1IFQA

Sec22b n-terminal domain
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
SVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel snare N-terminal domain revealed by the crystal structure of Sec22b.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords vesicle trafficking protein Sec22b
total genus 36
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ifqA00
3KYQA 4B93A 1H8MA 2DMWA 2VX8A 3EGXC 3EGDC 1IOUA 3BW6A 2NUTC 4AFIA 1IFQA 2NUPC
chains in the Genus database with same CATH superfamily
1K25A 3PBOA 4HBUA 2OV5A 2WKPA 4LV0A 1BLCA 2VV7A 4UA9A 1XFQA 5DTTA 5FDSA 5M19A 4IEDA 1LSVA 2YKHA 2ZBBA 3KX0X 4ZRRA 3NDGA 1MWRA 4S2LA 5IHVA 2HDSA 5FQJA 3NCKA 3UDFA 4PPRA 5DTKA 4RA7A 1ONGA 4E6XA 2XK1A 5HPFA 5EVIC 2OSUA 4JF4A 3R7WA 1UWNX 5EECA 2P9VB 4X1LA 4U0XA 3IXBA 2LB9A 3IBRA 3TW8A 5TJJA 1KGGA 3UB5P 4ME4A 1W7FA 4JPMA 1CI9A 5GHYA 3IXDA 4R70A 5AQ7A 3LEZA 1SDNA 4QY6A 3N8RA 2PD8A 1SKOB 3W2ZA 3VP3A 4ZJ3A 4G3WA 5GLDA 5FAPA 1HTZA 5F69A 3WS4A 3UDIA 2IWDA 2J80A 3UB8A 4LRZE 1JTDA 4GDBA 4OQHA 4LPZA 2XA7S 4EBNA 4GB7A 1KVMA 3HLDA 1H8MA 5L10A 2XH9A 2RL3A 4GS9A 2ZQ7A 3TE8A 2H10A 3OPRA 3C5AA 1W8QA 2EWVA 1J3WA 5GLCA 1P0ZA 1Q2QA 4E3JA 3M2KA 1IELA 4NXFA 5F6AA 3UN7A 3KSIA 2B02A 3LI9A 5FEGA 1JNUA 3VSKA 1IYPA 1W5DA 3E4OA 4MCWA 4KZ6A 4R6LA 1TDLA 3M6HA 1YMXA 2HP5A 3LGOA 4R4RA 4R3AA 1K38A 3LCEA 2EX9A 2Y2KA 3AGDA 3CUEA 4WMCA 1MC0A 2OOLA 1GCEA 4IUHA 4YNRA 4WMCD 5HWVA 2HZ5A 1L0GA 1NYYA 3DW0A 1N9BA 4G3VA 2XF3A 3NJAA 3ZG0A 1V9ZA 1IYSA 2VZWA 4Q0HA 1DJCA 2PAVP 3T4KA 2PT7A 3CWFA 3QHYA 3MQOA 5F1FA 1BZAA 4KUOA 5HWTA 1S4RA 1S0WA 1NJ4A 3BY9A 1ZC2A 1L3LA 2L0WA 2M1CA 3ZYTA 2PR5A 2ZC4B 4P6BA 4O0PA 2JN7A 5FAOA 2E8IA 3VFFA 3ZG8B 5CGXA 1T18A 4KZ9A 3KSFA 5G4YA 5D3OA 1P9WA 1S1YA 4G3KA 1N4OA 1CJFA 5CXWA 2VV8A 3BFCA 1KOUA 1SZVA 3IHBA 1CI8A 1BT5A 3S1YA 1ZHHB 4HP9A 2Y2GA 3MSHA 2G7UA 1O07A 5AVFA 4IHQA 3EOIA 3E4PA 4HH2A 4WZ5A 2J7VA 3NOUC 2ZOIA 3LI8A 5E2HA 3N8LA 3ULFA 1GSWA 3LY3A 4DE1A 2Y55A 2KLIA 3UB9A 3Q1FA 1GA9A 1W63M 4LGWA 4C3QA 4BBVA 4WEJA 2EX6A 3HVFA 4F94A 4BLMA 5AJGA 2ACGA 3T1SA 1D7EA 3AGFA 5EPHA 1P97A 1OJ5A 3IF6C 3E0YA 2BTFP 4XUZA 1OTIA 4ETZA 3HUMA 4H8RA 3GMWA 2L1MA 1MXOA 3D3OA 2Z6DA 3BW6A 4Q0JA 1I5QA 3T1XA 1BTLA 4HNBA 3M2JA 4Y15A 1K55C 4JGOA 3LR3A 3MFDA 4Q8IA 2HV1A 2GNXA 2A49A 4JLFA 1N9NA 2HP6A 2W3DA 1LI9A 1VEUB 1F5MA 3BJNA 2VGJA 1NRJA 1PRQA 3HLEA 4R0QA 3K3DA 4MDZA 3VE4A 3ZNYA 4YWZA 4WZ5C 4PM5A 3HLCA 4R1GA 5HAQA 1GA0A 5HW3A 2G2UA 4KQRA 1TS0A 3S7OA 3VOLA 1ES3A 1FIKA 1MWUA 3GTCA 2Z2LB 1XJ3A 4HH3A 4JF6A 1XJ2A 1K54A 2IA2A 3EQUA 4WLAA 1NXYA 1LL5A 1H5XA 3BQAA 3T4TA 4Y0UA 3MKEA 4B4ZA 2ZQ9A 1YLPA 3RTYA 4PM8A 3U2AA 2R78A 4BMWA 1KVLA 5FI6A 5DTSA 4IJGA 5EVEA 5CEBA 4GCZA 4OPYA 2G2WA 1ESUA 3MBZA 3LIDA 2O0YA 1H0MA 1D1JA 3F1OA 1BLHA 3UMEA 1GSVA 4FH2A 3IX3A 4LV1A 3ZFZA 2ZJ9A 2EA9A 3DWZA 2EWWA 2JKTI 4ARZB 5FQMA 1BUEA 4WBGA 3UPPA 2UWXA 4DMZA 3OCNA 3CJMA 4DJ2A 4K0XA 1JWZA 1Q2PA 3UMDA 5EM0A 1DRMA 1OMEA 2PRFA 2WKIA 2Y4AA 5FL3A 2KDKA 5J4EA 2A24A 3NIAA 4DF6A 3EGDC 2VGLS 5A91A 4ZAMA 2P08A 4GJ4A 3DWKA 1ACFA 1K56D 5DKLA 3RXXA 4Y5FA 1K57A 3V5MA 5FQKA 1PWGA 2IWCA 1K56A 2O9AA 2WK0A 3PYPA 2WKRA 4K0WA 4MEZA 2XRNA 4MNRA 2PR6A 3PAEA 1ERQA 3VMAA 5FASA 1YQSA 4BJPA 2QMIA 4BL3A 3BWLA 3MXQA 3IF5A 3B47A 1S66L 4II7A 4UA6A 3UPOA 2D02A 1PI5A 1TD5A 2ZQAA 1PWDA 4ZDXA 1T19A 3UE1A 2NUPC 4GD6A 4JXSA 5J8XA 1JWVA 5IT5A 1HZOA 5F1GA 4GHIB 2HPBA 4KZAA 2WKHA 1M6KA 3DTMA 1IEMA 3Q07A 5F83A 1ZG6A 4LCMA 4YINA 1A0KA 3SH8A 4OPZA 1Y28A 5TBMA 4S2NC 1BLPA 4KG6A 4LCLA 4XXRA 5CGWA 1TS6A 1O7EA 4FUWA 4HESA 5EVIA 3HJKA 4BENA 3N8SA 1N9OA 4K08A 4OPRA 4B88A 3QP6A 2J9PA 4UHUA 3UB7A 1G28A 1EW0A 4OQ0A 1E3UA 1N9LA 4RQ9A 5L09A 3VV4A 4LRYC 4BD0A 1FQGA 3RJUA 4HHDA 3VP2A 3CPTA 4BBTA 4ZJ2A 3PBTA 4XT2A 4PHTA 2P04A 1FR1A 2W3EA 1FCOA 3M6BA 4UAAA 4PM6A 4EUZA 5HFOA 3BFEA 3NULA 2J3TC 1SHVA 3FKVA 5KMWA 1XXMA 3A3DA 2FFYA 3TRCA 2WZXA 5TGFA 3BLMA 3PBNA 1FCMA 3Q7VA 2RCXA 3A0SA 1GHIA 5GLAA 4OOLA 3QP5A 4UA7A 4I3IA 4O8GA 4PKYA 2PBDP 2KX6A 3QP4A 2OAQ1 1YT4A 2Q0OA 1TEMA 1TDGA 1PZOA 3ISGA 4E3IA 5E2EA 3ZG5A 1OTAA 3VOZA 3MZEA 3MZFA 1MKIA 5MC7A 1Y4OA 4ESPA 1ES4A 4P87A 3KYZA 1PNEA 4BL2A 2DMWA 4EW7A 1CEFA 2H0YA 3F1NB 3LIFA 4EBPA 4S2JA 1IKIA 3K2NA 2CMNA 3B42A 3MF0A 5CRFA 4GNUA 4UEYA 5AQAA 2Y2LA 1P9RA 1BULA 1K4EA 2WZZA 4OONA 4DN0A 2A3UA 1S67L 5G4ZA 1YSQA 5CX7A 5EOEA 4KZ7A 1IOUA 5AQBA 4ZBEA 2BASA 3BECA 5FAQA 4JXWA 3V39A 3WS2A 3MMHA 4OQGA 3G32A 5EVIB 4LENA 2X02A 2IWBA 4X55A 2W1TB 2VKSA 3LO7A 3T4LA 2V0WA 1Z09A 3IXHA 4CPKA 2ZD8A 1OTEA 1UGUA 4FD8A 2GZAA 2HP9A 2DNSA 2BLSA 2PHYA 1K54C 4QHCA 2V1ZA 1TS7A 2ZOHA 2OWJA 3DTIA 5IU1A 4MMNA 4NXBA 3UO9A 4MBFA 4QPRA 3T4OA 2H28A 5HL6A 3V3SA 3EGXC 4GHIA 3PHYA 2VLGA 1L2SA 4HJ3A 4OLGA 2V1BA 4Y17A 1QMEA 3N6IA 4OOMA 5A92A 3OPPA 5I94A 2VGLM 4PM9A 3MS6A 1L0EA 5DF8A 2QJ7A 4HI4A 3EEHA 4ETXA 3DBAA 4Q0IA 2PDRA 5DFYA 5HDSA 4KQOA 4DDSA 4EESA 3LEQA 1F9IA 2M7UA 3T4JA 4H6JB 1PZPA 1S4SA 3CAXA 4U0TA 3IF6A 4MLLA 3IBJA 3OBFA 3VSLA 1L0DA 1WA9A 3C7UA 5HD3A 1KDWA 4XT2B 3SS3A 2JHEA 4N1HA 3IF6B 4RYEA 4HY8A 3HLFA 2XR0A 4WELA 2NUTC 4ZTKA 1KDSA 4GOGA 2HGVA 4E3OA 3IX4A 4IBXA 4L9GA 4JGRA 4PAUA 4EEUA 2QYBA 4HBTA 1G6AA 3E2LA 5M18A 3ZG7B 3HJIA 4X6TA 3CG5A 3RFBA 4WYYA 3G35A 2VA0A 1PW8A 3CI6A 3GSGA 5L07A 3EEAA 4B4XA 3HBRA 2W3GA 5HX9A 3IWIA 2XGNA 3SOIA 3G30A 2X01A 1DP6A 3C7VA 2L4RA 3ZVWA 3C30A 2PYPA 4EQIA 1RP5A 1RGZA 2O9CA 4OPQA 1PIOA 1DY6A 1PW1A 1RGYA 5AQ9A 2XROA 3NC8A 3BFGA 1K4FA 4F3LA 4DXCA 4DKIA 3BQ8A 2W0NA 5TR7A 3HCYA 1KGEA 2ZM2A 3NECA 2OAP1 5FQQA 2A2LA 3A0RA 1VB6A 2OLVA 2LB5A 3E4QA 4WN5A 3Q7ZA 2JE5A 5BOHA 4EWFA 3NBLA 3SW1A 4KQQA 3UE3A 1PYYA 3SH9A 3GDIA 5CHUA 4OOYA 4P85A 3H82A 3P01A 4N9LA 4GKUA 3S4XA 3ICYA 4R3JA 4IUKA 3PR6A 3A3JA 5HWWA 1XFNA 1XP4A 4E6WA 1E25A 5EV0A 1KE3A 4KZ5A 2HJ9C 5FATA 2DRWA 3GR2A 3N7WA 3FZCA 2HJEA 2WADA 4H6JA 2QJ5A 3F1OB 3VP0A 3LIEA 3CITA 4CJNA 2ZL1A 2R9XA 2O99A 3TJZC 3ITAA 3HLBA 1G5UA 1K55A 2Y2QA 3NY4A 2GX5A 1H8ZA 3HLWA 3IWOA 4LV2A 3TG9A 2ZQCA 4NETA 4D2OA 1G68A 4S2IA 3E2KA 5TFQA 2JKRM 4YOFA 3S7NA 4NXEA 3T50A 4DDYA 3GVBA 1W79A 3OC2A 4EU0A 4JXVA 1T1AA 1LSXA 3BEBA 4O01A 4IBRA 1Y54A 2A24B 1YSPA 3H7WA 2PU4A 1JVJA 1VEUA 4GS9B 3H9WA 3UNWA 2V8FA 3BYDA 5DFXA 2O9BA 1C3BA 4YFMA 3UPNA 2JBFA 1EWZA 1SKOA 4PM7A 3KYQA 4P6ZM 3WRZA 4S2PA 4FH4A 1SCWA 2Z2MB 5K5BA 1ZG4A 4CLCA 3FPWA 2GJ3A 1J9MA 2FFFB 3EQVA 4GZBA 5CERA 4QB8A 4I5SA 4PKYG 4HJ6A 1H3QA 4RX3A 4Y0OA 2ZC6B 1XA1A 5FI7A 2W27A 3PXPA 5CHJA 1LT0A 3BM6A 4QWOA 1TVFA 1K6SA 1KGFA 1E4DA 4S2KA 2B95A 3FC7A 2PBYA 4GW9A 3WRTA 2QKPA 4EQ1A 4LLOB 3O87A 4N1XA 3PTEA 1D06A 3LY4A 3H82B 3L7HA 5F68A 2VJWA 2Z6CA 5KSCA 5HDCA 4KZBA 5FDHA 1S1ZA 4N92A 4HJ4A 4ZJ1A 3OCLA 5FSRA 3A3IA 3MR0A 4BQMA 3KYEA 4X53A 3VP1A 3RXWA 3ZVTA 2JC7A 4LV3A 3S22A 2KOIA 2J3WA 4ARZA 1FCNA 1QMFA 5HAIA 1IYQA 3W4OA 1T1BA 2XA7M 3UY6A 2ZLYA 1VHMA 1IYOA 4WL9A 1ZTUA 3QNCA 1FSWA 3HLGA 2QZ6A 3C38A 3F1PB 4KG2A 5HSQA 1YLYA 4OP8A 2Y2IA 1UWPX 3DTKA 4M4XA 4UQIS 1NZOA 1KE4A 2VV6A 4DXBA 4QD4A 3MXRA 5F82A 2V0UA 1AWIA 3KSGA 2EXBA 3ITBA 3SS4A 3CLOA 3IS2B 1FR6A 4HP4A 2R9WA 1DP9A 4GLQA 1W63Q 3FWLA 3JYIA 5FQ9A 4LFUA 4CQHA 4Y0TA 3GQZA 1ODVA 4NKPA 2Y2JA 3SH7A 1LLBA 4NEED 3ZNTA 4B93A 5E43A 5IS1A 2VX8A 1VQQA 2V1AA 3LR5A 3ZGAB 5CTNA 1NLZA 2EFUA 1BSGA 1XA7A 3LR0A 2B5RA 2Y2MA 3GECA 4K91A 3VP4A 3OOVA 3WS0A 3FG8A 3CZDA 2WUQA 2XFTA 4UQIM 3IQAA 3EWKA 5GHXA 1GHMA 2HDQA 3OPLA 3UE6A 3V67A 1YPRA 1OPXA 4WZ4A 3IX8A 1U60A 5DF9A 5E2GA 2WYXA 4B9OA 1VETB 2ZMAA 3ZDJA 1ESIA 1YLWA 3MXSA 4BBUA 3VE3A 4BWIA 1EI5A 1SDEA 2QHKA 4S2NA 3NDEA 2X71A 2ZQ8A 2ZM8A 1YLTA 1HD8A 5HZHA 1VETA 5GLBA 3T4QA 2JCHA 5JYPA 5A8BA 1ZKJA 3KSHA 4MBKA 1ERMA 2Y79A 3T1QB 4EV4A 3T4SA 2B18A 5CHMA 2ZMFA 5FI2A 1XJ4A 1GSXA 2QPNA 4ID4A 4GN2A 4A5RA 4C6YA 1TF1A 3IXGA 3G2ZA 2JKFA 5EVID 1GHPA 3BY8A 1PWCA 3QP2A 1OJGA 2Y2PA 2XQZA 5CGSA 1CQAA 3QP1A 2D01A 4FOFA 3PBQA 4PMAA 5HDDA 4EERA 3PBRA 5J7EA 3QNBA 5HL1A 4LRXC 5G18A 2Y2OA 4KZ8A 5L8MA 3G2YA 2H0TA 1WE4A 5I5LA 4OLDA 3Q7VB 1OT9A 2J8YA 4C75A 3PBSA 4R3BA 3W4PA 1K57C 4OVDA 2DCFA 3C2WA 3HUNA 2W1RA 4NG2A 2XDMA 3WS5A 3IS2A 4CLCE 1HLUP 4P6ZS 2WGIA 2JKGA 5HPIA 3FV7A 3ZHHA 1OTDA 2CC1A 1E3UD 4E3KA 1WYBA 1BLSA 3CUEC 2INWA 3LIAA 3I7JA 1V9YA 3D72A 1WYCA 3R4KA 4JBFA 2BG1A 2ZQDA 4Y7PA 3T12B 1FOFA 4DE0A 4S2OA 3PAGA 1MBLA 1ONHA 3B33A 4IVKA 4EXOA 3F1PA 2WGVA 4KG5A 2E8JA 4X25A 3A3EA 4DRTA 1S6RA 1X0OA 1RCJA 1FSYA 4QU3A 4RVAA 3SZTA 4E3MA 1L0FA 4CLCC 3OPHA 2XD1A 4E3LA 4IVIA 4JGQA 5DJTA 2HDUA 3W8KA 1M40A 4GD8A 2Y59A 5EUAA 2WAEA 4QJGA 1NWZA 2K7SA 5DJUA 4M3KA 4WF0A 1OTBA 4L9FA 5DVAA 5HAPA 2W1TA 1NLYA 3HREA 2QWSA 4DJ3A 3B3XA 5FA7A 2FZ0A 2Y2HA 4BD1A 4DE2A 3D9YA 2V9AA 3OZHA 3P98A 2WGWB 3FPVA 4F3LB 1T1CA 5TBMB 2XLNA 3C4PA 1ALQA 1YLJA 5AVEA 3NI9A 1YMSA 1MWTA 3S7PA 2VK3A 2M7VA 4OH0A 2PYRA 4NXGA 4WM9A 4QY5A 1MWSA 3Q81A 1TS8A 5EOOA 5C5KA 3GRJA 2PU2A 5E2FA 1LHYA 2W3FA 3LR4A 4I39A 3MKFA 4O7DA 3NOPC 1LL8A 3O86A 1JTGA 2P7JA 2HF6A 3QP8A 3Q82A 2ZMVA 5EFWA 3DAVA 1STZA 4X56A 5KIZA 2V20A 5LBRA 1PFLA 2FH5A 2EFXA 3O3VA 1KE0A 4MN7A 4OQIA 1F98A 3BLSA 4X68A 3BFFA 1ES2A 1NY0A 4WEKA 4EUVA 2ZC3B 1NYMA 5J3WA 3MQ0A 1XGJA 5FQIA 2Q9NA 3VFHA 3VOYA 2EXAA 2MJ6A 3JVUA 1FILA 1YM1A 4MBHA 3G34A 3OLOA 3W4QA 3JVVA 4I38A 4CLCD 3CHWP 3A0VA 4X1MA 3AGEA 2ZM0A 2XFSA 4FSFA 2VEAA 2PD7A 2J3TD 4HOIA 4I3JA 3K3CA 2K2NA 4E3NA 3JPUA 1IFQA 2I72A 3L9KA 3F1NA 4E04A 2I9VA 4KENB 1NZUA 4OKPA 1LI0A 2GDNA 5DF7A 4HQAA 1LL9A 3CMZA 4S2MA 4XUXA 3G6OA 3DTEA 2XSSA 4EBLA 4DE3A 4U3TA 1Z6FA 1YKDA 5FEFA 4MN5A 1K0KA 1NRFA 3U4LP 1W8YA 3LFVA 2VGKA 3WWXA 2ZC5B 4N9KA 4MN6A 4Y3IA 3T1RA 2Y91A 5CECA 3UE0A 3G4PA 5CEDA 3ZQ5A 1YLZA 2WKQA 3BFDA 1CK3A 1PI4A 3NOTC 3NHQA 2ZC7A 1MZUA 4GDNA 5GHZA 1VM1A 3MQQA 4X69A 2C6WB 4JF5A 4KZ4A 3MJQA 3A3FA 3GV9A 1ES5A 1I2SA 2J9OA 5GL9A 3FYZA 4R38A 4EETB 1DJAA 2P9VA 2ZL1B 2Y8HA 1DP8A 5KSHA 2UV0E 2P74A 3SS5A 2HDRA 2AVXA 2WGWA 1MPLA 3CPTB 3HL9A 4Z9QA 4NK3A 1AXBA 3WS1A 2Q9MA 4JKTA 5KZHA 3MFXA 4Y2FA 1MY8A 3LIBA 4R4SA 1YAXA 2V2FF 2W3HA 3BRMA 4L0LA 4FCFA 2EX8A 3TSGA 2XD5A 3FKWA 3TOIA 3ZG9B 3MZDA 1OT6A 3IHAA 4EEPA 3C8CA 1LSWA 3HUOA 3KO6A 4OP5A 5EM1A 4AFIA 1HVBA 3N4IA 2JKTM 2OLUA 5EE8A 1XX2A 3O88A 4Y13A 3IWQA 3RH8B 3R7WB 3G31A 3LICA 1K6RA 3O5YA 3IT9A 1I2WA 3LUQA 1BYWA 5DKKA 4WUJA 1F2KA 1IKGA 3V3RA 4JGPA 5HARA 4KQDA 4CLCB 5JYOA 4R23A 2C5WB 3P09A 5U47A 3P7NA 2K31A 1SKFA 2WKEA 1CEGA 4L9EA 2OWHA 2XEPA 4FTXA 1DJBA 3S7QA 3C4OA 1EROA 4KUKA 5F5YA 5A90A 4RX2A 3V50A 2V8CA 3H7WB 1H8YA 4D60A 1XJ6A 1G6OA 1MKMA 3LYXA 1JWPA 3E98A 3ZCZA 4KZ3A 2H5SA 1XGIA 3D4FA 5CTMA 5A93A 2EX2A 5EVLA 3IH8A 3IH9A 5HD5A 2Y2NA 5L2FA 2JKRI 1XPBA 4Z1WA 5M1AA 2WAFA 4JXGA 4HEFA 1CF0A 3UDXA 1XKZA 2YKFA 3UB6A 4I3AA 4P0MA 4HIAA
chains in the Genus database with same CATH topology
2LB5A 3E4QA 3PBOA 4WN5A 2WKPA 1DRMA 3B33A 4EXOA 3F1PA 2VV7A 5FL3A 2KDKA 3SW1A 5J4EA 2A24A 1XFQA 3UE3A 3EGDC 2VGLS 1X0OA 3GDIA 2P08A 4GJ4A 5DKLA 4Y5FA 3H82A 3P01A 4CLCC 1LSVA 2YKHA 3ICYA 4IUKA 3PR6A 2ZBBA 3KX0X 4ZRRA 4JGQA 5HWWA 2O9AA 1XFNA 3PYPA 5DJTA 2WKRA 2XRNA 2PR6A 2HJ9C 1NWZA 2K7SA 5DJUA 4WF0A 1OTBA 4L9FA 4BJPA 2W1TA 1NLYA 3BWLA 2QWSA 3MXQA 4DJ3A 2HJEA 5HPFA 3B47A 4H6JA 1UWNX 3R7WA 2QJ5A 3F1OB 1S66L 4II7A 3LIEA 2FZ0A 3CITA 2D02A 2O99A 3TJZC 1TD5A 2LB9A 2V9AA 3IBRA 3TW8A 5TJJA 1T19A 3FPVA 4F3LB 1T1CA 5TBMB 2NUPC 4ME4A 2GX5A 5IT5A 5AVEA 4GHIB 4R70A 2JKRM 4YOFA 3S7NA 4NXEA 3S7PA 3T50A 2M7VA 1Y28A 2PYRA 5TBMA 4NXGA 3OC2A 4EU0A 2PD8A 3W2ZA 1T1AA 1LSXA 1TS8A 4O01A 2A24B 1YSPA 5C5KA 3H7WA 4G3WA 2W3FA 5F69A 1TS6A 3LR4A 4GS9B 4I39A 3H9WA 2J80A 3HJKA 5DFXA 2O9BA 3UB8A 4LRZE 3NOPC 1LL8A 4LPZA 2XA7S 3KYQA 1N9OA 1H8MA 4K08A 2P7JA 4P6ZM 2HF6A 4GS9A 2ZMVA 5EFWA 1G28A 3UB7A 3TE8A 1STZA 1EW0A 4RQ9A 1N9LA 3VV4A 4LRYC 5K5BA 5KIZA 4HHDA 5LBRA 2EWVA 1P0ZA 4CLCA 3FPWA 2FH5A 2GJ3A 4BBTA 3EQVA 3PBTA 4XT2A 4I5SA 4PHTA 4MN7A 4PKYG 2P04A 4HJ6A 4NXFA 5F6AA 1H3QA 2W3EA 3KSIA 1F98A 2B02A 3LI9A 1JNUA 2J3TC 2W27A 3PXPA 4WEKA 4EUVA 1LT0A 3E4OA 4MCWA 5J3WA 4R6LA 3MQ0A 3TRCA 3FC7A 4GW9A 4R3AA 4EQ1A 2QKPA 3PBNA 4LLOB 3CUEA 3A0SA 1D06A 2MJ6A 3JVUA 4OOLA 1MC0A 3H82B 2OOLA 5F68A 3OLOA 2VJWA 3JVVA 2Z6CA 4I3IA 4O8GA 5HDCA 4PKYA 4I38A 4CLCD 1S1ZA 4IUHA 4YNRA 4HJ4A 3A0VA 5HWVA 3OCLA 4FSFA 2KX6A 2VEAA 2PD7A 4G3VA 2OAQ1 2J3TD 4HOIA 4I3JA 3MR0A 3K3CA 2K2NA 1IFQA 3F1NA 4E04A 3NJAA 2I9VA 1OTAA 1V9ZA 2VZWA 4Q0HA 5MC7A 2KOIA 3KYZA 3T4KA 2J3WA 2PT7A 4ARZA 4HQAA 3CWFA 2DMWA 3MQOA 1T1BA 4KUOA 5HWTA 2XA7M 4EW7A 1S4RA 3F1NB 3LIFA 3G6OA 2XSSA 3BY9A 1VHMA 2L0WA 2M1CA 3K2NA 2CMNA 2PR5A 3B42A 3MF0A 4WL9A 3ZYTA 1ZTUA 1YKDA 4UEYA 3C38A 4MN5A 4O0PA 2JN7A 3F1PB 5HSQA 1P9RA 1UWPX 4M4XA 1T18A 3LFVA 3KSFA 4UQIS 5G4YA 4DN0A 4Y3IA 1S67L 4MN6A 5G4ZA 1YSQA 5CX7A 1P9WA 2VV6A 1S1YA 4G3KA 1IOUA 2VV8A 1KOUA 3ZQ5A 2WKQA 2V0UA 2BASA 3KSGA 3NOTC 1ZHHB 3CLOA 3IS2B 3NHQA 3MMHA 4HP4A 4HP9A 1DP9A 1MZUA 4GLQA 1W63Q 2G7UA 3MQQA 5AVFA 4IHQA 4CQHA 3EOIA 3E4PA 4HH2A 1ODVA 4NKPA 3NOUC 2W1TB 2VKSA 2ZOIA 3T4LA 3LI8A 2V0WA 3ULFA 3MJQA 4NEED 1GSWA 4B93A 2KLIA 3UB9A 1OTEA 1UGUA 5IS1A 2VX8A 2GZAA 1W63M 2V1AA 3LR5A 2PHYA 1TS7A 2ZOHA 4R38A 1NLZA 4BBVA 4EETB 4WEJA 2Y8HA 3LR0A 1DP8A 2OWJA 5IU1A 4MMNA 5KSHA 4NXBA 3GECA 3OOVA 5AJGA 4QPRA 3FG8A 1D7EA 3T4OA 2H28A 1P97A 5HL6A 1OJ5A 3EGXC 4GHIA 3PHYA 4UQIM 3E0YA 3EWKA 2VLGA 1OTIA 4ETZA 4HJ3A 3MFXA 3UE6A 3V67A 4Y2FA 1OPXA 2V1BA 2L1MA 3LIBA 3D3OA 2Z6DA 3BW6A 4Q0JA 1YAXA 2W3HA 4L0LA 4HNBA 5DF9A 4OOMA 4JGOA 3LR3A 4B9OA 2VGLM 2HV1A 2GNXA 2QJ7A 4HI4A 1OT6A 3EEHA 4ETXA 3DBAA 4Q0IA 3VE3A 4BBUA 2PDRA 1N9NA 4EEPA 5DFYA 2W3DA 4BWIA 3C8CA 5HDSA 1LSWA 4KQOA 1F5MA 2QHKA 3KO6A 3BJNA 4AFIA 1NRJA 3K3DA 4MDZA 3VE4A 4EESA 5HZHA 2JKTM 4YWZA 3T4QA 1F9IA 2M7UA 5A8BA 1TS0A 3KSHA 3RH8B 3T4JA 4H6JB 3R7WB 1S4SA 3CAXA 3LICA 3S7OA 3VOLA 3O5YA 3LUQA 2Y79A 1BYWA 3IBJA 5DKKA 4WUJA 1XJ3A 3OBFA 3T4SA 1WA9A 5HD3A 2B18A 4HH3A 4JGPA 2ZMFA 1XJ4A 1GSXA 4XT2B 4KQDA 4CLCB 1XJ2A 1TF1A 2JHEA 2IA2A 3EQUA 4WLAA 4HY8A 3P7NA 3BY8A 2K31A 4WELA 2NUTC 1OJGA 3BQAA 3T4TA 2HGVA 4L9EA 3RTYA 4L9GA 4JGRA 4PAUA 4EEUA 2OWHA 2D01A 4FOFA 3PBQA 3U2AA 2QYBA 5HDDA 3S7QA 4EERA 3PBRA 2R78A 5J7EA 4KUKA 4LRXC 5F5YA 4BMWA 3H7WB 3HJIA 5L8MA 3RFBA 2VA0A 5I5LA 3CI6A 1XJ6A 1OT9A 1G6OA 3PBSA 4IJGA 3EEAA 1MKMA 3LYXA 2W3GA 3E98A 4GCZA 3C2WA 2W1RA 3LIDA 2O0YA 3IS2A 1DP6A 3F1OA 3UMEA 4CLCE 1GSVA 2L4RA 3C30A 4P6ZS 2PYPA 5HD5A 5HPIA 2JKRI 2O9CA 1OTDA 4Z1WA 2XROA 2EA9A 4F3LA 2EWWA 3BQ8A 3CUEC 2JKTI 2W0NA 2INWA 2YKFA 3UB6A 4ARZB 4I3AA 3LIAA 3HCYA 4DMZA 3OCNA 2OAP1 1V9YA 3D72A 2A2LA 3A0RA 4DJ2A 4HIAA 3R4KA 1VB6A 3UMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KYQ A;  4B93 A;  1H8M A;  2DMW A;  2VX8 A;  3EGX C;  3EGD C;  1IOU A;  3BW6 A;  2NUT C;  4AFI A;  1IFQ A;  2NUP C; 
#chains in the Genus database with same CATH topology
 1K25 A;  3PBO A;  4HBU A;  2OV5 A;  2WKP A;  4LV0 A;  1BLC A;  2VV7 A;  4UA9 A;  1XFQ A;  5DTT A;  5FDS A;  5M19 A;  4IED A;  1LSV A;  2YKH A;  2ZBB A;  3KX0 X;  4ZRR A;  3NDG A;  1MWR A;  4S2L A;  5IHV A;  2HDS A;  5FQJ A;  3NCK A;  3UDF A;  4PPR A;  5DTK A;  4RA7 A;  1ONG A;  4E6X A;  2XK1 A;  5HPF A;  5EVI C;  2OSU A;  4JF4 A;  3R7W A;  1UWN X;  5EEC A;  2P9V B;  4X1L A;  4U0X A;  3IXB A;  2LB9 A;  3IBR A;  3TW8 A;  5TJJ A;  1KGG A;  3UB5 P;  4ME4 A;  1W7F A;  4JPM A;  1CI9 A;  5GHY A;  3IXD A;  4R70 A;  5AQ7 A;  3LEZ A;  1SDN A;  4QY6 A;  3N8R A;  2PD8 A;  1SKO B;  3W2Z A;  3VP3 A;  4ZJ3 A;  4G3W A;  5GLD A;  5FAP A;  1HTZ A;  5F69 A;  3WS4 A;  3UDI A;  2IWD A;  2J80 A;  3UB8 A;  4LRZ E;  1JTD A;  4GDB A;  4OQH A;  4LPZ A;  2XA7 S;  4EBN A;  4GB7 A;  1KVM A;  3HLD A;  1H8M A;  5L10 A;  2XH9 A;  2RL3 A;  4GS9 A;  2ZQ7 A;  3TE8 A;  2H10 A;  3OPR A;  3C5A A;  1W8Q A;  2EWV A;  1J3W A;  5GLC A;  1P0Z A;  1Q2Q A;  4E3J A;  3M2K A;  1IEL A;  4NXF A;  5F6A A;  3UN7 A;  3KSI A;  2B02 A;  3LI9 A;  5FEG A;  1JNU A;  3VSK A;  1IYP A;  1W5D A;  3E4O A;  4MCW A;  4KZ6 A;  4R6L A;  1TDL A;  3M6H A;  1YMX A;  2HP5 A;  3LGO A;  4R4R A;  4R3A A;  1K38 A;  3LCE A;  2EX9 A;  2Y2K A;  3AGD A;  3CUE A;  4WMC A;  1MC0 A;  2OOL A;  1GCE A;  4IUH A;  4YNR A;  4WMC D;  5HWV A;  2HZ5 A;  1L0G A;  1NYY A;  3DW0 A;  1N9B A;  4G3V A;  2XF3 A;  3NJA A;  3ZG0 A;  1V9Z A;  1IYS A;  2VZW A;  4Q0H A;  1DJC A;  2PAV P;  3T4K A;  2PT7 A;  3CWF A;  3QHY A;  3MQO A;  5F1F A;  1BZA A;  4KUO A;  5HWT A;  1S4R A;  1S0W A;  1NJ4 A;  3BY9 A;  1ZC2 A;  1L3L A;  2L0W A;  2M1C A;  3ZYT A;  2PR5 A;  2ZC4 B;  4P6B A;  4O0P A;  2JN7 A;  5FAO A;  2E8I A;  3VFF A;  3ZG8 B;  5CGX A;  1T18 A;  4KZ9 A;  3KSF A;  5G4Y A;  5D3O A;  1P9W A;  1S1Y A;  4G3K A;  1N4O A;  1CJF A;  5CXW A;  2VV8 A;  3BFC A;  1KOU A;  1SZV A;  3IHB A;  1CI8 A;  1BT5 A;  3S1Y A;  1ZHH B;  4HP9 A;  2Y2G A;  3MSH A;  2G7U A;  1O07 A;  5AVF A;  4IHQ A;  3EOI A;  3E4P A;  4HH2 A;  4WZ5 A;  2J7V A;  3NOU C;  2ZOI A;  3LI8 A;  5E2H A;  3N8L A;  3ULF A;  1GSW A;  3LY3 A;  4DE1 A;  2Y55 A;  2KLI A;  3UB9 A;  3Q1F A;  1GA9 A;  1W63 M;  4LGW A;  4C3Q A;  4BBV A;  4WEJ A;  2EX6 A;  3HVF A;  4F94 A;  4BLM A;  5AJG A;  2ACG A;  3T1S A;  1D7E A;  3AGF A;  5EPH A;  1P97 A;  1OJ5 A;  3IF6 C;  3E0Y A;  2BTF P;  4XUZ A;  1OTI A;  4ETZ A;  3HUM A;  4H8R A;  3GMW A;  2L1M A;  1MXO A;  3D3O A;  2Z6D A;  3BW6 A;  4Q0J A;  1I5Q A;  3T1X A;  1BTL A;  4HNB A;  3M2J A;  4Y15 A;  1K55 C;  4JGO A;  3LR3 A;  3MFD A;  4Q8I A;  2HV1 A;  2GNX A;  2A49 A;  4JLF A;  1N9N A;  2HP6 A;  2W3D A;  1LI9 A;  1VEU B;  1F5M A;  3BJN A;  2VGJ A;  1NRJ A;  1PRQ A;  3HLE A;  4R0Q A;  3K3D A;  4MDZ A;  3VE4 A;  3ZNY A;  4YWZ A;  4WZ5 C;  4PM5 A;  3HLC A;  4R1G A;  5HAQ A;  1GA0 A;  5HW3 A;  2G2U A;  4KQR A;  1TS0 A;  3S7O A;  3VOL A;  1ES3 A;  1FIK A;  1MWU A;  3GTC A;  2Z2L B;  1XJ3 A;  4HH3 A;  4JF6 A;  1XJ2 A;  1K54 A;  2IA2 A;  3EQU A;  4WLA A;  1NXY A;  1LL5 A;  1H5X A;  3BQA A;  3T4T A;  4Y0U A;  3MKE A;  4B4Z A;  2ZQ9 A;  1YLP A;  3RTY A;  4PM8 A;  3U2A A;  2R78 A;  4BMW A;  1KVL A;  5FI6 A;  5DTS A;  4IJG A;  5EVE A;  5CEB A;  4GCZ A;  4OPY A;  2G2W A;  1ESU A;  3MBZ A;  3LID A;  2O0Y A;  1H0M A;  1D1J A;  3F1O A;  1BLH A;  3UME A;  1GSV A;  4FH2 A;  3IX3 A;  4LV1 A;  3ZFZ A;  2ZJ9 A;  2EA9 A;  3DWZ A;  2EWW A;  2JKT I;  4ARZ B;  5FQM A;  1BUE A;  4WBG A;  3UPP A;  2UWX A;  4DMZ A;  3OCN A;  3CJM A;  4DJ2 A;  4K0X A;  1JWZ A;  1Q2P A;  3UMD A;  5EM0 A;  1DRM A;  1OME A;  2PRF A;  2WKI A;  2Y4A A;  5FL3 A;  2KDK A;  5J4E A;  2A24 A;  3NIA A;  4DF6 A;  3EGD C;  2VGL S;  5A91 A;  4ZAM A;  2P08 A;  4GJ4 A;  3DWK A;  1ACF A;  1K56 D;  5DKL A;  3RXX A;  4Y5F A;  1K57 A;  3V5M A;  5FQK A;  1PWG A;  2IWC A;  1K56 A;  2O9A A;  2WK0 A;  3PYP A;  2WKR A;  4K0W A;  4MEZ A;  2XRN A;  4MNR A;  2PR6 A;  3PAE A;  1ERQ A;  3VMA A;  5FAS A;  1YQS A;  4BJP A;  2QMI A;  4BL3 A;  3BWL A;  3MXQ A;  3IF5 A;  3B47 A;  1S66 L;  4II7 A;  4UA6 A;  3UPO A;  2D02 A;  1PI5 A;  1TD5 A;  2ZQA A;  1PWD A;  4ZDX A;  1T19 A;  3UE1 A;  2NUP C;  4GD6 A;  4JXS A;  5J8X A;  1JWV A;  5IT5 A;  1HZO A;  5F1G A;  4GHI B;  2HPB A;  4KZA A;  2WKH A;  1M6K A;  3DTM A;  1IEM A;  3Q07 A;  5F83 A;  1ZG6 A;  4LCM A;  4YIN A;  1A0K A;  3SH8 A;  4OPZ A;  1Y28 A;  5TBM A;  4S2N C;  1BLP A;  4KG6 A;  4LCL A;  4XXR A;  5CGW A;  1TS6 A;  1O7E A;  4FUW A;  4HES A;  5EVI A;  3HJK A;  4BEN A;  3N8S A;  1N9O A;  4K08 A;  4OPR A;  4B88 A;  3QP6 A;  2J9P A;  4UHU A;  3UB7 A;  1G28 A;  1EW0 A;  4OQ0 A;  1E3U A;  1N9L A;  4RQ9 A;  5L09 A;  3VV4 A;  4LRY C;  4BD0 A;  1FQG A;  3RJU A;  4HHD A;  3VP2 A;  3CPT A;  4BBT A;  4ZJ2 A;  3PBT A;  4XT2 A;  4PHT A;  2P04 A;  1FR1 A;  2W3E A;  1FCO A;  3M6B A;  4UAA A;  4PM6 A;  4EUZ A;  5HFO A;  3BFE A;  3NUL A;  2J3T C;  1SHV A;  3FKV A;  5KMW A;  1XXM A;  3A3D A;  2FFY A;  3TRC A;  2WZX A;  5TGF A;  3BLM A;  3PBN A;  1FCM A;  3Q7V A;  2RCX A;  3A0S A;  1GHI A;  5GLA A;  4OOL A;  3QP5 A;  4UA7 A;  4I3I A;  4O8G A;  4PKY A;  2PBD P;  2KX6 A;  3QP4 A;  2OAQ 1;  1YT4 A;  2Q0O A;  1TEM A;  1TDG A;  1PZO A;  3ISG A;  4E3I A;  5E2E A;  3ZG5 A;  1OTA A;  3VOZ A;  3MZE A;  3MZF A;  1MKI A;  5MC7 A;  1Y4O A;  4ESP A;  1ES4 A;  4P87 A;  3KYZ A;  1PNE A;  4BL2 A;  2DMW A;  4EW7 A;  1CEF A;  2H0Y A;  3F1N B;  3LIF A;  4EBP A;  4S2J A;  1IKI A;  3K2N A;  2CMN A;  3B42 A;  3MF0 A;  5CRF A;  4GNU A;  4UEY A;  5AQA A;  2Y2L A;  1P9R A;  1BUL A;  1K4E A;  2WZZ A;  4OON A;  4DN0 A;  2A3U A;  1S67 L;  5G4Z A;  1YSQ A;  5CX7 A;  5EOE A;  4KZ7 A;  1IOU A;  5AQB A;  4ZBE A;  2BAS A;  3BEC A;  5FAQ A;  4JXW A;  3V39 A;  3WS2 A;  3MMH A;  4OQG A;  3G32 A;  5EVI B;  4LEN A;  2X02 A;  2IWB A;  4X55 A;  2W1T B;  2VKS A;  3LO7 A;  3T4L A;  2V0W A;  1Z09 A;  3IXH A;  4CPK A;  2ZD8 A;  1OTE A;  1UGU A;  4FD8 A;  2GZA A;  2HP9 A;  2DNS A;  2BLS A;  2PHY A;  1K54 C;  4QHC A;  2V1Z A;  1TS7 A;  2ZOH A;  2OWJ A;  3DTI A;  5IU1 A;  4MMN A;  4NXB A;  3UO9 A;  4MBF A;  4QPR A;  3T4O A;  2H28 A;  5HL6 A;  3V3S A;  3EGX C;  4GHI A;  3PHY A;  2VLG A;  1L2S A;  4HJ3 A;  4OLG A;  2V1B A;  4Y17 A;  1QME A;  3N6I A;  4OOM A;  5A92 A;  3OPP A;  5I94 A;  2VGL M;  4PM9 A;  3MS6 A;  1L0E A;  5DF8 A;  2QJ7 A;  4HI4 A;  3EEH A;  4ETX A;  3DBA A;  4Q0I A;  2PDR A;  5DFY A;  5HDS A;  4KQO A;  4DDS A;  4EES A;  3LEQ A;  1F9I A;  2M7U A;  3T4J A;  4H6J B;  1PZP A;  1S4S A;  3CAX A;  4U0T A;  3IF6 A;  4MLL A;  3IBJ A;  3OBF A;  3VSL A;  1L0D A;  1WA9 A;  3C7U A;  5HD3 A;  1KDW A;  4XT2 B;  3SS3 A;  2JHE A;  4N1H A;  3IF6 B;  4RYE A;  4HY8 A;  3HLF A;  2XR0 A;  4WEL A;  2NUT C;  4ZTK A;  1KDS A;  4GOG A;  2HGV A;  4E3O A;  3IX4 A;  4IBX A;  4L9G A;  4JGR A;  4PAU A;  4EEU A;  2QYB A;  4HBT A;  1G6A A;  3E2L A;  5M18 A;  3ZG7 B;  3HJI A;  4X6T A;  3CG5 A;  3RFB A;  4WYY A;  3G35 A;  2VA0 A;  1PW8 A;  3CI6 A;  3GSG A;  5L07 A;  3EEA A;  4B4X A;  3HBR A;  2W3G A;  5HX9 A;  3IWI A;  2XGN A;  3SOI A;  3G30 A;  2X01 A;  1DP6 A;  3C7V A;  2L4R A;  3ZVW A;  3C30 A;  2PYP A;  4EQI A;  1RP5 A;  1RGZ A;  2O9C A;  4OPQ A;  1PIO A;  1DY6 A;  1PW1 A;  1RGY A;  5AQ9 A;  2XRO A;  3NC8 A;  3BFG A;  1K4F A;  4F3L A;  4DXC A;  4DKI A;  3BQ8 A;  2W0N A;  5TR7 A;  3HCY A;  1KGE A;  2ZM2 A;  3NEC A;  2OAP 1;  5FQQ A;  2A2L A;  3A0R A;  1VB6 A;  2OLV A;  2LB5 A;  3E4Q A;  4WN5 A;  3Q7Z A;  2JE5 A;  5BOH A;  4EWF A;  3NBL A;  3SW1 A;  4KQQ A;  3UE3 A;  1PYY A;  3SH9 A;  3GDI A;  5CHU A;  4OOY A;  4P85 A;  3H82 A;  3P01 A;  4N9L A;  4GKU A;  3S4X A;  3ICY A;  4R3J A;  4IUK A;  3PR6 A;  3A3J A;  5HWW A;  1XFN A;  1XP4 A;  4E6W A;  1E25 A;  5EV0 A;  1KE3 A;  4KZ5 A;  2HJ9 C;  5FAT A;  2DRW A;  3GR2 A;  3N7W A;  3FZC A;  2HJE A;  2WAD A;  4H6J A;  2QJ5 A;  3F1O B;  3VP0 A;  3LIE A;  3CIT A;  4CJN A;  2ZL1 A;  2R9X A;  2O99 A;  3TJZ C;  3ITA A;  3HLB A;  1G5U A;  1K55 A;  2Y2Q A;  3NY4 A;  2GX5 A;  1H8Z A;  3HLW A;  3IWO A;  4LV2 A;  3TG9 A;  2ZQC A;  4NET A;  4D2O A;  1G68 A;  4S2I A;  3E2K A;  5TFQ A;  2JKR M;  4YOF A;  3S7N A;  4NXE A;  3T50 A;  4DDY A;  3GVB A;  1W79 A;  3OC2 A;  4EU0 A;  4JXV A;  1T1A A;  1LSX A;  3BEB A;  4O01 A;  4IBR A;  1Y54 A;  2A24 B;  1YSP A;  3H7W A;  2PU4 A;  1JVJ A;  1VEU A;  4GS9 B;  3H9W A;  3UNW A;  2V8F A;  3BYD A;  5DFX A;  2O9B A;  1C3B A;  4YFM A;  3UPN A;  2JBF A;  1EWZ A;  1SKO A;  4PM7 A;  3KYQ A;  4P6Z M;  3WRZ A;  4S2P A;  4FH4 A;  1SCW A;  2Z2M B;  5K5B A;  1ZG4 A;  4CLC A;  3FPW A;  2GJ3 A;  1J9M A;  2FFF B;  3EQV A;  4GZB A;  5CER A;  4QB8 A;  4I5S A;  4PKY G;  4HJ6 A;  1H3Q A;  4RX3 A;  4Y0O A;  2ZC6 B;  1XA1 A;  5FI7 A;  2W27 A;  3PXP A;  5CHJ A;  1LT0 A;  3BM6 A;  4QWO A;  1TVF A;  1K6S A;  1KGF A;  1E4D A;  4S2K A;  2B95 A;  3FC7 A;  2PBY A;  4GW9 A;  3WRT A;  2QKP A;  4EQ1 A;  4LLO B;  3O87 A;  4N1X A;  3PTE A;  1D06 A;  3LY4 A;  3H82 B;  3L7H A;  5F68 A;  2VJW A;  2Z6C A;  5KSC A;  5HDC A;  4KZB A;  5FDH A;  1S1Z A;  4N92 A;  4HJ4 A;  4ZJ1 A;  3OCL A;  5FSR A;  3A3I A;  3MR0 A;  4BQM A;  3KYE A;  4X53 A;  3VP1 A;  3RXW A;  3ZVT A;  2JC7 A;  4LV3 A;  3S22 A;  2KOI A;  2J3W A;  4ARZ A;  1FCN A;  1QMF A;  5HAI A;  1IYQ A;  3W4O A;  1T1B A;  2XA7 M;  3UY6 A;  2ZLY A;  1VHM A;  1IYO A;  4WL9 A;  1ZTU A;  3QNC A;  1FSW A;  3HLG A;  2QZ6 A;  3C38 A;  3F1P B;  4KG2 A;  5HSQ A;  1YLY A;  4OP8 A;  2Y2I A;  1UWP X;  3DTK A;  4M4X A;  4UQI S;  1NZO A;  1KE4 A;  2VV6 A;  4DXB A;  4QD4 A;  3MXR A;  5F82 A;  2V0U A;  1AWI A;  3KSG A;  2EXB A;  3ITB A;  3SS4 A;  3CLO A;  3IS2 B;  1FR6 A;  4HP4 A;  2R9W A;  1DP9 A;  4GLQ A;  1W63 Q;  3FWL A;  3JYI A;  5FQ9 A;  4LFU A;  4CQH A;  4Y0T A;  3GQZ A;  1ODV A;  4NKP A;  2Y2J A;  3SH7 A;  1LLB A;  4NEE D;  3ZNT A;  4B93 A;  5E43 A;  5IS1 A;  2VX8 A;  1VQQ A;  2V1A A;  3LR5 A;  3ZGA B;  5CTN A;  1NLZ A;  2EFU A;  1BSG A;  1XA7 A;  3LR0 A;  2B5R A;  2Y2M A;  3GEC A;  4K91 A;  3VP4 A;  3OOV A;  3WS0 A;  3FG8 A;  3CZD A;  2WUQ A;  2XFT A;  4UQI M;  3IQA A;  3EWK A;  5GHX A;  1GHM A;  2HDQ A;  3OPL A;  3UE6 A;  3V67 A;  1YPR A;  1OPX A;  4WZ4 A;  3IX8 A;  1U60 A;  5DF9 A;  5E2G A;  2WYX A;  4B9O A;  1VET B;  2ZMA A;  3ZDJ A;  1ESI A;  1YLW A;  3MXS A;  4BBU A;  3VE3 A;  4BWI A;  1EI5 A;  1SDE A;  2QHK A;  4S2N A;  3NDE A;  2X71 A;  2ZQ8 A;  2ZM8 A;  1YLT A;  1HD8 A;  5HZH A;  1VET A;  5GLB A;  3T4Q A;  2JCH A;  5JYP A;  5A8B A;  1ZKJ A;  3KSH A;  4MBK A;  1ERM A;  2Y79 A;  3T1Q B;  4EV4 A;  3T4S A;  2B18 A;  5CHM A;  2ZMF A;  5FI2 A;  1XJ4 A;  1GSX A;  2QPN A;  4ID4 A;  4GN2 A;  4A5R A;  4C6Y A;  1TF1 A;  3IXG A;  3G2Z A;  2JKF A;  5EVI D;  1GHP A;  3BY8 A;  1PWC A;  3QP2 A;  1OJG A;  2Y2P A;  2XQZ A;  5CGS A;  1CQA A;  3QP1 A;  2D01 A;  4FOF A;  3PBQ A;  4PMA A;  5HDD A;  4EER A;  3PBR A;  5J7E A;  3QNB A;  5HL1 A;  4LRX C;  5G18 A;  2Y2O A;  4KZ8 A;  5L8M A;  3G2Y A;  2H0T A;  1WE4 A;  5I5L A;  4OLD A;  3Q7V B;  1OT9 A;  2J8Y A;  4C75 A;  3PBS A;  4R3B A;  3W4P A;  1K57 C;  4OVD A;  2DCF A;  3C2W A;  3HUN A;  2W1R A;  4NG2 A;  2XDM A;  3WS5 A;  3IS2 A;  4CLC E;  1HLU P;  4P6Z S;  2WGI A;  2JKG A;  5HPI A;  3FV7 A;  3ZHH A;  1OTD A;  2CC1 A;  1E3U D;  4E3K A;  1WYB A;  1BLS A;  3CUE C;  2INW A;  3LIA A;  3I7J A;  1V9Y A;  3D72 A;  1WYC A;  3R4K A;  4JBF A;  2BG1 A;  2ZQD A;  4Y7P A;  3T12 B;  1FOF A;  4DE0 A;  4S2O A;  3PAG A;  1MBL A;  1ONH A;  3B33 A;  4IVK A;  4EXO A;  3F1P A;  2WGV A;  4KG5 A;  2E8J A;  4X25 A;  3A3E A;  4DRT A;  1S6R A;  1X0O A;  1RCJ A;  1FSY A;  4QU3 A;  4RVA A;  3SZT A;  4E3M A;  1L0F A;  4CLC C;  3OPH A;  2XD1 A;  4E3L A;  4IVI A;  4JGQ A;  5DJT A;  2HDU A;  3W8K A;  1M40 A;  4GD8 A;  2Y59 A;  5EUA A;  2WAE A;  4QJG A;  1NWZ A;  2K7S A;  5DJU A;  4M3K A;  4WF0 A;  1OTB A;  4L9F A;  5DVA A;  5HAP A;  2W1T A;  1NLY A;  3HRE A;  2QWS A;  4DJ3 A;  3B3X A;  5FA7 A;  2FZ0 A;  2Y2H A;  4BD1 A;  4DE2 A;  3D9Y A;  2V9A A;  3OZH A;  3P98 A;  2WGW B;  3FPV A;  4F3L B;  1T1C A;  5TBM B;  2XLN A;  3C4P A;  1ALQ A;  1YLJ A;  5AVE A;  3NI9 A;  1YMS A;  1MWT A;  3S7P A;  2VK3 A;  2M7V A;  4OH0 A;  2PYR A;  4NXG A;  4WM9 A;  4QY5 A;  1MWS A;  3Q81 A;  1TS8 A;  5EOO A;  5C5K A;  3GRJ A;  2PU2 A;  5E2F A;  1LHY A;  2W3F A;  3LR4 A;  4I39 A;  3MKF A;  4O7D A;  3NOP C;  1LL8 A;  3O86 A;  1JTG A;  2P7J A;  2HF6 A;  3QP8 A;  3Q82 A;  2ZMV A;  5EFW A;  3DAV A;  1STZ A;  4X56 A;  5KIZ A;  2V20 A;  5LBR A;  1PFL A;  2FH5 A;  2EFX A;  3O3V A;  1KE0 A;  4MN7 A;  4OQI A;  1F98 A;  3BLS A;  4X68 A;  3BFF A;  1ES2 A;  1NY0 A;  4WEK A;  4EUV A;  2ZC3 B;  1NYM A;  5J3W A;  3MQ0 A;  1XGJ A;  5FQI A;  2Q9N A;  3VFH A;  3VOY A;  2EXA A;  2MJ6 A;  3JVU A;  1FIL A;  1YM1 A;  4MBH A;  3G34 A;  3OLO A;  3W4Q A;  3JVV A;  4I38 A;  4CLC D;  3CHW P;  3A0V A;  4X1M A;  3AGE A;  2ZM0 A;  2XFS A;  4FSF A;  2VEA A;  2PD7 A;  2J3T D;  4HOI A;  4I3J A;  3K3C A;  2K2N A;  4E3N A;  3JPU A;  1IFQ A;  2I72 A;  3L9K A;  3F1N A;  4E04 A;  2I9V A;  4KEN B;  1NZU A;  4OKP A;  1LI0 A;  2GDN A;  5DF7 A;  4HQA A;  1LL9 A;  3CMZ A;  4S2M A;  4XUX A;  3G6O A;  3DTE A;  2XSS A;  4EBL A;  4DE3 A;  4U3T A;  1Z6F A;  1YKD A;  5FEF A;  4MN5 A;  1K0K A;  1NRF A;  3U4L P;  1W8Y A;  3LFV A;  2VGK A;  3WWX A;  2ZC5 B;  4N9K A;  4MN6 A;  4Y3I A;  3T1R A;  2Y91 A;  5CEC A;  3UE0 A;  3G4P A;  5CED A;  3ZQ5 A;  1YLZ A;  2WKQ A;  3BFD A;  1CK3 A;  1PI4 A;  3NOT C;  3NHQ A;  2ZC7 A;  1MZU A;  4GDN A;  5GHZ A;  1VM1 A;  3MQQ A;  4X69 A;  2C6W B;  4JF5 A;  4KZ4 A;  3MJQ A;  3A3F A;  3GV9 A;  1ES5 A;  1I2S A;  2J9O A;  5GL9 A;  3FYZ A;  4R38 A;  4EET B;  1DJA A;  2P9V A;  2ZL1 B;  2Y8H A;  1DP8 A;  5KSH A;  2UV0 E;  2P74 A;  3SS5 A;  2HDR A;  2AVX A;  2WGW A;  1MPL A;  3CPT B;  3HL9 A;  4Z9Q A;  4NK3 A;  1AXB A;  3WS1 A;  2Q9M A;  4JKT A;  5KZH A;  3MFX A;  4Y2F A;  1MY8 A;  3LIB A;  4R4S A;  1YAX A;  2V2F F;  2W3H A;  3BRM A;  4L0L A;  4FCF A;  2EX8 A;  3TSG A;  2XD5 A;  3FKW A;  3TOI A;  3ZG9 B;  3MZD A;  1OT6 A;  3IHA A;  4EEP A;  3C8C A;  1LSW A;  3HUO A;  3KO6 A;  4OP5 A;  5EM1 A;  4AFI A;  1HVB A;  3N4I A;  2JKT M;  2OLU A;  5EE8 A;  1XX2 A;  3O88 A;  4Y13 A;  3IWQ A;  3RH8 B;  3R7W B;  3G31 A;  3LIC A;  1K6R A;  3O5Y A;  3IT9 A;  1I2W A;  3LUQ A;  1BYW A;  5DKK A;  4WUJ A;  1F2K A;  1IKG A;  3V3R A;  4JGP A;  5HAR A;  4KQD A;  4CLC B;  5JYO A;  4R23 A;  2C5W B;  3P09 A;  5U47 A;  3P7N A;  2K31 A;  1SKF A;  2WKE A;  1CEG A;  4L9E A;  2OWH A;  2XEP A;  4FTX A;  1DJB A;  3S7Q A;  3C4O A;  1ERO A;  4KUK A;  5F5Y A;  5A90 A;  4RX2 A;  3V50 A;  2V8C A;  3H7W B;  1H8Y A;  4D60 A;  1XJ6 A;  1G6O A;  1MKM A;  3LYX A;  1JWP A;  3E98 A;  3ZCZ A;  4KZ3 A;  2H5S A;  1XGI A;  3D4F A;  5CTM A;  5A93 A;  2EX2 A;  5EVL A;  3IH8 A;  3IH9 A;  5HD5 A;  2Y2N A;  5L2F A;  2JKR I;  1XPB A;  4Z1W A;  5M1A A;  2WAF A;  4JXG A;  4HEF A;  1CF0 A;  3UDX A;  1XKZ A;  2YKF A;  3UB6 A;  4I3A A;  4P0M A;  4HIA A; 
#chains in the Genus database with same CATH homology
 2LB5 A;  3E4Q A;  3PBO A;  4WN5 A;  2WKP A;  1DRM A;  3B33 A;  4EXO A;  3F1P A;  2VV7 A;  5FL3 A;  2KDK A;  3SW1 A;  5J4E A;  2A24 A;  1XFQ A;  3UE3 A;  3EGD C;  2VGL S;  1X0O A;  3GDI A;  2P08 A;  4GJ4 A;  5DKL A;  4Y5F A;  3H82 A;  3P01 A;  4CLC C;  1LSV A;  2YKH A;  3ICY A;  4IUK A;  3PR6 A;  2ZBB A;  3KX0 X;  4ZRR A;  4JGQ A;  5HWW A;  2O9A A;  1XFN A;  3PYP A;  5DJT A;  2WKR A;  2XRN A;  2PR6 A;  2HJ9 C;  1NWZ A;  2K7S A;  5DJU A;  4WF0 A;  1OTB A;  4L9F A;  4BJP A;  2W1T A;  1NLY A;  3BWL A;  2QWS A;  3MXQ A;  4DJ3 A;  2HJE A;  5HPF A;  3B47 A;  4H6J A;  1UWN X;  3R7W A;  2QJ5 A;  3F1O B;  1S66 L;  4II7 A;  3LIE A;  2FZ0 A;  3CIT A;  2D02 A;  2O99 A;  3TJZ C;  1TD5 A;  2LB9 A;  2V9A A;  3IBR A;  3TW8 A;  5TJJ A;  1T19 A;  3FPV A;  4F3L B;  1T1C A;  5TBM B;  2NUP C;  4ME4 A;  2GX5 A;  5IT5 A;  5AVE A;  4GHI B;  4R70 A;  2JKR M;  4YOF A;  3S7N A;  4NXE A;  3S7P A;  3T50 A;  2M7V A;  1Y28 A;  2PYR A;  5TBM A;  4NXG A;  3OC2 A;  4EU0 A;  2PD8 A;  3W2Z A;  1T1A A;  1LSX A;  1TS8 A;  4O01 A;  2A24 B;  1YSP A;  5C5K A;  3H7W A;  4G3W A;  2W3F A;  5F69 A;  1TS6 A;  3LR4 A;  4GS9 B;  4I39 A;  3H9W A;  2J80 A;  3HJK A;  5DFX A;  2O9B A;  3UB8 A;  4LRZ E;  3NOP C;  1LL8 A;  4LPZ A;  2XA7 S;  3KYQ A;  1N9O A;  1H8M A;  4K08 A;  2P7J A;  4P6Z M;  2HF6 A;  4GS9 A;  2ZMV A;  5EFW A;  1G28 A;  3UB7 A;  3TE8 A;  1STZ A;  1EW0 A;  4RQ9 A;  1N9L A;  3VV4 A;  4LRY C;  5K5B A;  5KIZ A;  4HHD A;  5LBR A;  2EWV A;  1P0Z A;  4CLC A;  3FPW A;  2FH5 A;  2GJ3 A;  4BBT A;  3EQV A;  3PBT A;  4XT2 A;  4I5S A;  4PHT A;  4MN7 A;  4PKY G;  2P04 A;  4HJ6 A;  4NXF A;  5F6A A;  1H3Q A;  2W3E A;  3KSI A;  1F98 A;  2B02 A;  3LI9 A;  1JNU A;  2J3T C;  2W27 A;  3PXP A;  4WEK A;  4EUV A;  1LT0 A;  3E4O A;  4MCW A;  5J3W A;  4R6L A;  3MQ0 A;  3TRC A;  3FC7 A;  4GW9 A;  4R3A A;  4EQ1 A;  2QKP A;  3PBN A;  4LLO B;  3CUE A;  3A0S A;  1D06 A;  2MJ6 A;  3JVU A;  4OOL A;  1MC0 A;  3H82 B;  2OOL A;  5F68 A;  3OLO A;  2VJW A;  3JVV A;  2Z6C A;  4I3I A;  4O8G A;  5HDC A;  4PKY A;  4I38 A;  4CLC D;  1S1Z A;  4IUH A;  4YNR A;  4HJ4 A;  3A0V A;  5HWV A;  3OCL A;  4FSF A;  2KX6 A;  2VEA A;  2PD7 A;  4G3V A;  2OAQ 1;  2J3T D;  4HOI A;  4I3J A;  3MR0 A;  3K3C A;  2K2N A;  1IFQ A;  3F1N A;  4E04 A;  3NJA A;  2I9V A;  1OTA A;  1V9Z A;  2VZW A;  4Q0H A;  5MC7 A;  2KOI A;  3KYZ A;  3T4K A;  2J3W A;  2PT7 A;  4ARZ A;  4HQA A;  3CWF A;  2DMW A;  3MQO A;  1T1B A;  4KUO A;  5HWT A;  2XA7 M;  4EW7 A;  1S4R A;  3F1N B;  3LIF A;  3G6O A;  2XSS A;  3BY9 A;  1VHM A;  2L0W A;  2M1C A;  3K2N A;  2CMN A;  2PR5 A;  3B42 A;  3MF0 A;  4WL9 A;  3ZYT A;  1ZTU A;  1YKD A;  4UEY A;  3C38 A;  4MN5 A;  4O0P A;  2JN7 A;  3F1P B;  5HSQ A;  1P9R A;  1UWP X;  4M4X A;  1T18 A;  3LFV A;  3KSF A;  4UQI S;  5G4Y A;  4DN0 A;  4Y3I A;  1S67 L;  4MN6 A;  5G4Z A;  1YSQ A;  5CX7 A;  1P9W A;  2VV6 A;  1S1Y A;  4G3K A;  1IOU A;  2VV8 A;  1KOU A;  3ZQ5 A;  2WKQ A;  2V0U A;  2BAS A;  3KSG A;  3NOT C;  1ZHH B;  3CLO A;  3IS2 B;  3NHQ A;  3MMH A;  4HP4 A;  4HP9 A;  1DP9 A;  1MZU A;  4GLQ A;  1W63 Q;  2G7U A;  3MQQ A;  5AVF A;  4IHQ A;  4CQH A;  3EOI A;  3E4P A;  4HH2 A;  1ODV A;  4NKP A;  3NOU C;  2W1T B;  2VKS A;  2ZOI A;  3T4L A;  3LI8 A;  2V0W A;  3ULF A;  3MJQ A;  4NEE D;  1GSW A;  4B93 A;  2KLI A;  3UB9 A;  1OTE A;  1UGU A;  5IS1 A;  2VX8 A;  2GZA A;  1W63 M;  2V1A A;  3LR5 A;  2PHY A;  1TS7 A;  2ZOH A;  4R38 A;  1NLZ A;  4BBV A;  4EET B;  4WEJ A;  2Y8H A;  3LR0 A;  1DP8 A;  2OWJ A;  5IU1 A;  4MMN A;  5KSH A;  4NXB A;  3GEC A;  3OOV A;  5AJG A;  4QPR A;  3FG8 A;  1D7E A;  3T4O A;  2H28 A;  1P97 A;  5HL6 A;  1OJ5 A;  3EGX C;  4GHI A;  3PHY A;  4UQI M;  3E0Y A;  3EWK A;  2VLG A;  1OTI A;  4ETZ A;  4HJ3 A;  3MFX A;  3UE6 A;  3V67 A;  4Y2F A;  1OPX A;  2V1B A;  2L1M A;  3LIB A;  3D3O A;  2Z6D A;  3BW6 A;  4Q0J A;  1YAX A;  2W3H A;  4L0L A;  4HNB A;  5DF9 A;  4OOM A;  4JGO A;  3LR3 A;  4B9O A;  2VGL M;  2HV1 A;  2GNX A;  2QJ7 A;  4HI4 A;  1OT6 A;  3EEH A;  4ETX A;  3DBA A;  4Q0I A;  3VE3 A;  4BBU A;  2PDR A;  1N9N A;  4EEP A;  5DFY A;  2W3D A;  4BWI A;  3C8C A;  5HDS A;  1LSW A;  4KQO A;  1F5M A;  2QHK A;  3KO6 A;  3BJN A;  4AFI A;  1NRJ A;  3K3D A;  4MDZ A;  3VE4 A;  4EES A;  5HZH A;  2JKT M;  4YWZ A;  3T4Q A;  1F9I A;  2M7U A;  5A8B A;  1TS0 A;  3KSH A;  3RH8 B;  3T4J A;  4H6J B;  3R7W B;  1S4S A;  3CAX A;  3LIC A;  3S7O A;  3VOL A;  3O5Y A;  3LUQ A;  2Y79 A;  1BYW A;  3IBJ A;  5DKK A;  4WUJ A;  1XJ3 A;  3OBF A;  3T4S A;  1WA9 A;  5HD3 A;  2B18 A;  4HH3 A;  4JGP A;  2ZMF A;  1XJ4 A;  1GSX A;  4XT2 B;  4KQD A;  4CLC B;  1XJ2 A;  1TF1 A;  2JHE A;  2IA2 A;  3EQU A;  4WLA A;  4HY8 A;  3P7N A;  3BY8 A;  2K31 A;  4WEL A;  2NUT C;  1OJG A;  3BQA A;  3T4T A;  2HGV A;  4L9E A;  3RTY A;  4L9G A;  4JGR A;  4PAU A;  4EEU A;  2OWH A;  2D01 A;  4FOF A;  3PBQ A;  3U2A A;  2QYB A;  5HDD A;  3S7Q A;  4EER A;  3PBR A;  2R78 A;  5J7E A;  4KUK A;  4LRX C;  5F5Y A;  4BMW A;  3H7W B;  3HJI A;  5L8M A;  3RFB A;  2VA0 A;  5I5L A;  3CI6 A;  1XJ6 A;  1OT9 A;  1G6O A;  3PBS A;  4IJG A;  3EEA A;  1MKM A;  3LYX A;  2W3G A;  3E98 A;  4GCZ A;  3C2W A;  2W1R A;  3LID A;  2O0Y A;  3IS2 A;  1DP6 A;  3F1O A;  3UME A;  4CLC E;  1GSV A;  2L4R A;  3C30 A;  4P6Z S;  2PYP A;  5HD5 A;  5HPI A;  2JKR I;  2O9C A;  1OTD A;  4Z1W A;  2XRO A;  2EA9 A;  4F3L A;  2EWW A;  3BQ8 A;  3CUE C;  2JKT I;  2W0N A;  2INW A;  2YKF A;  3UB6 A;  4ARZ B;  4I3A A;  3LIA A;  3HCY A;  4DMZ A;  3OCN A;  2OAP 1;  1V9Y A;  3D72 A;  2A2L A;  3A0R A;  4DJ2 A;  4HIA A;  3R4K A;  1VB6 A;  3UMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...