A;  5AW3 B;  4BRY B;  2FY8 A;  4TLF A;  1JTH A;  2R5D A;  4H44 B;  1GW3 A;  1P84 E;  1R5S A;  3EFF K;  3GW6 A;  2K9J A;  3L70 E;  2QJP C;  3AE4 C;  4XFJ A;  4RES B;  4GKG A;  3M06 A;  1S5L H;  4WY4 B;  2QG4 A;  4NPF X;  1QL2 A;  4W80 A;  5APV A;  5B5E E;  1P84 I;  1AFO A;  1EXI A;  3L73 E;  2W6B A;  1TU3 F;  2E74 B;  1R8E A;  1T2K D;  3RK3 C;  2K88 A;  2L5G B;  1DD3 A;  3I56 P;  3BCC J;  4GT1 A;  3Q1M A;  4WY4 A;  2H89 C;  2SPZ A;  2J59 M;  5APT A;  2QA4 P;  4R4L A;  1SQP J;  2ZAE B;  1KB9 H;  2R5B A;  5CMZ A;  2LXC B;  1LWU A;  2Z4E A;  3CCL P;  3CWB J;  2L91 A;  3A2A A;  2K3R A;  4I7Z C;  3TGU G;  4AYC A;  2FYU G;  1GZL A;  1L0L D;  1S2E A;  3O6Q A;  1GL2 A;  3S4R A;  1ZLL A;  2YXR B;  2ZYD A;  3H1H G;  2J58 A;  3L73 J;  4WWI A;  4ASV A;  3NFQ A;  5KLV G;  3MIW A;  2WSC H;  2FYN B;  3AE1 C;  1KB9 I;  5KJ7 A;  1KB9 D;  2KP8 A;  2PGD A;  3B71 A;  3P8C E;  1IC2 A;  2QJY B;  5GTI E;  4Y28 J;  3EWK A;  2OQQ A;  1S3J A;  4HH2 A;  2B89 A;  3OAK A;  1J1E B;  4PD4 I;  3RK2 B;  1CSB A;  1PIX A;  2YO3 A;  3FWL A;  3GF7 A;  3Q5S A;  2FXM A;  1OW8 A;  1S5L E;  2KZJ A;  3O6Q B;  3AEF C;  4GOD A;  4IOI H;  1IK9 A;  5CJ4 A;  1KZU B;  3A0H H;  1KQS O;  3B5N D;  3H1L D;  1R5L A;  1IO4 A;  1VQK P;  2JKV A;  3RK2 D;  1SQX G;  3L70 J;  5CCH A;  2OYI A;  2C9L Y;  1AJY A;  1L2P A;  1S5L X;  2WVR A;  1FDM A;  1LTS C;  1PL5 A;  1NU1 D;  3PP5 A;  1SQV G;  1LJ2 A;  3UIA A;  1Z56 A;  1M1J B;  1ZN5 A;  1ZME C;  4PD4 H;  2E5T A;  5AW0 B;  2KLU A;  3TSI A;  2OYI B;  1NWQ A;  3NMD A;  2IFN A;  3FX0 A;  1EDI A;  2NZ2 A;  3CWB G;  2WPS A;  2Q7C A;  2QE7 H;  3SSU A;  1CI6 B;  3IF4 A;  4DZO A;  2OTL P;  2QJP B;  1KIL C;  2FYU J;  1GMJ A;  3TGU E;  3Q5P A;  1BCC D;  3A3Y B;  3AED C;  1U7M A;  2XKM A;  4GDO A;  3RBX A;  1OVU A;  2WPQ A;  1QVG O;  1NU1 K;  1OVV A;  1BSN A;  3MGN A;  1XTG B;  1N8R Q;  1PZQ A;  2GUS A;  1T6A A;  1NU1 E;  1SQV E; 
#chains in the Genus database with same CATH homology
 2XND H;  1FS0 E;  3USS A;  3PJS K;  4YXW H;  1IFP A;  2CK3 H;  2WSS H;  2W6J H;  2E5T A;  2E5Y A;  1JEK A;  4QMA A;  1BSH A;  4TLF A;  2QE7 H;  3EFF K;  1E79 H;  2JDI H;  4WVZ A;  2V7Q H;  4DJG A;  1BSN A;  1AQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...