1IFQA

Sec22b n-terminal domain
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
b'SVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords vesicle trafficking protein Sec22b
publication title A novel snare N-terminal domain revealed by the crystal structure of Sec22b.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 36
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ifqA00
3EGDC 4AFIA 4B93A 1IFQA 2NUPC 2NUTC 1H8MA 3BW6A 2DMWA 2VX8A 3KYQA 1IOUA 3EGXC
chains in the Genus database with same CATH superfamily
2KLIA 1GSXA 2UWXA 3SOIA 3UNWA 5HWWA 2VZWA 3QP4A 5I94A 2QWSA 1SDNA 4YFMA 1YM1A 1SDEA 3BFDA 3IWIA 3TSGA 1YLTA 1FSYA 4PM6A 2B02A 3DTIA 1CI8A 2W3EA 3MZFA 2J80A 1BLHA 3IQAA 1YLJA 2WK0A 4HEFA 5EOEA 1MBLA 5GLBA 3DAVA 2JKRI 2HDSA 3TRCA 3DTKA 5FQ9A 5CGWA 4E3MA 2R9XA 1W63M 5JYPA 3WS2A 2ZLYA 3UPOA 4MLLA 4OPQA 3OPPA 4KZ5A 3SZTA 2CMNA 5F5YA 2VJWA 3CUEC 1A0KA 5FQMA 5EOOA 1Q2PA 3ZG8B 2FZ0A 1SKFA 2OLVA 4JGOA 3F1OB 3P01A 4ZAMA 4PM5A 3I7JA 4KG5A 1NYMA 5CHJA 1EROA 1BYWA 2Z2LB 2LB5A 4ZBEA 3KO6A 3A0SA 4CLCD 3PAEA 5HPIA 3A3JA 1LT0A 2P9VA 1ES2A 1LL5A 5HL1A 4OONA 2H5SA 1YKDA 4DJ2A 3S7OA 1SKOB 3ZVTA 2XK1A 3F1NA 2XR0A 3D3OA 5G4ZA 3NDEA 2IWDA 1MWTA 1C3BA 3NCKA 3QP6A 3LYXA 3MXQA 5CEBA 1IYQA 4IUKA 4EBLA 1G68A 3DTMA 3NY4A 1GSWA 5U47A 4B9OA 3HL9A 1TDGA 3K2NA 4R3BA 2DRWA 2JKTM 2BG1A 3BY8A 1KE4A 2J3TD 1KDSA 3SH9A 5DJUA 4PKYG 3C2WA 3GRJA 4DE0A 2XF3A 4N1HA 4X6TA 1LSWA 3W2ZA 3CITA 3G30A 3N8RA 4HBUA 2J7VA 5CERA 3D72A 3GDIA 4WELA 3O5YA 1OTBA 4X53A 3CLOA 3NOUC 3N8SA 1H8ZA 4Q8IA 4EU0A 4CQHA 4Y17A 5CEDA 1NY0A 4R38A 1QMEA 4JXVA 5AJGA 4N9LA 5CHUA 5EM0A 3ITBA 3C5AA 1AXBA 4BENA 3C38A 1I5QA 2L0WA 2OWJA 4CLCB 2EXAA 2ZC5B 4R6LA 3VP0A 1BTLA 1CQAA 3HLWA 2HF6A 3CJMA 2WKQA 4S2KA 2Y2JA 3OCLA 3MZEA 2HP9A 5A92A 1BLPA 2FFYA 1P97A 3F1OA 3IS2B 4OPZA 1LL9A 1QMFA 1CJFA 2ZD8A 3T1XA 3G35A 4UAAA 4D60A 1RGZA 1Z09A 5HZHA 4MNRA 2ZC3B 2XFTA 5E43A 3MKFA 2WAFA 1YQSA 1YPRA 4BBUA 3QHYA 2H0TA 4IBXA 2R78A 4EQ1A 2O99A 1JVJA 4R70A 2VKSA 1S0WA 3A3FA 1HD8A 5FL3A 4KQDA 3T1SA 2PU4A 1SKOA 4X1MA 3E4PA 5CHMA 4M4XA 5A8BA 1YLWA 3HLEA 2O9AA 2GZAA 3LCEA 4U3TA 2D01A 1W63Q 1YLPA 3OLOA 3QP2A 4UQIM 3MQOA 5J7EA 1XJ4A 2E8IA 5F1FA 1YAXA 3JVUA 4RA7A 4MBFA 2EX2A 3MBZA 1T1CA 3GVBA 2JE5A 3BRMA 1GHPA 4L0LA 4GZBA 4X69A 3A3IA 3IXBA 2XRNA 3G34A 3S4XA 3FZCA 5E2FA 3UB8A 2O9BA 4ID4A 2IWBA 2Y2LA 2JKRM 4WZ5A 1H8YA 1TVFA 1LSXA 5KMWA 4E3IA 4Q0HA 4ZJ2A 3W4OA 1WE4A 4PM7A 2HJEA 3Q7ZA 2Y2NA 2K31A 5IS1A 4PAUA 3BEBA 5DFXA 3ZGAB 2GDNA 1VEUB 2XSSA 1RP5A 3IH9A 4QU3A 4FSFA 2WZXA 4EBPA 5HFOA 2X71A 4JXWA 1KGEA 2VX8A 1XKZA 3QNBA 3ZG9B 4FCFA 1K54C 1JWVA 5DTKA 4CLCA 4BBVA 1O07A 2M7VA 2KX6A 1TF1A 5CTMA 5F1GA 5J3WA 1FCMA 4XT2B 1EWZA 3UE1A 2X02A 5EUAA 5FEFA 4IVIA 3IS2A 2M1CA 3C7VA 4R3JA 1NZUA 2EFUA 4OH0A 1HVBA 4LRYC 2NUPC 1U60A 4MN5A 1H5XA 3B33A 3HLFA 4E3JA 4GW9A 3EEHA 3LIBA 4EETB 4YOFA 3O88A 4B4XA 1GA0A 1KGGA 5FATA 2WAEA 2Q9NA 1W8QA 3ZVWA 4WMCD 1L0DA 3UE0A 3SW1A 2W1TB 3QP5A 4EWFA 1ESIA 5CX7A 1DY6A 3PBNA 4FUWA 4Y13A 2A3UA 1PI4A 4XUXA 4CLCC 2VLGA 5AVEA 1K4FA 4HH2A 4UA9A 3NDGA 4JKTA 4KZ8A 1L3LA 2V8FA 4HI4A 1W5DA 3S7PA 4NXEA 3UPNA 4HOIA 5IT5A 2INWA 2I9VA 1LI0A 3HLDA 3RTYA 3NHQA 1W7FA 4P6BA 2ZQDA 1GHMA 5F69A 5DKLA 4JF4A 4D2OA 2JN7A 3HVFA 4NKPA 4CLCE 3LEZA 3PHYA 4IEDA 4NG2A 3KSGA 1KVMA 4MMNA 4CPKA 3CPTB 1PFLA 2PYPA 5A93A 2HPBA 3VOZA 2ZQ9A 3P7NA 1YMXA 1DJCA 4GKUA 2B95A 4KZAA 3NULA 3NC8A 3MMHA 3UO9A 2RL3A 2XLNA 3GQZA 4Y0OA 1VHMA 4EERA 1Q2QA 2UV0E 3IWOA 5HWTA 1VEUA 1N9BA 3DBAA 5HX9A 1F9IA 1TS8A 1KE3A 3MFDA 2J3TC 2QYBA 2EXBA 2Y2GA 5I5LA 1ZTUA 2W3DA 3CUEA 4WYYA 1HTZA 3LIDA 5KZHA 4I3AA 1P9RA 2Y8HA 1I2SA 5EECA 1O7EA 1IFQA 1T1BA 1FCNA 2CC1A 3F1PB 3O86A 5CRFA 3W4QA 1K56D 1DJAA 1IYOA 4XT2A 5HAPA 1MKIA 3BQ8A 4DN0A 2W27A 4DE3A 4OVDA 3EOIA 5CTNA 2ZQCA 3LR4A 2BTFP 4GB7A 5MC7A 5FDHA 1V9ZA 3UN7A 4FH2A 3ZG7B 2HV1A 1IYSA 4K08A 3UMDA 4OQ0A 3JYIA 3OBFA 4L9GA 1Z6FA 3HUOA 4GNUA 4HNBA 2IA2A 4BD0A 2Y2HA 4WBGA 2DNSA 3KSIA 1J9MA 3LIAA 2EWWA 4OOMA 3CG5A 4EBNA 4GDBA 3PBRA 2W1TA 1ONHA 2Y2PA 4E6WA 1DRMA 4UQIS 5EVLA 1YLYA 4S2LA 4S2IA 1ZHHB 3RH8B 1ACFA 3FPWA 2VEAA 4H6JB 2WKRA 4BWIA 2XQZA 4GOGA 5FA7A 2B5RA 2WKIA 3LY3A 1MWRA 1K57A 4L9FA 1ES3A 2X01A 5FDSA 1OTIA 4HJ3A 2Y91A 1FOFA 3DWKA 3MFXA 4ME4A 3LICA 3UPPA 2OOLA 4B88A 1GSVA 2G7UA 1M6KA 1N9LA 1IEMA 2QPNA 3T4KA 3CPTA 4HJ4A 1MZUA 3EGXC 1V9YA 4G3WA 3GV9A 5DTSA 2WZZA 4P85A 1DJBA 4S2JA 2ZOHA 1TS6A 3LI8A 4Y3IA 5DF7A 2EX6A 1ZKJA 4UA6A 2ZJ9A 4HJ6A 1VM1A 1KGFA 4NXFA 3BQAA 5EPHA 3ZNTA 4DDSA 1G28A 3LI9A 2ZMVA 1CF0A 3G31A 4C3QA 1OTDA 3VV4A 4LRXC 3OPHA 3FYZA 2PHYA 1MWUA 3S22A 4EUZA 3HJIA 3DW0A 4S2MA 3M2KA 3UB5P 4E3LA 5M18A 3NOPC 1KDWA 1K57C 2HJ9C 4OQHA 3F1PA 1OTAA 5F6AA 3OCNA 2XFSA 3VFHA 2QKPA 2KOIA 4Y0TA 4QWOA 3W8KA 2Z6DA 4JPMA 4DDYA 3CI6A 3T4JA 1Y54A 5IHVA 4WMCA 1H3QA 5E2GA 5DJTA 3E98A 3IF5A 3NOTC 1MPLA 1IKIA 4GDNA 3A3EA 3L9KA 3Q07A 1S66L 4KG2A 3RFBA 4JXGA 3C4OA 4EEPA 4E3OA 2V1BA 5HDSA 1EI5A 1ODVA 2NUTC 3FKWA 4GD6A 5GLCA 3RJUA 3BYDA 3S1YA 4PMAA 2OSUA 4NEED 4F94A 4HBTA 4EQIA 4MEZA 5CGSA 2XD5A 3LR5A 3PBSA 5FQIA 3ICYA 4KZ9A 2ZQ8A 2HZ5A 4H6JA 1NWZA 2ZC6B 1WA9A 2OAQ1 2PBDP 3CHWP 1RGYA 1XGIA 4KQOA 5HAIA 2ZM0A 1MKMA 3N8LA 4DXCA 2HDUA 4N1XA 1GCEA 3HJKA 4QY6A 1PZOA 4GN2A 4Y0UA 3O87A 4QY5A 4EW7A 2ZC4B 5DF8A 3HUNA 2V9AA 3OPLA 3SH8A 3VE3A 3MQQA 1PRQA 4ZRRA 1WYCA 4JGQA 4WEJA 2V8CA 3E4OA 1DP6A 1TD5A 4N9KA 5AQ7A 5A91A 5LBRA 2ZBBA 1IYPA 1K56A 1NYYA 2FFFB 4O0PA 3FV7A 4DE2A 1MY8A 2ZM8A 2J9PA 2HP5A 3MJQA 4EV4A 4WZ4A 1K54A 4X1LA 2FH5A 3GR2A 1XJ6A 3NIAA 3ZFZA 1FIKA 3W4PA 1TEMA 3N6IA 4A5RA 1ES4A 3SS5A 4WL9A 2VGLS 3HREA 4P6ZS 3MR0A 4BBTA 5TGFA 2MJ6A 2A2LA 1FR6A 3H7WB 1J3WA 4MN6A 2HDQA 2WGWB 3BLMA 4JLFA 4Z9QA 4HH3A 4MBHA 3D4FA 1K55C 4F3LB 4OP8A 5HWVA 2EA9A 1L0EA 4DRTA 4GS9B 1G5UA 1BLCA 4ETXA 4WN5A 3Q1FA 4HP4A 3OC2A 4DF6A 5EM1A 2K7SA 4KZ7A 2PU2A 2LB9A 4QB8A 1MC0A 4GHIB 4FTXA 1UWNX 1PI5A 2O0YA 4I3JA 4E6XA 5G18A 4E3NA 1F2KA 3ZQ5A 5M1AA 1T19A 5FASA 3PBQA 5IU1A 2PRFA 2DMWA 3IBRA 3M6BA 1IOUA 1EW0A 3BJNA 3CMZA 4EESA 2P08A 3EQVA 1PWGA 1D1JA 5L2FA 1NRJA 3C4PA 3EWKA 3UDXA 4MDZA 1XFQA 4DXBA 4IVKA 1YT4A 1SZVA 5FI7A 3IF6B 1H8MA 3UDIA 4ZTKA 5HARA 4S2NA 3WRZA 3ZCZA 3VOYA 3G2ZA 3KYZA 3TOIA 4LCLA 1AWIA 1LLBA 4GLQA 3VSLA 5GLDA 1ZG6A 4I38A 5FAPA 3M2JA 4R4RA 3U2AA 3IBJA 3UB6A 4OOYA 3OPRA 3TE8A 5K5BA 3CAXA 3G6OA 5E2EA 3C8CA 2V1AA 2E8JA 2B18A 3PR6A 4KZ4A 4WM9A 3NI9A 4EEUA 1D06A 4KZ6A 3OZHA 4PPRA 2VV6A 5AQAA 5GHYA 4WLAA 3S7NA 3E2KA 3A0VA 2Y55A 4FD8A 1DP8A 3A0RA 2KDKA 4LGWA 4UHUA 4OQGA 3HLGA 4WEKA 1XGJA 3CWFA 3UB7A 2V0UA 1CI9A 3T4TA 3PBTA 1XX2A 4S2NC 3Q7VB 2Z2MB 3HLBA 3NJAA 2Q9MA 4LENA 1G6AA 3WS1A 4WF0A 4KZ3A 1X0OA 3BFGA 3UDFA 4LV3A 4BLMA 2JBFA 5DFYA 3JPUA 2P74A 2H10A 5DKKA 2XROA 2WGWA 4Y15A 3RXWA 3LUQA 1JTDA 4I39A 4IUHA 2W3GA 1BULA 4EUVA 5G4YA 5CGXA 3AGEA 1YLZA 2OV5A 4GS9A 3G2YA 1ESUA 2EFXA 1OTEA 1HZOA 5FQQA 4EXOA 2R9WA 4NETA 1YMSA 5CXWA 3SS3A 2ZL1B 3KYQA 1PZPA 1XFNA 5AVFA 4GHIA 4R23A 4X68A 3B3XA 4Z1WA 3R4KA 4LV2A 3LEQA 4OLDA 5L09A 1ONGA 1MWSA 3LIFA 4XUZA 5HSQA 2K2NA 5EFWA 3OOVA 1N4OA 4UEYA 2IWCA 3WS5A 3IF6A 2XEPA 3U4LP 1GHIA 4GJ4A 2VGLM 2V2FF 4P6ZM 1DP9A 1D7EA 3KYEA 1OJGA 3G32A 2W1RA 1PW8A 5FAQA 4KUOA 4G3VA 3D9YA 1M40A 1YSPA 4GCZA 2Y2OA 4FH4A 4JXSA 3H82B 4O8GA 3VP1A 4G3KA 4JF5A 4PHTA 2M7UA 4R1GA 1K4EA 5FI2A 3FG8A 5HD3A 4LPZA 1F5MA 2JCHA 3M6HA 3V3RA 3IX8A 1L2SA 5EVEA 3IT9A 2VV8A 1BLSA 2ZOIA 4MN7A 4DMZA 4QPRA 1S1ZA 2VA0A 1XXMA 5AQBA 2WGIA 1BT5A 1G6OA 2HDRA 5DTTA 5FSRA 2G2WA 3V39A 3PBOA 3QNCA 3IF6C 4II7A 1UWPX 4R3AA 3T4OA 2YKFA 3Q7VA 2Y2KA 4R0QA 3E0YA 4RX2A 2J8YA 1TS0A 4JF6A 1HLUP 4I5SA 3QP1A 1BUEA 2QHKA 3P98A 3C30A 3IHBA 4Q0IA 4S2PA 2W3FA 4JBFA 1CEFA 1TS7A 1E3UD 2A49A 3MZDA 4ESPA 4LLOB 5M19A 3IHAA 5EVID 3UE6A 4ARZB 2HGVA 3IH8A 1ERQA 3DTEA 4MCWA 2EWVA 2W0NA 3T12B 2QJ5A 3TJZC 4KUKA 2ZL1A 1S6RA 2GJ3A 1L0GA 3TW8A 3KSHA 1E4DA 5L10A 1K6SA 3Q81A 3MF0A 2D02A 1K6RA 3K3DA 3V5MA 4YINA 1S4RA 4Y7PA 3VSKA 3Q82A 3MXRA 3VOLA 3N4IA 2A24B 4H8RA 3ZNYA 2XH9A 3B42A 1K25A 2JC7A 5KSCA 2XD1A 3FKVA 2VGKA 3GSGA 4IBRA 5FEGA 1ERMA 4K0XA 4RX3A 1OT9A 4LRZE 1JNUA 1T1AA 1XJ2A 2C5WB 1PYYA 3K3CA 5J4EA 4JGPA 1VETB 1NZOA 3ZG0A 3LIEA 3ZYTA 3UE3A 2VV7A 2PYRA 4HP9A 5TBMB 3BFFA 3G4PA 1XA1A 4O7DA 3H82A 4ZDXA 3MS6A 4NXGA 1NJ4A 3GTCA 2PBYA 2ZC7A 3FPVA 3BECA 1T18A 4LCMA 3LR0A 4O01A 1ZG4A 2ACGA 3N7WA 3QP8A 4PM8A 3TG9A 1UGUA 3MXSA 4N92A 1BZAA 1VQQA 4HY8A 3SS4A 5KIZA 3H9WA 2VGJA 5F83A 1W79A 3IXHA 3AGFA 4M3KA 1ES5A 2O9CA 4OPRA 3R7WB 3GMWA 3CZDA 5F82A 5GL9A 2BASA 5EVIB 4KQRA 3UB9A 2PD7A 4OLGA 2WKHA 2BLSA 1OPXA 5A90A 1CK3A 1S4SA 1K55A 3S7QA 1STZA 2V20A 2VK3A 5TJJA 4E3KA 1IELA 5KSHA 4BQMA 3VP2A 5HPFA 4C75A 4ARZA 3ULFA 2P04A 2WUQA 4BJPA 3ISGA 2Q0OA 1PWCA 4OPYA 3GECA 2OAP1 2W3HA 3ITAA 4HHDA 1PWDA 1Y4OA 1FSWA 2PR5A 1CEGA 5FAOA 3KX0X 1RCJA 5FI6A 3LFVA 3A3DA 1E25A 4QJGA 4ZJ1A 3IXDA 3IXGA 4P87A 5HL6A 4U0TA 2Y2MA 3IX4A 3ZDJA 2P7JA 2DCFA 4X25A 5JYOA 3L7HA 3BFCA 1H0MA 1MXOA 2A24A 4B4ZA 1VB6A 3T50A 3EEAA 5L8MA 3WS4A 2I72A 3T4SA 3P09A 4GD8A 1ALQA 4PM9A 3AGDA 3SH7A 2G2UA 4DE1A 2XA7S 2JKFA 4X56A 4DJ3A 1SHVA 5DVAA 3HCYA 5J8XA 1VETA 2ZM2A 2WKEA 3E2LA 2J9OA 2JKGA 3DWZA 1JWZA 1ZC2A 4ETZA 2H28A 1NRFA 1K38A 4RVAA 5TBMA 3BW6A 3UY6A 2Y2QA 1FCOA 2QJ7A 4U0XA 3O3VA 4BMWA 3VP4A 4HIAA 1KVLA 3PAGA 5DF9A 3VE4A 1XPBA 4HQAA 4C6YA 3T4LA 1S67L 4QHCA 3T4QA 2HP6A 4JGRA 1I2WA 4BL3A 1LI9A 5C5KA 2WGVA 2EX9A 5CECA 2PDRA 5TR7A 2WYXA 3RXXA 2GX5A 4OKPA 4XXRA 4YNRA 5GHZA 1E3UA 3WWXA 3C7UA 4KG6A 4I3IA 3R7WA 2RCXA 4FOFA 2L1MA 1XJ3A 1FQGA 3MSHA 5E2HA 5EVIA 4Q0JA 4LV0A 1Y28A 3LO7A 5HD5A 3HLCA 2PD8A 2Y4AA 3LGOA 4E04A 3WRTA 3NBLA 3BM6A 4WUJA 5GLAA 2AVXA 4KENB 4R4SA 1BSGA 1IKGA 2ZQAA 4KZBA 4OP5A 3VP3A 1K0KA 3V50A 5EV0A 1N9NA 4WZ5C 2V1ZA 2JKTI 5F68A 4K0WA 3VFFA 3LR3A 3HUMA 4AFIA 2Y79A 4ZJ3A 2L4RA 4S2OA 1L0FA 3E4QA 2YKHA 1FR1A 3PTEA 3FC7A 5HDCA 4DKIA 1NXYA 5L07A 1JWPA 2PT7A 1NLZA 3T1RA 1FILA 3BWLA 3MQ0A 2C6WB 1SCWA 3PYPA 4L9EA 2V0WA 4HESA 5EE8A 2Z6CA 3VMAA 1JTGA 5EVIC 4OOLA 1NLYA 4UA7A 3KSFA 1OT6A 4LFUA 3WS0A 4OQIA 5HW3A 2EX8A 2PAVP 1P9WA 1LHYA 1WYBA 2QMIA 3H7WA 4K91A 4BL2A 2ZQ7A 4QD4A 5D3OA 4Y5FA 4F3LA 1S1YA 1KE0A 3BFEA 4KQQA 5BOHA 4PKYA 1W8YA 3JVVA 2QZ6A 4B93A 2GNXA 4RQ9A 2P9VB 2H0YA 1PW1A 1PIOA 2XDMA 3EGDC 2ZMFA 3IWQA 1LSVA 1GA9A 3HBRA 2OWHA 3NECA 3LY4A 1XA7A 3ZHHA 3MKEA 1F98A 1N9OA 1P0ZA 4RYEA 2Y2IA 3F1NB 4LV1A 4Y2FA 5GHXA 5FQKA 5HDDA 4CJNA 1TDLA 5AQ9A 3V67A 4IJGA 2WADA 1LL8A 3EQUA 3BY9A 4NXBA 2PR6A 2J3WA 3B47A 1YSQA 4X55A 4P0MA 4NK3A 2WKPA 2OLUA 4BD1A 1PNEA 1KOUA 5HAQA 2XGNA 5TFQA 1OJ5A 4IHQA 4MBKA 3BLSA 3T1QB 1XP4A 3ZG5A 3PXPA 2XA7M 5FQJA 2Y59A 3IX3A 4YWZA 2JHEA 1OMEA 3V3SA 3UMEA 3FWLA 2ZMAA
chains in the Genus database with same CATH topology
2KLIA 1GSXA 5HWWA 2VZWA 4O0PA 2QWSA 3MJQA 1OT9A 4LRZE 1JNUA 1T1AA 1XJ2A 3K3CA 5J4EA 2B02A 4JGPA 3SW1A 2FH5A 2W3EA 2W1TB 1XJ6A 2J80A 5CX7A 3LIEA 3ZYTA 4WL9A 3UE3A 2VV7A 2PYRA 2VGLS 4HP9A 3PBNA 4P6ZS 5TBMB 3MR0A 2JKRI 3TRCA 4BBTA 2MJ6A 2A2LA 4CLCC 3H7WB 3H82A 2VLGA 4MN6A 1W63M 5AVEA 4HH2A 4NXGA 4HH3A 4HI4A 3S7PA 4NXEA 3FPVA 4F3LB 5HWVA 4HOIA 1T18A 2INWA 5IT5A 3LR0A 4O01A 2EA9A 2I9VA 4GS9B 2CMNA 3RTYA 5F5YA 2VJWA 1UGUA 3CUEC 3NHQA 4ETXA 5F69A 5DKLA 4WN5A 4HY8A 2JN7A 4HP4A 3OC2A 4NKPA 4CLCE 5KIZA 2FZ0A 3H9WA 3PHYA 2K7SA 2LB9A 1MC0A 4GHIB 4JGOA 3F1OB 1UWNX 3P01A 3KSGA 2O9CA 4MMNA 2O0YA 2PYPA 1BYWA 4I3JA 3R7WB 3ZQ5A 1T19A 3PBQA 2BASA 3P7NA 5IU1A 2DMWA 2LB5A 3UB9A 3IBRA 1IOUA 1EW0A 3BJNA 3KO6A 3A0SA 4EESA 2PD7A 2P08A 4CLCD 3MMHA 5HPIA 3EQVA 1NRJA 1VHMA 1LT0A 3EWKA 4EERA 1OPXA 4MDZA 1XFQA 5HWTA 3DBAA 1H8MA 1F9IA 1S4SA 1TS8A 3S7QA 1STZA 3KYZA 1YKDA 2J3TC 2QYBA 5TJJA 4DJ2A 5I5LA 3S7OA 5KSHA 1ZTUA 2W3DA 3CUEA 4GLQA 3F1NA 5HPFA 3LIDA 4ARZA 4I3AA 4I38A 3ULFA 1P9RA 2Y8HA 3D3OA 2P04A 3U2AA 3IBJA 3UB6A 5G4ZA 4BJPA 1IFQA 1T1BA 3F1PB 3GECA 2OAP1 2W3HA 4HHDA 3TE8A 3CAXA 3G6OA 5K5BA 3C8CA 2V1AA 2B18A 2PR5A 4XT2A 3PR6A 3KX0X 3BQ8A 3LFVA 3LYXA 3MXQA 4IUKA 4DN0A 2W27A 4EEUA 1D06A 1GSWA 5HL6A 4B9OA 3EOIA 3LR4A 2VV6A 2P7JA 4WLAA 3S7NA 5MC7A 3K2NA 3A0VA 1V9ZA 2JKTM 2A24A 3BY8A 1VB6A 1DP8A 3T50A 3A0RA 2KDKA 3EEAA 5L8MA 2J3TD 2HV1A 3T4SA 4K08A 3UMDA 5DJUA 4PKYG 3OBFA 4L9GA 3C2WA 4WEKA 3CWFA 3UB7A 2XA7S 2V0UA 1LSWA 4HNBA 2IA2A 3T4TA 3W2ZA 4DJ3A 3PBTA 3CITA 3KSIA 3LIAA 3NJAA 2EWWA 3HCYA 4OOMA 3PBRA 2W1TA 1DRMA 4UQIS 4ETZA 2H28A 3D72A 3GDIA 4WELA 3O5YA 1OTBA 4WF0A 1X0OA 1ZHHB 3CLOA 3NOUC 3RH8B 5TBMA 3BW6A 2QJ7A 3FPWA 2VEAA 4EU0A 4CQHA 5DFYA 4R38A 5DKKA 4BMWA 4H6JB 2WKRA 4HIAA 2XROA 5DF9A 4BWIA 3LUQA 3VE4A 5AJGA 4HQAA 4I39A 2W3GA 4IUHA 4EUVA 5G4YA 3T4LA 1S67L 3C38A 2L0WA 3T4QA 4JGRA 4L9FA 2OWJA 4GS9A 4CLCB 4R6LA 1OTEA 1OTIA 5C5KA 4HJ3A 4EXOA 2HF6A 2PDRA 2WKQA 3MFXA 4ME4A 3LICA 2OOLA 3OCLA 3KYQA 2GX5A 1XFNA 5AVFA 4GHIA 1GSVA 2G7UA 4YNRA 3F1OA 1P97A 1N9LA 3IS2B 3T4KA 4Z1WA 3R4KA 4I3IA 3R7WA 4HJ4A 1MZUA 3EGXC 1V9YA 4FOFA 2L1MA 4G3WA 1XJ3A 5HZHA 4Q0JA 3LIFA 1Y28A 5HD5A 2ZOHA 5HSQA 2K2NA 5EFWA 1TS6A 3LI8A 2PD8A 4Y3IA 4E04A 3OOVA 4UEYA 4HJ6A 4WUJA 4BBUA 4NXFA 3BQAA 1G28A 2R78A 4EQ1A 2O99A 3LI9A 4GJ4A 4R70A 2VGLM 2VKSA 4P6ZM 2ZMVA 5FL3A 1DP9A 4KQDA 1D7EA 1OJGA 1OTDA 1N9NA 3VV4A 2JKTI 4LRXC 3E4PA 5F68A 4M4XA 5A8BA 2PHYA 2W1RA 3HJIA 2O9AA 3LR3A 4AFIA 2GZAA 2Y79A 2D01A 4KUOA 4G3VA 1YSPA 2L4RA 3NOPC 4GCZA 1W63Q 3OLOA 3E4QA 2HJ9C 2YKHA 4UQIM 3F1PA 3H82B 3MQOA 4O8GA 5J7EA 1OTAA 4G3KA 5F6AA 4PHTA 3OCNA 2M7UA 1XJ4A 2QKPA 2KOIA 3FC7A 5HDCA 1YAXA 2Z6DA 3FG8A 3JVUA 5HD3A 4LPZA 2PT7A 1NLZA 3CI6A 3T4JA 1T1CA 1H3QA 1F5MA 3BWLA 3E98A 5DJTA 3NOTC 3MQ0A 3PYPA 4L9EA 4L0LA 2V0WA 2VV8A 2ZOIA 2Z6CA 4MN7A 4DMZA 4QPRA 1S1ZA 2VA0A 1S66L 2XRNA 4OOLA 1NLYA 3KSFA 1OT6A 3UB8A 2O9BA 3RFBA 1G6OA 1P9WA 4EEPA 2JKRM 2V1BA 3H7WA 5HDSA 1ODVA 3PBOA 1LSXA 2NUTC 4II7A 1UWPX 4Q0HA 4R3AA 3T4OA 4Y5FA 2YKFA 2HJEA 4F3LA 2K31A 3E0YA 1S1YA 1TS0A 5IS1A 4PAUA 4PKYA 4I5SA 3JVVA 4B93A 2GNXA 5DFXA 2QHKA 4NEED 4RQ9A 3C30A 3EGDC 2ZMFA 3LR5A 3PBSA 2XSSA 3ICYA 4Q0IA 2W3FA 1LSVA 4FSFA 4H6JA 1NWZA 1TS7A 2OWHA 1WA9A 2OAQ1 1F98A 1N9OA 4KQOA 2VX8A 4LLOB 1MKMA 1P0ZA 4Y2FA 3F1NB 5HDDA 3UE6A 4ARZB 2HGVA 4CLCA 3HJKA 3V67A 4MCWA 4BBVA 4IJGA 2M7VA 2KX6A 2EWVA 2W0NA 1TF1A 2QJ5A 5J3WA 1LL8A 4KUKA 3TJZC 4EW7A 2GJ3A 3EQUA 3BY9A 4NXBA 4XT2B 2V9AA 2PR6A 2J3WA 3B47A 3TW8A 3MQQA 3VE3A 3KSHA 1YSQA 4ZRRA 3IS2A 2M1CA 2WKPA 1KOUA 4JGQA 4WEJA 3MF0A 3E4OA 2D02A 1OJ5A 4IHQA 3K3DA 4LRYC 1S4RA 1DP6A 1TD5A 2NUPC 3VOLA 3PXPA 2XA7M 4MN5A 5LBRA 3B33A 2A24B 4YWZA 2JHEA 4GW9A 3EEHA 3B42A 3LIBA 2ZBBA 3UMEA 4EETB 4YOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGD C;  4AFI A;  4B93 A;  1IFQ A;  2NUP C;  2NUT C;  1H8M A;  3BW6 A;  2DMW A;  2VX8 A;  3KYQ A;  1IOU A;  3EGX C; 
#chains in the Genus database with same CATH topology
 2KLI A;  1GSX A;  2UWX A;  3SOI A;  3UNW A;  5HWW A;  2VZW A;  3QP4 A;  5I94 A;  2QWS A;  1SDN A;  4YFM A;  1YM1 A;  1SDE A;  3BFD A;  3IWI A;  3TSG A;  1YLT A;  1FSY A;  4PM6 A;  2B02 A;  3DTI A;  1CI8 A;  2W3E A;  3MZF A;  2J80 A;  1BLH A;  3IQA A;  1YLJ A;  2WK0 A;  4HEF A;  5EOE A;  1MBL A;  5GLB A;  3DAV A;  2JKR I;  2HDS A;  3TRC A;  3DTK A;  5FQ9 A;  5CGW A;  4E3M A;  2R9X A;  1W63 M;  5JYP A;  3WS2 A;  2ZLY A;  3UPO A;  4MLL A;  4OPQ A;  3OPP A;  4KZ5 A;  3SZT A;  2CMN A;  5F5Y A;  2VJW A;  3CUE C;  1A0K A;  5FQM A;  5EOO A;  1Q2P A;  3ZG8 B;  2FZ0 A;  1SKF A;  2OLV A;  4JGO A;  3F1O B;  3P01 A;  4ZAM A;  4PM5 A;  3I7J A;  4KG5 A;  1NYM A;  5CHJ A;  1ERO A;  1BYW A;  2Z2L B;  2LB5 A;  4ZBE A;  3KO6 A;  3A0S A;  4CLC D;  3PAE A;  5HPI A;  3A3J A;  1LT0 A;  2P9V A;  1ES2 A;  1LL5 A;  5HL1 A;  4OON A;  2H5S A;  1YKD A;  4DJ2 A;  3S7O A;  1SKO B;  3ZVT A;  2XK1 A;  3F1N A;  2XR0 A;  3D3O A;  5G4Z A;  3NDE A;  2IWD A;  1MWT A;  1C3B A;  3NCK A;  3QP6 A;  3LYX A;  3MXQ A;  5CEB A;  1IYQ A;  4IUK A;  4EBL A;  1G68 A;  3DTM A;  3NY4 A;  1GSW A;  5U47 A;  4B9O A;  3HL9 A;  1TDG A;  3K2N A;  4R3B A;  2DRW A;  2JKT M;  2BG1 A;  3BY8 A;  1KE4 A;  2J3T D;  1KDS A;  3SH9 A;  5DJU A;  4PKY G;  3C2W A;  3GRJ A;  4DE0 A;  2XF3 A;  4N1H A;  4X6T A;  1LSW A;  3W2Z A;  3CIT A;  3G30 A;  3N8R A;  4HBU A;  2J7V A;  5CER A;  3D72 A;  3GDI A;  4WEL A;  3O5Y A;  1OTB A;  4X53 A;  3CLO A;  3NOU C;  3N8S A;  1H8Z A;  4Q8I A;  4EU0 A;  4CQH A;  4Y17 A;  5CED A;  1NY0 A;  4R38 A;  1QME A;  4JXV A;  5AJG A;  4N9L A;  5CHU A;  5EM0 A;  3ITB A;  3C5A A;  1AXB A;  4BEN A;  3C38 A;  1I5Q A;  2L0W A;  2OWJ A;  4CLC B;  2EXA A;  2ZC5 B;  4R6L A;  3VP0 A;  1BTL A;  1CQA A;  3HLW A;  2HF6 A;  3CJM A;  2WKQ A;  4S2K A;  2Y2J A;  3OCL A;  3MZE A;  2HP9 A;  5A92 A;  1BLP A;  2FFY A;  1P97 A;  3F1O A;  3IS2 B;  4OPZ A;  1LL9 A;  1QMF A;  1CJF A;  2ZD8 A;  3T1X A;  3G35 A;  4UAA A;  4D60 A;  1RGZ A;  1Z09 A;  5HZH A;  4MNR A;  2ZC3 B;  2XFT A;  5E43 A;  3MKF A;  2WAF A;  1YQS A;  1YPR A;  4BBU A;  3QHY A;  2H0T A;  4IBX A;  2R78 A;  4EQ1 A;  2O99 A;  1JVJ A;  4R70 A;  2VKS A;  1S0W A;  3A3F A;  1HD8 A;  5FL3 A;  4KQD A;  3T1S A;  2PU4 A;  1SKO A;  4X1M A;  3E4P A;  5CHM A;  4M4X A;  5A8B A;  1YLW A;  3HLE A;  2O9A A;  2GZA A;  3LCE A;  4U3T A;  2D01 A;  1W63 Q;  1YLP A;  3OLO A;  3QP2 A;  4UQI M;  3MQO A;  5J7E A;  1XJ4 A;  2E8I A;  5F1F A;  1YAX A;  3JVU A;  4RA7 A;  4MBF A;  2EX2 A;  3MBZ A;  1T1C A;  3GVB A;  2JE5 A;  3BRM A;  1GHP A;  4L0L A;  4GZB A;  4X69 A;  3A3I A;  3IXB A;  2XRN A;  3G34 A;  3S4X A;  3FZC A;  5E2F A;  3UB8 A;  2O9B A;  4ID4 A;  2IWB A;  2Y2L A;  2JKR M;  4WZ5 A;  1H8Y A;  1TVF A;  1LSX A;  5KMW A;  4E3I A;  4Q0H A;  4ZJ2 A;  3W4O A;  1WE4 A;  4PM7 A;  2HJE A;  3Q7Z A;  2Y2N A;  2K31 A;  5IS1 A;  4PAU A;  3BEB A;  5DFX A;  3ZGA B;  2GDN A;  1VEU B;  2XSS A;  1RP5 A;  3IH9 A;  4QU3 A;  4FSF A;  2WZX A;  4EBP A;  5HFO A;  2X71 A;  4JXW A;  1KGE A;  2VX8 A;  1XKZ A;  3QNB A;  3ZG9 B;  4FCF A;  1K54 C;  1JWV A;  5DTK A;  4CLC A;  4BBV A;  1O07 A;  2M7V A;  2KX6 A;  1TF1 A;  5CTM A;  5F1G A;  5J3W A;  1FCM A;  4XT2 B;  1EWZ A;  3UE1 A;  2X02 A;  5EUA A;  5FEF A;  4IVI A;  3IS2 A;  2M1C A;  3C7V A;  4R3J A;  1NZU A;  2EFU A;  4OH0 A;  1HVB A;  4LRY C;  2NUP C;  1U60 A;  4MN5 A;  1H5X A;  3B33 A;  3HLF A;  4E3J A;  4GW9 A;  3EEH A;  3LIB A;  4EET B;  4YOF A;  3O88 A;  4B4X A;  1GA0 A;  1KGG A;  5FAT A;  2WAE A;  2Q9N A;  1W8Q A;  3ZVW A;  4WMC D;  1L0D A;  3UE0 A;  3SW1 A;  2W1T B;  3QP5 A;  4EWF A;  1ESI A;  5CX7 A;  1DY6 A;  3PBN A;  4FUW A;  4Y13 A;  2A3U A;  1PI4 A;  4XUX A;  4CLC C;  2VLG A;  5AVE A;  1K4F A;  4HH2 A;  4UA9 A;  3NDG A;  4JKT A;  4KZ8 A;  1L3L A;  2V8F A;  4HI4 A;  1W5D A;  3S7P A;  4NXE A;  3UPN A;  4HOI A;  5IT5 A;  2INW A;  2I9V A;  1LI0 A;  3HLD A;  3RTY A;  3NHQ A;  1W7F A;  4P6B A;  2ZQD A;  1GHM A;  5F69 A;  5DKL A;  4JF4 A;  4D2O A;  2JN7 A;  3HVF A;  4NKP A;  4CLC E;  3LEZ A;  3PHY A;  4IED A;  4NG2 A;  3KSG A;  1KVM A;  4MMN A;  4CPK A;  3CPT B;  1PFL A;  2PYP A;  5A93 A;  2HPB A;  3VOZ A;  2ZQ9 A;  3P7N A;  1YMX A;  1DJC A;  4GKU A;  2B95 A;  4KZA A;  3NUL A;  3NC8 A;  3MMH A;  3UO9 A;  2RL3 A;  2XLN A;  3GQZ A;  4Y0O A;  1VHM A;  4EER A;  1Q2Q A;  2UV0 E;  3IWO A;  5HWT A;  1VEU A;  1N9B A;  3DBA A;  5HX9 A;  1F9I A;  1TS8 A;  1KE3 A;  3MFD A;  2J3T C;  2QYB A;  2EXB A;  2Y2G A;  5I5L A;  1ZTU A;  2W3D A;  3CUE A;  4WYY A;  1HTZ A;  3LID A;  5KZH A;  4I3A A;  1P9R A;  2Y8H A;  1I2S A;  5EEC A;  1O7E A;  1IFQ A;  1T1B A;  1FCN A;  2CC1 A;  3F1P B;  3O86 A;  5CRF A;  3W4Q A;  1K56 D;  1DJA A;  1IYO A;  4XT2 A;  5HAP A;  1MKI A;  3BQ8 A;  4DN0 A;  2W27 A;  4DE3 A;  4OVD A;  3EOI A;  5CTN A;  2ZQC A;  3LR4 A;  2BTF P;  4GB7 A;  5MC7 A;  5FDH A;  1V9Z A;  3UN7 A;  4FH2 A;  3ZG7 B;  2HV1 A;  1IYS A;  4K08 A;  3UMD A;  4OQ0 A;  3JYI A;  3OBF A;  4L9G A;  1Z6F A;  3HUO A;  4GNU A;  4HNB A;  2IA2 A;  4BD0 A;  2Y2H A;  4WBG A;  2DNS A;  3KSI A;  1J9M A;  3LIA A;  2EWW A;  4OOM A;  3CG5 A;  4EBN A;  4GDB A;  3PBR A;  2W1T A;  1ONH A;  2Y2P A;  4E6W A;  1DRM A;  4UQI S;  5EVL A;  1YLY A;  4S2L A;  4S2I A;  1ZHH B;  3RH8 B;  1ACF A;  3FPW A;  2VEA A;  4H6J B;  2WKR A;  4BWI A;  2XQZ A;  4GOG A;  5FA7 A;  2B5R A;  2WKI A;  3LY3 A;  1MWR A;  1K57 A;  4L9F A;  1ES3 A;  2X01 A;  5FDS A;  1OTI A;  4HJ3 A;  2Y91 A;  1FOF A;  3DWK A;  3MFX A;  4ME4 A;  3LIC A;  3UPP A;  2OOL A;  4B88 A;  1GSV A;  2G7U A;  1M6K A;  1N9L A;  1IEM A;  2QPN A;  3T4K A;  3CPT A;  4HJ4 A;  1MZU A;  3EGX C;  1V9Y A;  4G3W A;  3GV9 A;  5DTS A;  2WZZ A;  4P85 A;  1DJB A;  4S2J A;  2ZOH A;  1TS6 A;  3LI8 A;  4Y3I A;  5DF7 A;  2EX6 A;  1ZKJ A;  4UA6 A;  2ZJ9 A;  4HJ6 A;  1VM1 A;  1KGF A;  4NXF A;  3BQA A;  5EPH A;  3ZNT A;  4DDS A;  1G28 A;  3LI9 A;  2ZMV A;  1CF0 A;  3G31 A;  4C3Q A;  1OTD A;  3VV4 A;  4LRX C;  3OPH A;  3FYZ A;  2PHY A;  1MWU A;  3S22 A;  4EUZ A;  3HJI A;  3DW0 A;  4S2M A;  3M2K A;  3UB5 P;  4E3L A;  5M18 A;  3NOP C;  1KDW A;  1K57 C;  2HJ9 C;  4OQH A;  3F1P A;  1OTA A;  5F6A A;  3OCN A;  2XFS A;  3VFH A;  2QKP A;  2KOI A;  4Y0T A;  4QWO A;  3W8K A;  2Z6D A;  4JPM A;  4DDY A;  3CI6 A;  3T4J A;  1Y54 A;  5IHV A;  4WMC A;  1H3Q A;  5E2G A;  5DJT A;  3E98 A;  3IF5 A;  3NOT C;  1MPL A;  1IKI A;  4GDN A;  3A3E A;  3L9K A;  3Q07 A;  1S66 L;  4KG2 A;  3RFB A;  4JXG A;  3C4O A;  4EEP A;  4E3O A;  2V1B A;  5HDS A;  1EI5 A;  1ODV A;  2NUT C;  3FKW A;  4GD6 A;  5GLC A;  3RJU A;  3BYD A;  3S1Y A;  4PMA A;  2OSU A;  4NEE D;  4F94 A;  4HBT A;  4EQI A;  4MEZ A;  5CGS A;  2XD5 A;  3LR5 A;  3PBS A;  5FQI A;  3ICY A;  4KZ9 A;  2ZQ8 A;  2HZ5 A;  4H6J A;  1NWZ A;  2ZC6 B;  1WA9 A;  2OAQ 1;  2PBD P;  3CHW P;  1RGY A;  1XGI A;  4KQO A;  5HAI A;  2ZM0 A;  1MKM A;  3N8L A;  4DXC A;  2HDU A;  4N1X A;  1GCE A;  3HJK A;  4QY6 A;  1PZO A;  4GN2 A;  4Y0U A;  3O87 A;  4QY5 A;  4EW7 A;  2ZC4 B;  5DF8 A;  3HUN A;  2V9A A;  3OPL A;  3SH8 A;  3VE3 A;  3MQQ A;  1PRQ A;  4ZRR A;  1WYC A;  4JGQ A;  4WEJ A;  2V8C A;  3E4O A;  1DP6 A;  1TD5 A;  4N9K A;  5AQ7 A;  5A91 A;  5LBR A;  2ZBB A;  1IYP A;  1K56 A;  1NYY A;  2FFF B;  4O0P A;  3FV7 A;  4DE2 A;  1MY8 A;  2ZM8 A;  2J9P A;  2HP5 A;  3MJQ A;  4EV4 A;  4WZ4 A;  1K54 A;  4X1L A;  2FH5 A;  3GR2 A;  1XJ6 A;  3NIA A;  3ZFZ A;  1FIK A;  3W4P A;  1TEM A;  3N6I A;  4A5R A;  1ES4 A;  3SS5 A;  4WL9 A;  2VGL S;  3HRE A;  4P6Z S;  3MR0 A;  4BBT A;  5TGF A;  2MJ6 A;  2A2L A;  1FR6 A;  3H7W B;  1J3W A;  4MN6 A;  2HDQ A;  2WGW B;  3BLM A;  4JLF A;  4Z9Q A;  4HH3 A;  4MBH A;  3D4F A;  1K55 C;  4F3L B;  4OP8 A;  5HWV A;  2EA9 A;  1L0E A;  4DRT A;  4GS9 B;  1G5U A;  1BLC A;  4ETX A;  4WN5 A;  3Q1F A;  4HP4 A;  3OC2 A;  4DF6 A;  5EM1 A;  2K7S A;  4KZ7 A;  2PU2 A;  2LB9 A;  4QB8 A;  1MC0 A;  4GHI B;  4FTX A;  1UWN X;  1PI5 A;  2O0Y A;  4I3J A;  4E6X A;  5G18 A;  4E3N A;  1F2K A;  3ZQ5 A;  5M1A A;  1T19 A;  5FAS A;  3PBQ A;  5IU1 A;  2PRF A;  2DMW A;  3IBR A;  3M6B A;  1IOU A;  1EW0 A;  3BJN A;  3CMZ A;  4EES A;  2P08 A;  3EQV A;  1PWG A;  1D1J A;  5L2F A;  1NRJ A;  3C4P A;  3EWK A;  3UDX A;  4MDZ A;  1XFQ A;  4DXB A;  4IVK A;  1YT4 A;  1SZV A;  5FI7 A;  3IF6 B;  1H8M A;  3UDI A;  4ZTK A;  5HAR A;  4S2N A;  3WRZ A;  3ZCZ A;  3VOY A;  3G2Z A;  3KYZ A;  3TOI A;  4LCL A;  1AWI A;  1LLB A;  4GLQ A;  3VSL A;  5GLD A;  1ZG6 A;  4I38 A;  5FAP A;  3M2J A;  4R4R A;  3U2A A;  3IBJ A;  3UB6 A;  4OOY A;  3OPR A;  3TE8 A;  5K5B A;  3CAX A;  3G6O A;  5E2E A;  3C8C A;  2V1A A;  2E8J A;  2B18 A;  3PR6 A;  4KZ4 A;  4WM9 A;  3NI9 A;  4EEU A;  1D06 A;  4KZ6 A;  3OZH A;  4PPR A;  2VV6 A;  5AQA A;  5GHY A;  4WLA A;  3S7N A;  3E2K A;  3A0V A;  2Y55 A;  4FD8 A;  1DP8 A;  3A0R A;  2KDK A;  4LGW A;  4UHU A;  4OQG A;  3HLG A;  4WEK A;  1XGJ A;  3CWF A;  3UB7 A;  2V0U A;  1CI9 A;  3T4T A;  3PBT A;  1XX2 A;  4S2N C;  3Q7V B;  2Z2M B;  3HLB A;  3NJA A;  2Q9M A;  4LEN A;  1G6A A;  3WS1 A;  4WF0 A;  4KZ3 A;  1X0O A;  3BFG A;  3UDF A;  4LV3 A;  4BLM A;  2JBF A;  5DFY A;  3JPU A;  2P74 A;  2H10 A;  5DKK A;  2XRO A;  2WGW A;  4Y15 A;  3RXW A;  3LUQ A;  1JTD A;  4I39 A;  4IUH A;  2W3G A;  1BUL A;  4EUV A;  5G4Y A;  5CGX A;  3AGE A;  1YLZ A;  2OV5 A;  4GS9 A;  3G2Y A;  1ESU A;  2EFX A;  1OTE A;  1HZO A;  5FQQ A;  4EXO A;  2R9W A;  4NET A;  1YMS A;  5CXW A;  3SS3 A;  2ZL1 B;  3KYQ A;  1PZP A;  1XFN A;  5AVF A;  4GHI A;  4R23 A;  4X68 A;  3B3X A;  4Z1W A;  3R4K A;  4LV2 A;  3LEQ A;  4OLD A;  5L09 A;  1ONG A;  1MWS A;  3LIF A;  4XUZ A;  5HSQ A;  2K2N A;  5EFW A;  3OOV A;  1N4O A;  4UEY A;  2IWC A;  3WS5 A;  3IF6 A;  2XEP A;  3U4L P;  1GHI A;  4GJ4 A;  2VGL M;  2V2F F;  4P6Z M;  1DP9 A;  1D7E A;  3KYE A;  1OJG A;  3G32 A;  2W1R A;  1PW8 A;  5FAQ A;  4KUO A;  4G3V A;  3D9Y A;  1M40 A;  1YSP A;  4GCZ A;  2Y2O A;  4FH4 A;  4JXS A;  3H82 B;  4O8G A;  3VP1 A;  4G3K A;  4JF5 A;  4PHT A;  2M7U A;  4R1G A;  1K4E A;  5FI2 A;  3FG8 A;  5HD3 A;  4LPZ A;  1F5M A;  2JCH A;  3M6H A;  3V3R A;  3IX8 A;  1L2S A;  5EVE A;  3IT9 A;  2VV8 A;  1BLS A;  2ZOI A;  4MN7 A;  4DMZ A;  4QPR A;  1S1Z A;  2VA0 A;  1XXM A;  5AQB A;  2WGI A;  1BT5 A;  1G6O A;  2HDR A;  5DTT A;  5FSR A;  2G2W A;  3V39 A;  3PBO A;  3QNC A;  3IF6 C;  4II7 A;  1UWP X;  4R3A A;  3T4O A;  2YKF A;  3Q7V A;  2Y2K A;  4R0Q A;  3E0Y A;  4RX2 A;  2J8Y A;  1TS0 A;  4JF6 A;  1HLU P;  4I5S A;  3QP1 A;  1BUE A;  2QHK A;  3P98 A;  3C30 A;  3IHB A;  4Q0I A;  4S2P A;  2W3F A;  4JBF A;  1CEF A;  1TS7 A;  1E3U D;  2A49 A;  3MZD A;  4ESP A;  4LLO B;  5M19 A;  3IHA A;  5EVI D;  3UE6 A;  4ARZ B;  2HGV A;  3IH8 A;  1ERQ A;  3DTE A;  4MCW A;  2EWV A;  2W0N A;  3T12 B;  2QJ5 A;  3TJZ C;  4KUK A;  2ZL1 A;  1S6R A;  2GJ3 A;  1L0G A;  3TW8 A;  3KSH A;  1E4D A;  5L10 A;  1K6S A;  3Q81 A;  3MF0 A;  2D02 A;  1K6R A;  3K3D A;  3V5M A;  4YIN A;  1S4R A;  4Y7P A;  3VSK A;  3Q82 A;  3MXR A;  3VOL A;  3N4I A;  2A24 B;  4H8R A;  3ZNY A;  2XH9 A;  3B42 A;  1K25 A;  2JC7 A;  5KSC A;  2XD1 A;  3FKV A;  2VGK A;  3GSG A;  4IBR A;  5FEG A;  1ERM A;  4K0X A;  4RX3 A;  1OT9 A;  4LRZ E;  1JNU A;  1T1A A;  1XJ2 A;  2C5W B;  1PYY A;  3K3C A;  5J4E A;  4JGP A;  1VET B;  1NZO A;  3ZG0 A;  3LIE A;  3ZYT A;  3UE3 A;  2VV7 A;  2PYR A;  4HP9 A;  5TBM B;  3BFF A;  3G4P A;  1XA1 A;  4O7D A;  3H82 A;  4ZDX A;  3MS6 A;  4NXG A;  1NJ4 A;  3GTC A;  2PBY A;  2ZC7 A;  3FPV A;  3BEC A;  1T18 A;  4LCM A;  3LR0 A;  4O01 A;  1ZG4 A;  2ACG A;  3N7W A;  3QP8 A;  4PM8 A;  3TG9 A;  1UGU A;  3MXS A;  4N92 A;  1BZA A;  1VQQ A;  4HY8 A;  3SS4 A;  5KIZ A;  3H9W A;  2VGJ A;  5F83 A;  1W79 A;  3IXH A;  3AGF A;  4M3K A;  1ES5 A;  2O9C A;  4OPR A;  3R7W B;  3GMW A;  3CZD A;  5F82 A;  5GL9 A;  2BAS A;  5EVI B;  4KQR A;  3UB9 A;  2PD7 A;  4OLG A;  2WKH A;  2BLS A;  1OPX A;  5A90 A;  1CK3 A;  1S4S A;  1K55 A;  3S7Q A;  1STZ A;  2V20 A;  2VK3 A;  5TJJ A;  4E3K A;  1IEL A;  5KSH A;  4BQM A;  3VP2 A;  5HPF A;  4C75 A;  4ARZ A;  3ULF A;  2P04 A;  2WUQ A;  4BJP A;  3ISG A;  2Q0O A;  1PWC A;  4OPY A;  3GEC A;  2OAP 1;  2W3H A;  3ITA A;  4HHD A;  1PWD A;  1Y4O A;  1FSW A;  2PR5 A;  1CEG A;  5FAO A;  3KX0 X;  1RCJ A;  5FI6 A;  3LFV A;  3A3D A;  1E25 A;  4QJG A;  4ZJ1 A;  3IXD A;  3IXG A;  4P87 A;  5HL6 A;  4U0T A;  2Y2M A;  3IX4 A;  3ZDJ A;  2P7J A;  2DCF A;  4X25 A;  5JYO A;  3L7H A;  3BFC A;  1H0M A;  1MXO A;  2A24 A;  4B4Z A;  1VB6 A;  3T50 A;  3EEA A;  5L8M A;  3WS4 A;  2I72 A;  3T4S A;  3P09 A;  4GD8 A;  1ALQ A;  4PM9 A;  3AGD A;  3SH7 A;  2G2U A;  4DE1 A;  2XA7 S;  2JKF A;  4X56 A;  4DJ3 A;  1SHV A;  5DVA A;  3HCY A;  5J8X A;  1VET A;  2ZM2 A;  2WKE A;  3E2L A;  2J9O A;  2JKG A;  3DWZ A;  1JWZ A;  1ZC2 A;  4ETZ A;  2H28 A;  1NRF A;  1K38 A;  4RVA A;  5TBM A;  3BW6 A;  3UY6 A;  2Y2Q A;  1FCO A;  2QJ7 A;  4U0X A;  3O3V A;  4BMW A;  3VP4 A;  4HIA A;  1KVL A;  3PAG A;  5DF9 A;  3VE4 A;  1XPB A;  4HQA A;  4C6Y A;  3T4L A;  1S67 L;  4QHC A;  3T4Q A;  2HP6 A;  4JGR A;  1I2W A;  4BL3 A;  1LI9 A;  5C5K A;  2WGV A;  2EX9 A;  5CEC A;  2PDR A;  5TR7 A;  2WYX A;  3RXX A;  2GX5 A;  4OKP A;  4XXR A;  4YNR A;  5GHZ A;  1E3U A;  3WWX A;  3C7U A;  4KG6 A;  4I3I A;  3R7W A;  2RCX A;  4FOF A;  2L1M A;  1XJ3 A;  1FQG A;  3MSH A;  5E2H A;  5EVI A;  4Q0J A;  4LV0 A;  1Y28 A;  3LO7 A;  5HD5 A;  3HLC A;  2PD8 A;  2Y4A A;  3LGO A;  4E04 A;  3WRT A;  3NBL A;  3BM6 A;  4WUJ A;  5GLA A;  2AVX A;  4KEN B;  4R4S A;  1BSG A;  1IKG A;  2ZQA A;  4KZB A;  4OP5 A;  3VP3 A;  1K0K A;  3V50 A;  5EV0 A;  1N9N A;  4WZ5 C;  2V1Z A;  2JKT I;  5F68 A;  4K0W A;  3VFF A;  3LR3 A;  3HUM A;  4AFI A;  2Y79 A;  4ZJ3 A;  2L4R A;  4S2O A;  1L0F A;  3E4Q A;  2YKH A;  1FR1 A;  3PTE A;  3FC7 A;  5HDC A;  4DKI A;  1NXY A;  5L07 A;  1JWP A;  2PT7 A;  1NLZ A;  3T1R A;  1FIL A;  3BWL A;  3MQ0 A;  2C6W B;  1SCW A;  3PYP A;  4L9E A;  2V0W A;  4HES A;  5EE8 A;  2Z6C A;  3VMA A;  1JTG A;  5EVI C;  4OOL A;  1NLY A;  4UA7 A;  3KSF A;  1OT6 A;  4LFU A;  3WS0 A;  4OQI A;  5HW3 A;  2EX8 A;  2PAV P;  1P9W A;  1LHY A;  1WYB A;  2QMI A;  3H7W A;  4K91 A;  4BL2 A;  2ZQ7 A;  4QD4 A;  5D3O A;  4Y5F A;  4F3L A;  1S1Y A;  1KE0 A;  3BFE A;  4KQQ A;  5BOH A;  4PKY A;  1W8Y A;  3JVV A;  2QZ6 A;  4B93 A;  2GNX A;  4RQ9 A;  2P9V B;  2H0Y A;  1PW1 A;  1PIO A;  2XDM A;  3EGD C;  2ZMF A;  3IWQ A;  1LSV A;  1GA9 A;  3HBR A;  2OWH A;  3NEC A;  3LY4 A;  1XA7 A;  3ZHH A;  3MKE A;  1F98 A;  1N9O A;  1P0Z A;  4RYE A;  2Y2I A;  3F1N B;  4LV1 A;  4Y2F A;  5GHX A;  5FQK A;  5HDD A;  4CJN A;  1TDL A;  5AQ9 A;  3V67 A;  4IJG A;  2WAD A;  1LL8 A;  3EQU A;  3BY9 A;  4NXB A;  2PR6 A;  2J3W A;  3B47 A;  1YSQ A;  4X55 A;  4P0M A;  4NK3 A;  2WKP A;  2OLU A;  4BD1 A;  1PNE A;  1KOU A;  5HAQ A;  2XGN A;  5TFQ A;  1OJ5 A;  4IHQ A;  4MBK A;  3BLS A;  3T1Q B;  1XP4 A;  3ZG5 A;  3PXP A;  2XA7 M;  5FQJ A;  2Y59 A;  3IX3 A;  4YWZ A;  2JHE A;  1OME A;  3V3S A;  3UME A;  3FWL A;  2ZMA A; 
#chains in the Genus database with same CATH homology
 2KLI A;  1GSX A;  5HWW A;  2VZW A;  4O0P A;  2QWS A;  3MJQ A;  1OT9 A;  4LRZ E;  1JNU A;  1T1A A;  1XJ2 A;  3K3C A;  5J4E A;  2B02 A;  4JGP A;  3SW1 A;  2FH5 A;  2W3E A;  2W1T B;  1XJ6 A;  2J80 A;  5CX7 A;  3LIE A;  3ZYT A;  4WL9 A;  3UE3 A;  2VV7 A;  2PYR A;  2VGL S;  4HP9 A;  3PBN A;  4P6Z S;  5TBM B;  3MR0 A;  2JKR I;  3TRC A;  4BBT A;  2MJ6 A;  2A2L A;  4CLC C;  3H7W B;  3H82 A;  2VLG A;  4MN6 A;  1W63 M;  5AVE A;  4HH2 A;  4NXG A;  4HH3 A;  4HI4 A;  3S7P A;  4NXE A;  3FPV A;  4F3L B;  5HWV A;  4HOI A;  1T18 A;  2INW A;  5IT5 A;  3LR0 A;  4O01 A;  2EA9 A;  2I9V A;  4GS9 B;  2CMN A;  3RTY A;  5F5Y A;  2VJW A;  1UGU A;  3CUE C;  3NHQ A;  4ETX A;  5F69 A;  5DKL A;  4WN5 A;  4HY8 A;  2JN7 A;  4HP4 A;  3OC2 A;  4NKP A;  4CLC E;  5KIZ A;  2FZ0 A;  3H9W A;  3PHY A;  2K7S A;  2LB9 A;  1MC0 A;  4GHI B;  4JGO A;  3F1O B;  1UWN X;  3P01 A;  3KSG A;  2O9C A;  4MMN A;  2O0Y A;  2PYP A;  1BYW A;  4I3J A;  3R7W B;  3ZQ5 A;  1T19 A;  3PBQ A;  2BAS A;  3P7N A;  5IU1 A;  2DMW A;  2LB5 A;  3UB9 A;  3IBR A;  1IOU A;  1EW0 A;  3BJN A;  3KO6 A;  3A0S A;  4EES A;  2PD7 A;  2P08 A;  4CLC D;  3MMH A;  5HPI A;  3EQV A;  1NRJ A;  1VHM A;  1LT0 A;  3EWK A;  4EER A;  1OPX A;  4MDZ A;  1XFQ A;  5HWT A;  3DBA A;  1H8M A;  1F9I A;  1S4S A;  1TS8 A;  3S7Q A;  1STZ A;  3KYZ A;  1YKD A;  2J3T C;  2QYB A;  5TJJ A;  4DJ2 A;  5I5L A;  3S7O A;  5KSH A;  1ZTU A;  2W3D A;  3CUE A;  4GLQ A;  3F1N A;  5HPF A;  3LID A;  4ARZ A;  4I3A A;  4I38 A;  3ULF A;  1P9R A;  2Y8H A;  3D3O A;  2P04 A;  3U2A A;  3IBJ A;  3UB6 A;  5G4Z A;  4BJP A;  1IFQ A;  1T1B A;  3F1P B;  3GEC A;  2OAP 1;  2W3H A;  4HHD A;  3TE8 A;  3CAX A;  3G6O A;  5K5B A;  3C8C A;  2V1A A;  2B18 A;  2PR5 A;  4XT2 A;  3PR6 A;  3KX0 X;  3BQ8 A;  3LFV A;  3LYX A;  3MXQ A;  4IUK A;  4DN0 A;  2W27 A;  4EEU A;  1D06 A;  1GSW A;  5HL6 A;  4B9O A;  3EOI A;  3LR4 A;  2VV6 A;  2P7J A;  4WLA A;  3S7N A;  5MC7 A;  3K2N A;  3A0V A;  1V9Z A;  2JKT M;  2A24 A;  3BY8 A;  1VB6 A;  1DP8 A;  3T50 A;  3A0R A;  2KDK A;  3EEA A;  5L8M A;  2J3T D;  2HV1 A;  3T4S A;  4K08 A;  3UMD A;  5DJU A;  4PKY G;  3OBF A;  4L9G A;  3C2W A;  4WEK A;  3CWF A;  3UB7 A;  2XA7 S;  2V0U A;  1LSW A;  4HNB A;  2IA2 A;  3T4T A;  3W2Z A;  4DJ3 A;  3PBT A;  3CIT A;  3KSI A;  3LIA A;  3NJA A;  2EWW A;  3HCY A;  4OOM A;  3PBR A;  2W1T A;  1DRM A;  4UQI S;  4ETZ A;  2H28 A;  3D72 A;  3GDI A;  4WEL A;  3O5Y A;  1OTB A;  4WF0 A;  1X0O A;  1ZHH B;  3CLO A;  3NOU C;  3RH8 B;  5TBM A;  3BW6 A;  2QJ7 A;  3FPW A;  2VEA A;  4EU0 A;  4CQH A;  5DFY A;  4R38 A;  5DKK A;  4BMW A;  4H6J B;  2WKR A;  4HIA A;  2XRO A;  5DF9 A;  4BWI A;  3LUQ A;  3VE4 A;  5AJG A;  4HQA A;  4I39 A;  2W3G A;  4IUH A;  4EUV A;  5G4Y A;  3T4L A;  1S67 L;  3C38 A;  2L0W A;  3T4Q A;  4JGR A;  4L9F A;  2OWJ A;  4GS9 A;  4CLC B;  4R6L A;  1OTE A;  1OTI A;  5C5K A;  4HJ3 A;  4EXO A;  2HF6 A;  2PDR A;  2WKQ A;  3MFX A;  4ME4 A;  3LIC A;  2OOL A;  3OCL A;  3KYQ A;  2GX5 A;  1XFN A;  5AVF A;  4GHI A;  1GSV A;  2G7U A;  4YNR A;  3F1O A;  1P97 A;  1N9L A;  3IS2 B;  3T4K A;  4Z1W A;  3R4K A;  4I3I A;  3R7W A;  4HJ4 A;  1MZU A;  3EGX C;  1V9Y A;  4FOF A;  2L1M A;  4G3W A;  1XJ3 A;  5HZH A;  4Q0J A;  3LIF A;  1Y28 A;  5HD5 A;  2ZOH A;  5HSQ A;  2K2N A;  5EFW A;  1TS6 A;  3LI8 A;  2PD8 A;  4Y3I A;  4E04 A;  3OOV A;  4UEY A;  4HJ6 A;  4WUJ A;  4BBU A;  4NXF A;  3BQA A;  1G28 A;  2R78 A;  4EQ1 A;  2O99 A;  3LI9 A;  4GJ4 A;  4R70 A;  2VGL M;  2VKS A;  4P6Z M;  2ZMV A;  5FL3 A;  1DP9 A;  4KQD A;  1D7E A;  1OJG A;  1OTD A;  1N9N A;  3VV4 A;  2JKT I;  4LRX C;  3E4P A;  5F68 A;  4M4X A;  5A8B A;  2PHY A;  2W1R A;  3HJI A;  2O9A A;  3LR3 A;  4AFI A;  2GZA A;  2Y79 A;  2D01 A;  4KUO A;  4G3V A;  1YSP A;  2L4R A;  3NOP C;  4GCZ A;  1W63 Q;  3OLO A;  3E4Q A;  2HJ9 C;  2YKH A;  4UQI M;  3F1P A;  3H82 B;  3MQO A;  4O8G A;  5J7E A;  1OTA A;  4G3K A;  5F6A A;  4PHT A;  3OCN A;  2M7U A;  1XJ4 A;  2QKP A;  2KOI A;  3FC7 A;  5HDC A;  1YAX A;  2Z6D A;  3FG8 A;  3JVU A;  5HD3 A;  4LPZ A;  2PT7 A;  1NLZ A;  3CI6 A;  3T4J A;  1T1C A;  1H3Q A;  1F5M A;  3BWL A;  3E98 A;  5DJT A;  3NOT C;  3MQ0 A;  3PYP A;  4L9E A;  4L0L A;  2V0W A;  2VV8 A;  2ZOI A;  2Z6C A;  4MN7 A;  4DMZ A;  4QPR A;  1S1Z A;  2VA0 A;  1S66 L;  2XRN A;  4OOL A;  1NLY A;  3KSF A;  1OT6 A;  3UB8 A;  2O9B A;  3RFB A;  1G6O A;  1P9W A;  4EEP A;  2JKR M;  2V1B A;  3H7W A;  5HDS A;  1ODV A;  3PBO A;  1LSX A;  2NUT C;  4II7 A;  1UWP X;  4Q0H A;  4R3A A;  3T4O A;  4Y5F A;  2YKF A;  2HJE A;  4F3L A;  2K31 A;  3E0Y A;  1S1Y A;  1TS0 A;  5IS1 A;  4PAU A;  4PKY A;  4I5S A;  3JVV A;  4B93 A;  2GNX A;  5DFX A;  2QHK A;  4NEE D;  4RQ9 A;  3C30 A;  3EGD C;  2ZMF A;  3LR5 A;  3PBS A;  2XSS A;  3ICY A;  4Q0I A;  2W3F A;  1LSV A;  4FSF A;  4H6J A;  1NWZ A;  1TS7 A;  2OWH A;  1WA9 A;  2OAQ 1;  1F98 A;  1N9O A;  4KQO A;  2VX8 A;  4LLO B;  1MKM A;  1P0Z A;  4Y2F A;  3F1N B;  5HDD A;  3UE6 A;  4ARZ B;  2HGV A;  4CLC A;  3HJK A;  3V67 A;  4MCW A;  4BBV A;  4IJG A;  2M7V A;  2KX6 A;  2EWV A;  2W0N A;  1TF1 A;  2QJ5 A;  5J3W A;  1LL8 A;  4KUK A;  3TJZ C;  4EW7 A;  2GJ3 A;  3EQU A;  3BY9 A;  4NXB A;  4XT2 B;  2V9A A;  2PR6 A;  2J3W A;  3B47 A;  3TW8 A;  3MQQ A;  3VE3 A;  3KSH A;  1YSQ A;  4ZRR A;  3IS2 A;  2M1C A;  2WKP A;  1KOU A;  4JGQ A;  4WEJ A;  3MF0 A;  3E4O A;  2D02 A;  1OJ5 A;  4IHQ A;  3K3D A;  4LRY C;  1S4R A;  1DP6 A;  1TD5 A;  2NUP C;  3VOL A;  3PXP A;  2XA7 M;  4MN5 A;  5LBR A;  3B33 A;  2A24 B;  4YWZ A;  2JHE A;  4GW9 A;  3EEH A;  3B42 A;  3LIB A;  2ZBB A;  3UME A;  4EET B;  4YOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...