1IFQA

Sec22b n-terminal domain
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
SVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel snare N-terminal domain revealed by the crystal structure of Sec22b.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords vesicle trafficking protein Sec22b
total genus 36
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ifqA00
4B93A 2NUPC 3EGDC 2NUTC 4AFIA 3EGXC 3BW6A 1H8MA 1IOUA 1IFQA 3KYQA 2DMWA 2VX8A
chains in the Genus database with same CATH superfamily
1YLZA 3Q7VA 3BM6A 1GA9A 3KSHA 5F68A 5TR7A 4FD8A 1OTEA 1L0FA 2G2UA 2MJ6A 4E3IA 3BFEA 3MFXA 4A5RA 4OPZA 5GHXA 4JGPA 2Q9MA 4BENA 2RCXA 3UB7A 2J3TC 1K4FA 3NCKA 4I5SA 5HAQA 4IBXA 2Y8HA 1PYYA 1ZG4A 3GECA 1W79A 3ZVTA 3NI9A 5J7EA 2PU2A 4HBUA 3C2WA 1NRFA 4YNRA 2R9XA 2Z2LB 3BRMA 3UB5P 2W3EA 3WRTA 3NBLA 2EXBA 3VOYA 2XD1A 3LIEA 2Y79A 2XFSA 3FKVA 1BT5A 1ONGA 4O01A 1S66L 3BFCA 1FOFA 2WGWA 3A3IA 4IEDA 3SOIA 4P0MA 4F3LA 1EROA 2O9AA 5J3WA 1ES4A 3U2AA 4LRXC 4OPQA 2Y4AA 3KO6A 3B3XA 3ULFA 1I5QA 3BY8A 4HHDA 2HDRA 1P97A 3A3JA 5GHZA 1GSVA 2BLSA 3IBRA 1LSXA 3HLCA 3NJAA 3FPVA 1VM1A 1U60A 3QP8A 4R0QA 4DXBA 2XA7S 5E2GA 3QNBA 1KDSA 4OOLA 3BQ8A 1Q2PA 4DJ3A 4FUWA 4S2MA 2Q9NA 5CTMA 1YLTA 3W4PA 3ZCZA 3C4PA 2DRWA 1MKMA 2P9VA 1ESIA 1OTIA 4M3KA 2VA0A 1AWIA 4N92A 4S2KA 3VP3A 1TEMA 2QWSA 1L0EA 2Y2MA 3OPPA 1QMFA 2GX5A 3LR5A 3ISGA 3HLBA 5EVIA 3H7WA 3T4QA 3F1NB 2M7UA 2EX9A 4LRYC 3UMDA 1EI5A 5E2FA 3VP0A 3A3EA 2B02A 3ZVWA 2V8FA 2X02A 2HP9A 3BLMA 3F1NA 4MBHA 1FIKA 2Y2JA 2VV6A 5CGXA 1WYCA 3MZEA 5FQKA 3IXGA 3CLOA 4NETA 1CF0A 3JYIA 4HJ4A 1LHYA 4PPRA 1IYOA 5IHVA 5HD5A 4OQGA 5A8BA 4UQIM 1ACFA 5E43A 2GJ3A 1LI0A 3OPLA 1P0ZA 3RFBA 2A24A 1NZOA 1PNEA 4WUJA 2V9AA 1Z6FA 2QJ5A 4R23A 3H82B 1NJ4A 1E3UD 4I38A 3TOIA 1JWZA 1LSVA 4OH0A 4OQ0A 1H0MA 1M6KA 2EFXA 5HL6A 5LBRA 2PD8A 2PRFA 4KQQA 2V20A 3NC8A 1W63M 4R70A 4UQIS 5AQ9A 2PU4A 3ZNYA 3PBQA 2QZ6A 4BMWA 4MN6A 4GDBA 1MBLA 3HCYA 5F82A 4KZAA 3UE1A 4ESPA 3MMHA 4P87A 4Z9QA 1UWPX 3V3SA 1MY8A 2W3GA 5A92A 4R4SA 4KZ5A 3C8CA 1JWVA 1NWZA 3G30A 4PKYA 3VV4A 3VFFA 4X53A 1K57C 1TS7A 3F1OA 3LICA 3ZYTA 5IU1A 5EECA 1FSWA 3IX4A 1JTDA 4I3IA 3LEZA 4WF0A 4GB7A 4IBRA 2HZ5A 2W27A 3LIFA 4L9GA 1JWPA 4LPZA 1OTDA 2M1CA 1G28A 1X0OA 3LIDA 5FQIA 1HLUP 4BQMA 1YT4A 2FH5A 2ZL1B 4CLCC 3T4TA 2OLVA 3NOPC 4EBPA 3V3RA 2WKPA 5GHYA 5HWVA 2H0YA 4NEED 1Q2QA 5BOHA 4U0TA 4GN2A 4MLLA 3M2JA 2ZJ9A 3C4OA 4NKPA 5L2FA 3MZDA 4QD4A 1ES2A 5EM1A 1NYMA 4OQHA 3TJZC 2J3WA 3HLFA 1V9YA 5AQBA 3NY4A 5GLAA 1DJAA 2XGNA 2INWA 3ZG8B 2K31A 4DDYA 4EWFA 2KDKA 1DJCA 4KZ6A 2GNXA 2Z6DA 4EBLA 2B18A 5F1FA 4FCFA 4DE1A 1BLCA 1Y54A 3JPUA 4LCLA 2CMNA 4JGRA 3UN7A 1BTLA 4EEPA 2HV1A 4OP5A 1YMXA 4L0LA 3EWKA 4X1LA 5DFYA 1ZG6A 3PBSA 3SS4A 4GNUA 5HD3A 5F6AA 4JXGA 2JKGA 2ZQAA 4EV4A 3LR4A 4LRZE 3M6HA 3IT9A 3IF6A 3UPNA 2P9VB 3LIAA 1KVMA 3HUOA 2EX2A 3IHAA 3O5YA 1L0GA 3CUEA 4ETXA 5FL3A 1XA1A 4KG6A 1ESUA 3F1PB 2VJWA 4S2PA 1K57A 4HJ6A 5CXWA 5L09A 4G3KA 1K6RA 4KUOA 2OWJA 2V2FF 4GKUA 3M2KA 5KZHA 1W5DA 4Q0JA 3D9YA 2LB9A 4O8GA 1KDWA 1KE4A 4I3AA 3B42A 2XEPA 1TS6A 4OQIA 3CHWP 2V8CA 4B4ZA 1IYPA 4KQRA 4X56A 3RXXA 4QY5A 3WS1A 1KVLA 1M40A 4BLMA 4X55A 5FSRA 3RXWA 3MZFA 3OBFA 3R7WA 1SCWA 3CPTA 1ZKJA 2WZXA 1W8QA 1NYYA 3W4OA 2Y2GA 1PW8A 2NUPC 2EX6A 5HAIA 4AFIA 5HPIA 1VQQA 3DWKA 3DBAA 1KGFA 4HP9A 2O9BA 2H0TA 1OPXA 1H8YA 2WKIA 3LI9A 3N8RA 3FG8A 2UV0E 1S67L 3TE8A 3OPHA 1IYSA 3D3OA 3EQUA 4PM8A 3VMAA 4LENA 2ZQCA 1BLSA 3N6IA 4K91A 2Y55A 5TFQA 4E6WA 4WEJA 3DW0A 4JF6A 4DF6A 1XJ3A 3Q1FA 3CPTB 3UB8A 4CLCA 1N9LA 4U0XA 3NULA 5FI6A 5EM0A 4WBGA 4S2LA 3OC2A 2GDNA 3O86A 4R1GA 2ZMAA 4H8RA 3UPOA 3GR2A 2OOLA 4LV2A 5HAPA 4OLGA 4Y17A 4R3AA 4GS9B 3QP6A 2VGKA 3BYDA 4I39A 1GCEA 3EGDC 5FDHA 1GHMA 1VETB 4HY8A 1SHVA 4I3JA 1T1AA 2H10A 1OJGA 2ZOHA 2YKFA 2X01A 4KZ4A 5KSCA 2P7JA 1YSPA 4E3LA 1DY6A 5FDSA 4YWZA 4WMCA 1PI5A 2ZMFA 4B88A 4PHTA 5CHUA 2DCFA 1D1JA 3E4QA 5KSHA 3IS2A 4C75A 3O87A 2XD5A 4UAAA 2V1ZA 4MN5A 4GLQA 4S2OA 2IA2A 1CEGA 2P08A 3CJMA 4EERA 3HREA 2WGVA 2KLIA 1YPRA 1TS8A 2WGWB 4BL3A 3EEAA 1OMEA 3FV7A 1W7FA 3UNWA 4WEKA 4MDZA 4QJGA 4XUZA 3H82A 4B9OA 4PMAA 2QMIA 2ZQ8A 4OONA 3V67A 2WKHA 4OP8A 3AGFA 1OT6A 4WZ5C 3IS2B 2G7UA 1F2KA 1PWCA 1VB6A 1G6OA 1CEFA 4Q8IA 5A91A 4CJNA 2J7VA 2ZM2A 4Y0UA 2NUTC 3ZFZA 2O0YA 5DFXA 2WK0A 2C6WB 3PXPA 1ES5A 2VZWA 2WADA 4O7DA 5TBMB 1J3WA 1MWRA 2J8YA 2ZQ7A 5KIZA 5CX7A 3T4SA 4JPMA 4HNBA 1UGUA 3UE0A 2ZC7A 3MF0A 3BFGA 4GZBA 2K2NA 2P04A 3CG5A 4XT2B 5EVEA 4K0WA 3UO9A 1T19A 3MFDA 3L7HA 4UHUA 4PM6A 2PAVP 3C7UA 3T1XA 5EV0A 3IX3A 1J9MA 4L9EA 2E8JA 2W3DA 4BD0A 2XROA 1I2SA 4GS9A 2XH9A 3C7VA 4X68A 5L8MA 1H8ZA 2HJ9C 2KOIA 2Y91A 2JHEA 4CLCE 4WELA 4DDSA 3BY9A 3OLOA 1YAXA 3VSLA 3O88A 5CGWA 2W3FA 5FAQA 2BTFP 4E3KA 3UDFA 4E3MA 3OCNA 1ES3A 4E6XA 1SKOA 1H5XA 1SDEA 5EUAA 3PBNA 4EETB 4BD1A 2PBDP 2PYRA 3T50A 4OOMA 3O3VA 3N4IA 4HBTA 4ZJ2A 1F5MA 2PR6A 4M4XA 4WZ5A 3F1PA 1YSQA 1PW1A 1YKDA 2JKFA 2UWXA 5DVAA 4DE0A 4N1XA 1ALQA 3C30A 4R3JA 1D7EA 1K4EA 3W8KA 5AQ7A 3ZDJA 1ZTUA 4Y5FA 4PM9A 3MQ0A 1PI4A 1Z09A 4MN7A 5MC7A 3LR3A 4MCWA 3BW6A 2XK1A 2EWWA 3LYXA 2D01A 2OV5A 4ID4A 4EXOA 3CMZA 1CQAA 4ARZB 2OWHA 4BWIA 1PWDA 3WWXA 1MXOA 5A90A 1TS0A 1D06A 5DTTA 3CI6A 5FI7A 4Y3IA 3LEQA 2EA9A 1HVBA 2HJEA 5M1AA 2IWCA 3D72A 1FR6A 3R7WB 2QYBA 2XA7M 1W63Q 4KQOA 3UPPA 5DJTA 4H6JA 3PHYA 3HLWA 4Y15A 1XGJA 3MBZA 1XX2A 5IS1A 1XGIA 3PYPA 4BJPA 1XA7A 2V0UA 4OVDA 3Q7VB 3OCLA 3NECA 1C3BA 3B33A 5EVID 1LSWA 3FPWA 1BLHA 2WKEA 4GD6A 4QWOA 4P85A 1LL9A 1ODVA 2HF6A 2ZOIA 2ZQ9A 1LL8A 3MXQA 4JLFA 4WZ4A 4JXWA 3CITA 4Q0HA 3N8LA 4LV0A 4KG2A 3E2LA 4LV3A 1KGEA 5AQAA 3DTIA 4ZJ3A 3KYZA 4GHIB 2ZMVA 3IXHA 1G5UA 2CC1A 3W2ZA 2L1MA 3GMWA 3S7NA 5HX9A 4D2OA 5I94A 2W1RA 2EX8A 1K54C 1N9BA 4WMCD 5HWTA 5CHMA 4DXCA 3I7JA 4WM9A 3SH8A 2OSUA 3EOIA 1RCJA 2VV7A 1P9WA 3QP1A 1DP8A 3LCEA 4CPKA 4PM5A 4EUVA 3WS2A 2VX8A 5DF7A 5C5KA 1BZAA 5HSQA 3ZNTA 1ZHHB 2J9PA 3E4PA 4RX2A 1RP5A 2J9OA 5AVFA 3T4LA 4R4RA 1HD8A 4NXGA 4H6JB 2ZC6B 2Y2LA 1K25A 3BLSA 4EW7A 5HARA 1TDGA 3MJQA 4KUKA 3IXDA 1JVJA 3WS4A 2O99A 3MR0A 5CGSA 2ZLYA 4LCMA 4GJ4A 3LFVA 1I2WA 4MBKA 1MWUA 1H8MA 4E04A 3WRZA 1KE0A 1YLYA 3A0SA 4YFMA 2YKHA 1IEMA 3ZG9B 2WZZA 1CK3A 5EVIC 2Y2HA 2HPBA 1HTZA 1YLJA 4OPRA 2AVXA 4BL2A 3SH7A 4LFUA 1IELA 3BQAA 3T1SA 1FCOA 1MZUA 2J3TD 4GCZA 2PR5A 3S7QA 4IUKA 3QP2A 1K55A 4S2NC 3ZG5A 3D4FA 4EUZA 3ZG0A 3IF6B 1S6RA 1XFQA 4UEYA 2QJ7A 5GL9A 2Y59A 3VP4A 1T1BA 1LLBA 1AXBA 2Y2KA 3T4OA 5A93A 3KYQA 1NXYA 3MKEA 3IBJA 1JTGA 2DMWA 4QB8A 5F83A 4EEUA 3PAGA 2G2WA 3NOTC 4KZ3A 5KMWA 5EOOA 3VOZA 4NXBA 1MWSA 4P6ZM 5HFOA 3LGOA 1S1ZA 5G18A 1E25A 5FAPA 4YOFA 5IT5A 4NG2A 1YMSA 3NHQA 2C5WB 4FSFA 4EQ1A 4II7A 3IXBA 4JKTA 4OOYA 1L2SA 1NZUA 3QNCA 1IOUA 2BASA 1E4DA 4ETZA 2IWBA 3G34A 2GZAA 4U3TA 1WE4A 2W3HA 1EW0A 1O07A 3LY3A 4UA9A 3DTEA 5M19A 3OPRA 3CAXA 3VP1A 2I9VA 4FTXA 3MKFA 2B5RA 3BJNA 2ZQDA 3Q81A 1PWGA 1QMEA 4YINA 3VE3A 4OKPA 5TJJA 4UA6A 5CRFA 4G3WA 2HGVA 3S22A 1G6AA 3FYZA 1VHMA 5FEGA 3UDXA 3IF5A 4LGWA 1FQGA 4E3NA 3NDGA 4ZDXA 4PAUA 2A24B 2PHYA 2H28A 3L9KA 3PTEA 4UA7A 2VEAA 1G68A 5F5YA 1S4RA 1PZPA 3WS5A 2B95A 4DJ2A 2VLGA 5FQMA 5EFWA 3DTKA 5HDSA 1YLPA 2ZC4B 2EXAA 4RVAA 5HDCA 2R9WA 4P6ZS 4Z1WA 5F1GA 1LI9A 1LT0A 1WA9A 2FFFB 3GSGA 5HL1A 3T1QB 1CJFA 1FR1A 4DN0A 1STZA 4CLCB 1VEUA 3V39A 1IKIA 3G31A 5FQJA 4PKYG 1DRMA 3HBRA 4X6TA 2HDQA 3CWFA 2ZC3B 5FQ9A 4HH2A 3WS0A 3HJKA 3A0RA 2M7VA 3KSFA 3QHYA 2IWDA 3VFHA 2PT7A 5FA7A 3MQOA 4O0PA 4MNRA 3JVVA 5D3OA 1K54A 4L9FA 3UE3A 3ICYA 4JGQA 3LUQA 3V5MA 2D02A 2ZM8A 1UWNX 3DTMA 4EU0A 3HJIA 2O9CA 3N7WA 3QP4A 1P9RA 4XUXA 1N9NA 4HH3A 1NLZA 2QKPA 4BBVA 4D60A 4KENB 1RGYA 3T4JA 3KYEA 3HLGA 3CUEC 5HWWA 3MXRA 5I5LA 5FATA 3KX0X 2ZC5B 2OAP1 2VV8A 3IQAA 3ITBA 4S2JA 1BYWA 1SKFA 3U4LP 2WUQA 1Y4OA 2VGLS 2Z6CA 4BBTA 3EQVA 3TG9A 3H7WB 3IH8A 3JVUA 3VOLA 3M6BA 3PBOA 2HP6A 2P74A 5K5BA 1BLPA 2XR0A 3QP5A 5GLCA 3VSKA 2A49A 3E2KA 4KZ8A 1PIOA 4P6BA 4KZ7A 2XFTA 3R4KA 2X71A 1L0DA 4R3BA 3Q07A 3VP2A 1KOUA 1EWZA 1XPBA 4GW9A 3P98A 4LLOB 3GRJA 4B4XA 4X25A 2FZ0A 3NIAA 4FH4A 5HW3A 5DTSA 1XFNA 4X1MA 4WLAA 1NLYA 3ZQ5A 3KSIA 4DE2A 3GTCA 3PBTA 3G2ZA 1K55C 1WYBA 4ZJ1A 2Y2OA 3LO7A 3P01A 2E8IA 4XXRA 1IYQA 2WAFA 2V1AA 2JKRI 4DKIA 1MPLA 1PZOA 3TW8A 2OLUA 2L0WA 4FH2A 2ACGA 5CTNA 3UY6A 5L07A 3SS3A 3G32A 2A3UA 1N9OA 4KZBA 4JF5A 1BSGA 2R78A 3UB6A 3HUNA 3T4KA 2PBYA 4HQAA 4PM7A 1L3LA 4QPRA 2KX6A 5HZHA 4GD8A 4HIAA 5HDDA 3AGDA 3EEHA 1ERMA 2HDUA 4RA7A 1W8YA 1XJ6A 3MSHA 2JKTI 3BECA 1GA0A 2Q0OA 4CQHA 2W0NA 2H5SA 4S2NA 1GHPA 4HP4A 2JKRM 4WL9A 5GLDA 1VETA 4RYEA 2QHKA 3IX8A 1ONHA 1T18A 2LB5A 3S7PA 1JNUA 2EFUA 4WN5A 3P7NA 3SH9A 1YQSA 2XDMA 4Y2FA 3BEBA 5G4YA 1A0KA 3HVFA 1XJ2A 3BFDA 1K56D 1BULA 4MEZA 1XKZA 4HI4A 4IUHA 5CERA 2DNSA 2VGJA 1IFQA 5M18A 1SKOB 2XRNA 2JE5A 3HL9A 5DTKA 5F69A 2K7SA 2JBFA 4Q0IA 3FKWA 3DAVA 3T12B 1NY0A 4ZTKA 3S7OA 3SW1A 3AGEA 4KQDA 3RJUA 3DWZA 5DF8A 2VK3A 4HJ3A 2PD7A 1DP9A 4F3LB 1IKGA 4XT2A 5CEBA 3IWQA 1KGGA 3LY4A 4EBNA 1ZC2A 5FAOA 3B47A 4LV1A 5J8XA 3P09A 4R6LA 4CLCD 1PFLA 2ZL1A 2FFYA 2Z2MB 2Y2PA 2JC7A 1OJ5A 4N9KA 3UE6A 4B93A 5FEFA 1KE3A 4S2IA 1XJ4A 1OTBA 1VEUB 1DJBA 2ZM0A 3OZHA 3OOVA 3Q7ZA 3PAEA 2XQZA 4JBFA 3ZG7B 2JN7A 4NXFA 5AJGA 2EWVA 3UB9A 3RH8B 3MQQA 2WAEA 4IJGA 3GVBA 2Y2QA 3PR6A 1MWTA 2BG1A 4C6YA 3MS6A 5JYPA 4MMNA 3IF6C 4QHCA 1TF1A 2VKSA 4R38A 1FILA 3PBRA 4N9LA 1S0WA 4RQ9A 3G6OA 2XSSA 1XXMA 5DF9A 3Q82A 3A0VA 5EVIB 3HLEA 4JXSA 3A3FA 3TRCA 5DKLA 4GHIA 1BUEA 1PRQA 2ZBBA 4RX3A 2V1BA 3EGXC 3FZCA 1GSXA 4G3VA 1Y28A 2XF3A 4E3JA 3K3CA 3E0YA 5DKKA 4DE3A 3LR0A 4IHQA 3K2NA 1S4SA 3GQZA 2I72A 4X69A 5EE8A 1O7EA 3SS5A 5E2EA 3LI8A 1K6SA 3T1RA 5J4EA 2WKQA 1XP4A 2RL3A 2PDRA 4QU3A 2QPNA 5FQQA 1MKIA 5FI2A 4E3OA 5U47A 4ZRRA 1SDNA 4HEFA 4Y0OA 3LIBA 4MBFA 4EESA 5GLBA 5FASA 3ZGAB 1DP6A 3TSGA 4HOIA 4EQIA 5E2HA 3FWLA 1K0KA 2HDSA 5L10A 1LL5A 5CEDA 5TGFA 5CECA 2WGIA 1MC0A 1F98A 5EVLA 3S4XA 3UDIA 1FCMA 2V0WA 5EOEA 5DJUA 4K08A 1FSYA 3W4QA 4JGOA 5EPHA 3E98A 1OT9A 5CHJA 5TBMA 4ME4A 3G2YA 2Y2IA 1NRJA 4IVKA 3G35A 3BWLA 1E3UA 4ARZA 2WYXA 3IWOA 1H3QA 3K3DA 3E4OA 3IHBA 4ZBEA 2OAQ1 2W1TA 4NXEA 3FC7A 2L4RA 4FOFA 2WKRA 1TVFA 4JF4A 3HUMA 4KG5A 2VGLM 1CI9A 2W1TB 3BFFA 1K38A 1S1YA 2ZD8A 1F9IA 1HZOA 2HP5A 4IVIA 3ZHHA 4N1HA 3G4PA 3F1OB 4DRTA 1V9ZA 2A2LA 1OTAA 4OPYA 1RGZA 3IH9A 1YM1A 4F94A 3HLDA 4GOGA 3NOUC 3RTYA 1TD5A 3VE4A 4OLDA 1SZVA 5HPFA 2XLNA 3IWIA 4QY6A 4JXVA 3C38A 1T1CA 3S1YA 5G4ZA 3A3DA 3NDEA 4GDNA 4Y13A 4Y0TA 1CI8A 1K56A 2Y2NA 1TDLA 3C5AA 1N4OA 5AVEA 1FCNA 3H9WA 4WYYA 3UMEA 4NK3A 3KSGA 2JKTM 2PYPA 3MXSA 3N8SA 4BBUA 3GV9A 3V50A 1YLWA 1GHIA 4ZAMA 4HESA 3GDIA 3CZDA 4C3QA 2JCHA 1GSWA 3SZTA 5JYOA 2J80A 4KZ9A 4K0XA 3ITAA 4Y7PA 1ERQA 4DMZA
chains in the Genus database with same CATH topology
2W1RA 1N9OA 3KSHA 2R78A 5F68A 1OTEA 3UB6A 2MJ6A 3T4KA 5HWTA 3MFXA 4HQAA 4QPRA 2KX6A 3OBFA 5HZHA 3R7WA 4JGPA 3EOIA 4HIAA 5HDDA 2VV7A 1P9WA 1DP8A 3UB7A 2J3TC 3EEHA 2NUPC 4I5SA 4EUVA 2Y8HA 2VX8A 5C5KA 1XJ6A 4AFIA 2JKTI 5HPIA 5HSQA 3GECA 3DBAA 4HP9A 2O9BA 4CQHA 1ZHHB 5J7EA 2W0NA 1OPXA 3E4PA 3LI9A 3C2WA 3FG8A 4HP4A 1S67L 2JKRM 3TE8A 4WL9A 5AVFA 4YNRA 3D3OA 3EQUA 2QHKA 3T4LA 4NXGA 4H6JB 2W3EA 1T18A 4EW7A 4WEJA 3MJQA 4KUKA 1XJ3A 2O99A 2LB5A 3MR0A 3S7PA 3UB8A 1JNUA 4CLCA 1N9LA 4WN5A 3P7NA 4GJ4A 3LFVA 3LIEA 2Y79A 1H8MA 4E04A 4Y2FA 4O01A 5G4YA 1S66L 3OC2A 1XJ2A 3A0SA 4F3LA 2O9AA 2YKHA 5J3WA 2OOLA 3U2AA 4LRXC 3KO6A 4HI4A 3ULFA 4R3AA 4GS9B 3BY8A 4IUHA 4HHDA 1P97A 4I39A 1IFQA 1GSVA 2XRNA 3EGDC 5F69A 2K7SA 3BQAA 3IBRA 4Q0IA 1MZUA 4HY8A 2J3TD 4GCZA 1LSXA 2PR5A 3S7QA 4I3JA 4IUKA 1T1AA 3S7OA 3SW1A 4KQDA 3NJAA 3FPVA 4HJ3A 2PD7A 1OJGA 2ZOHA 2YKFA 1DP9A 4F3LB 2XA7S 2P7JA 1YSPA 4XT2A 4OOLA 3BQ8A 4YWZA 2ZMFA 1XFQA 4UEYA 2QJ7A 4DJ3A 3B47A 4R6LA 4CLCD 4PHTA 1T1BA 1MKMA 1OTIA 2VA0A 3E4QA 3T4OA 5KSHA 3IS2A 1OJ5A 3KYQA 2QWSA 4MN5A 3UE6A 4B93A 4GLQA 2GX5A 3LR5A 2IA2A 3IBJA 1XJ4A 1OTBA 2P08A 2DMWA 3H7WA 3OOVA 4EEUA 4EERA 3T4QA 3F1NB 2KLIA 1TS8A 2M7UA 4LRYC 2JN7A 4NXFA 5AJGA 3UMDA 2EWVA 3EEAA 3UB9A 3NOTC 2B02A 3RH8B 4WEKA 4MDZA 4NXBA 3MQQA 3H82A 4B9OA 4IJGA 3F1NA 3PR6A 4P6ZM 2VV6A 3V67A 1S1ZA 4YOFA 4MMNA 5IT5A 1TF1A 2VKSA 1OT6A 3IS2B 3CLOA 2G7UA 4R38A 3PBRA 3NHQA 4RQ9A 1VB6A 1G6OA 3G6OA 4HJ4A 2XSSA 4FSFA 4EQ1A 5DF9A 4II7A 5HD5A 3A0VA 2NUTC 2O0YA 5DFXA 5A8BA 4UQIM 3TRCA 1IOUA 3PXPA 5DKLA 2BASA 4GHIA 2VZWA 2GJ3A 4ETZA 2GZAA 1P0ZA 2ZBBA 2W3HA 5TBMB 1EW0A 3RFBA 2A24A 2V1BA 3EGXC 3CAXA 2V9AA 1GSXA 4WUJA 5KIZA 2QJ5A 5CX7A 2I9VA 3H82B 4G3VA 1Y28A 4I38A 3K3CA 3T4SA 3BJNA 3E0YA 5DKKA 1LSVA 4HNBA 1UGUA 3LR0A 3VE3A 3MF0A 4IHQA 2K2NA 2P04A 3K2NA 4XT2B 5TJJA 1S4SA 4G3WA 5HL6A 2HGVA 5LBRA 2PD8A 1VHMA 1W63M 4R70A 4UQIS 3LI8A 1T19A 3PBQA 4PAUA 2A24B 2PHYA 4BMWA 2H28A 4MN6A 5J4EA 2WKQA 2VEAA 3HCYA 5F5YA 1S4RA 4L9EA 2PDRA 2W3DA 3MMHA 4DJ2A 1UWPX 2W3GA 2VLGA 2XROA 4GS9A 5EFWA 4ZRRA 5L8MA 3C8CA 5HDSA 2HJ9C 2KOIA 1NWZA 5HDCA 2JHEA 4PKYA 4CLCE 4WELA 3VV4A 4P6ZS 3F1OA 1TS7A 3LICA 3ZYTA 5IU1A 3LIBA 3BY9A 3OLOA 1YAXA 4EESA 4Z1WA 1WA9A 1LT0A 1DP6A 2W3FA 4I3IA 4HOIA 4DN0A 1STZA 4CLCB 4WF0A 3OCNA 4PKYG 1DRMA 3CWFA 2W27A 4HH2A 3LIFA 4L9GA 4LPZA 1OTDA 3HJKA 2M1CA 1MC0A 1F98A 1X0OA 1G28A 3A0RA 3LIDA 2M7VA 3KSFA 3PBNA 2FH5A 2PT7A 2V0WA 3MQOA 4EETB 5DJUA 4O0PA 4K08A 2PYRA 3T50A 4CLCC 3JVVA 3T4TA 4JGOA 4OOMA 3NOPC 3E98A 1OT9A 2WKPA 4L9FA 3UE3A 5TBMA 5HWVA 4ME4A 1F5MA 3ICYA 2PR6A 3LUQA 4JGQA 2D02A 4NEED 1NRJA 4M4XA 1UWNX 3BWLA 4ARZA 3F1PA 1YSQA 4EU0A 1YKDA 3HJIA 1H3QA 2O9CA 1P9RA 1N9NA 3K3DA 3E4OA 4HH3A 1NLZA 2QKPA 4NKPA 4BBVA 2OAQ1 2W1TA 4NXEA 3FC7A 3T4JA 3C30A 3CUEC 1D7EA 2L4RA 5HWWA 1ZTUA 5I5LA 4FOFA 2WKRA 3KX0X 3MQ0A 4Y5FA 3TJZC 2OAP1 2VV8A 2J3WA 2VGLM 1V9YA 1BYWA 5MC7A 4MN7A 3LR3A 2INWA 4MCWA 2K31A 2W1TB 3BW6A 2EWWA 3LYXA 2VGLS 2D01A 2Z6CA 1S1YA 4EXOA 4BBTA 3EQVA 3H7WB 3JVUA 3VOLA 2KDKA 1F9IA 3PBOA 5K5BA 4ARZB 2OWHA 4BWIA 2GNXA 3F1OB 2Z6DA 2B18A 1TS0A 1V9ZA 1D06A 2A2LA 1OTAA 3CI6A 4Y3IA 2EA9A 2CMNA 4JGRA 2HJEA 4EEPA 3D72A 2HV1A 2QYBA 2XA7M 1W63Q 3EWKA 4L0LA 5DFYA 3R7WB 4KQOA 5DJTA 3R4KA 3NOUC 3RTYA 3PBSA 4H6JA 5F6AA 3PHYA 5HD3A 1TD5A 3LR4A 4LRZE 3VE4A 5HPFA 5IS1A 3PYPA 1KOUA 4BJPA 3LIAA 2V0UA 3C38A 1T1CA 4GW9A 5G4ZA 3OCLA 4LLOB 3O5YA 2FZ0A 3CUEA 4ETXA 3B33A 5FL3A 5AVEA 1LSWA 3FPWA 1XFNA 3F1PB 3H9WA 2VJWA 3UMEA 3KSGA 2JKTM 4WLAA 1NLYA 3ZQ5A 2PYPA 4BBUA 4HJ6A 3KSIA 1ODVA 2HF6A 2ZOIA 4G3KA 1LL8A 3MXQA 4KUOA 2OWJA 3GDIA 3PBTA 3CITA 1GSWA 3P01A 4Q0HA 2V1AA 2JKRI 4Q0JA 2LB9A 3KYZA 3TW8A 4GHIB 4O8GA 2J80A 2L0WA 2ZMVA 4I3AA 3B42A 3W2ZA 1TS6A 2L1MA 4DMZA 3S7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B93 A;  2NUP C;  3EGD C;  2NUT C;  4AFI A;  3EGX C;  3BW6 A;  1H8M A;  1IOU A;  1IFQ A;  3KYQ A;  2DMW A;  2VX8 A; 
#chains in the Genus database with same CATH topology
 1YLZ A;  3Q7V A;  3BM6 A;  1GA9 A;  3KSH A;  5F68 A;  5TR7 A;  4FD8 A;  1OTE A;  1L0F A;  2G2U A;  2MJ6 A;  4E3I A;  3BFE A;  3MFX A;  4A5R A;  4OPZ A;  5GHX A;  4JGP A;  2Q9M A;  4BEN A;  2RCX A;  3UB7 A;  2J3T C;  1K4F A;  3NCK A;  4I5S A;  5HAQ A;  4IBX A;  2Y8H A;  1PYY A;  1ZG4 A;  3GEC A;  1W79 A;  3ZVT A;  3NI9 A;  5J7E A;  2PU2 A;  4HBU A;  3C2W A;  1NRF A;  4YNR A;  2R9X A;  2Z2L B;  3BRM A;  3UB5 P;  2W3E A;  3WRT A;  3NBL A;  2EXB A;  3VOY A;  2XD1 A;  3LIE A;  2Y79 A;  2XFS A;  3FKV A;  1BT5 A;  1ONG A;  4O01 A;  1S66 L;  3BFC A;  1FOF A;  2WGW A;  3A3I A;  4IED A;  3SOI A;  4P0M A;  4F3L A;  1ERO A;  2O9A A;  5J3W A;  1ES4 A;  3U2A A;  4LRX C;  4OPQ A;  2Y4A A;  3KO6 A;  3B3X A;  3ULF A;  1I5Q A;  3BY8 A;  4HHD A;  2HDR A;  1P97 A;  3A3J A;  5GHZ A;  1GSV A;  2BLS A;  3IBR A;  1LSX A;  3HLC A;  3NJA A;  3FPV A;  1VM1 A;  1U60 A;  3QP8 A;  4R0Q A;  4DXB A;  2XA7 S;  5E2G A;  3QNB A;  1KDS A;  4OOL A;  3BQ8 A;  1Q2P A;  4DJ3 A;  4FUW A;  4S2M A;  2Q9N A;  5CTM A;  1YLT A;  3W4P A;  3ZCZ A;  3C4P A;  2DRW A;  1MKM A;  2P9V A;  1ESI A;  1OTI A;  4M3K A;  2VA0 A;  1AWI A;  4N92 A;  4S2K A;  3VP3 A;  1TEM A;  2QWS A;  1L0E A;  2Y2M A;  3OPP A;  1QMF A;  2GX5 A;  3LR5 A;  3ISG A;  3HLB A;  5EVI A;  3H7W A;  3T4Q A;  3F1N B;  2M7U A;  2EX9 A;  4LRY C;  3UMD A;  1EI5 A;  5E2F A;  3VP0 A;  3A3E A;  2B02 A;  3ZVW A;  2V8F A;  2X02 A;  2HP9 A;  3BLM A;  3F1N A;  4MBH A;  1FIK A;  2Y2J A;  2VV6 A;  5CGX A;  1WYC A;  3MZE A;  5FQK A;  3IXG A;  3CLO A;  4NET A;  1CF0 A;  3JYI A;  4HJ4 A;  1LHY A;  4PPR A;  1IYO A;  5IHV A;  5HD5 A;  4OQG A;  5A8B A;  4UQI M;  1ACF A;  5E43 A;  2GJ3 A;  1LI0 A;  3OPL A;  1P0Z A;  3RFB A;  2A24 A;  1NZO A;  1PNE A;  4WUJ A;  2V9A A;  1Z6F A;  2QJ5 A;  4R23 A;  3H82 B;  1NJ4 A;  1E3U D;  4I38 A;  3TOI A;  1JWZ A;  1LSV A;  4OH0 A;  4OQ0 A;  1H0M A;  1M6K A;  2EFX A;  5HL6 A;  5LBR A;  2PD8 A;  2PRF A;  4KQQ A;  2V20 A;  3NC8 A;  1W63 M;  4R70 A;  4UQI S;  5AQ9 A;  2PU4 A;  3ZNY A;  3PBQ A;  2QZ6 A;  4BMW A;  4MN6 A;  4GDB A;  1MBL A;  3HCY A;  5F82 A;  4KZA A;  3UE1 A;  4ESP A;  3MMH A;  4P87 A;  4Z9Q A;  1UWP X;  3V3S A;  1MY8 A;  2W3G A;  5A92 A;  4R4S A;  4KZ5 A;  3C8C A;  1JWV A;  1NWZ A;  3G30 A;  4PKY A;  3VV4 A;  3VFF A;  4X53 A;  1K57 C;  1TS7 A;  3F1O A;  3LIC A;  3ZYT A;  5IU1 A;  5EEC A;  1FSW A;  3IX4 A;  1JTD A;  4I3I A;  3LEZ A;  4WF0 A;  4GB7 A;  4IBR A;  2HZ5 A;  2W27 A;  3LIF A;  4L9G A;  1JWP A;  4LPZ A;  1OTD A;  2M1C A;  1G28 A;  1X0O A;  3LID A;  5FQI A;  1HLU P;  4BQM A;  1YT4 A;  2FH5 A;  2ZL1 B;  4CLC C;  3T4T A;  2OLV A;  3NOP C;  4EBP A;  3V3R A;  2WKP A;  5GHY A;  5HWV A;  2H0Y A;  4NEE D;  1Q2Q A;  5BOH A;  4U0T A;  4GN2 A;  4MLL A;  3M2J A;  2ZJ9 A;  3C4O A;  4NKP A;  5L2F A;  3MZD A;  4QD4 A;  1ES2 A;  5EM1 A;  1NYM A;  4OQH A;  3TJZ C;  2J3W A;  3HLF A;  1V9Y A;  5AQB A;  3NY4 A;  5GLA A;  1DJA A;  2XGN A;  2INW A;  3ZG8 B;  2K31 A;  4DDY A;  4EWF A;  2KDK A;  1DJC A;  4KZ6 A;  2GNX A;  2Z6D A;  4EBL A;  2B18 A;  5F1F A;  4FCF A;  4DE1 A;  1BLC A;  1Y54 A;  3JPU A;  4LCL A;  2CMN A;  4JGR A;  3UN7 A;  1BTL A;  4EEP A;  2HV1 A;  4OP5 A;  1YMX A;  4L0L A;  3EWK A;  4X1L A;  5DFY A;  1ZG6 A;  3PBS A;  3SS4 A;  4GNU A;  5HD3 A;  5F6A A;  4JXG A;  2JKG A;  2ZQA A;  4EV4 A;  3LR4 A;  4LRZ E;  3M6H A;  3IT9 A;  3IF6 A;  3UPN A;  2P9V B;  3LIA A;  1KVM A;  3HUO A;  2EX2 A;  3IHA A;  3O5Y A;  1L0G A;  3CUE A;  4ETX A;  5FL3 A;  1XA1 A;  4KG6 A;  1ESU A;  3F1P B;  2VJW A;  4S2P A;  1K57 A;  4HJ6 A;  5CXW A;  5L09 A;  4G3K A;  1K6R A;  4KUO A;  2OWJ A;  2V2F F;  4GKU A;  3M2K A;  5KZH A;  1W5D A;  4Q0J A;  3D9Y A;  2LB9 A;  4O8G A;  1KDW A;  1KE4 A;  4I3A A;  3B42 A;  2XEP A;  1TS6 A;  4OQI A;  3CHW P;  2V8C A;  4B4Z A;  1IYP A;  4KQR A;  4X56 A;  3RXX A;  4QY5 A;  3WS1 A;  1KVL A;  1M40 A;  4BLM A;  4X55 A;  5FSR A;  3RXW A;  3MZF A;  3OBF A;  3R7W A;  1SCW A;  3CPT A;  1ZKJ A;  2WZX A;  1W8Q A;  1NYY A;  3W4O A;  2Y2G A;  1PW8 A;  2NUP C;  2EX6 A;  5HAI A;  4AFI A;  5HPI A;  1VQQ A;  3DWK A;  3DBA A;  1KGF A;  4HP9 A;  2O9B A;  2H0T A;  1OPX A;  1H8Y A;  2WKI A;  3LI9 A;  3N8R A;  3FG8 A;  2UV0 E;  1S67 L;  3TE8 A;  3OPH A;  1IYS A;  3D3O A;  3EQU A;  4PM8 A;  3VMA A;  4LEN A;  2ZQC A;  1BLS A;  3N6I A;  4K91 A;  2Y55 A;  5TFQ A;  4E6W A;  4WEJ A;  3DW0 A;  4JF6 A;  4DF6 A;  1XJ3 A;  3Q1F A;  3CPT B;  3UB8 A;  4CLC A;  1N9L A;  4U0X A;  3NUL A;  5FI6 A;  5EM0 A;  4WBG A;  4S2L A;  3OC2 A;  2GDN A;  3O86 A;  4R1G A;  2ZMA A;  4H8R A;  3UPO A;  3GR2 A;  2OOL A;  4LV2 A;  5HAP A;  4OLG A;  4Y17 A;  4R3A A;  4GS9 B;  3QP6 A;  2VGK A;  3BYD A;  4I39 A;  1GCE A;  3EGD C;  5FDH A;  1GHM A;  1VET B;  4HY8 A;  1SHV A;  4I3J A;  1T1A A;  2H10 A;  1OJG A;  2ZOH A;  2YKF A;  2X01 A;  4KZ4 A;  5KSC A;  2P7J A;  1YSP A;  4E3L A;  1DY6 A;  5FDS A;  4YWZ A;  4WMC A;  1PI5 A;  2ZMF A;  4B88 A;  4PHT A;  5CHU A;  2DCF A;  1D1J A;  3E4Q A;  5KSH A;  3IS2 A;  4C75 A;  3O87 A;  2XD5 A;  4UAA A;  2V1Z A;  4MN5 A;  4GLQ A;  4S2O A;  2IA2 A;  1CEG A;  2P08 A;  3CJM A;  4EER A;  3HRE A;  2WGV A;  2KLI A;  1YPR A;  1TS8 A;  2WGW B;  4BL3 A;  3EEA A;  1OME A;  3FV7 A;  1W7F A;  3UNW A;  4WEK A;  4MDZ A;  4QJG A;  4XUZ A;  3H82 A;  4B9O A;  4PMA A;  2QMI A;  2ZQ8 A;  4OON A;  3V67 A;  2WKH A;  4OP8 A;  3AGF A;  1OT6 A;  4WZ5 C;  3IS2 B;  2G7U A;  1F2K A;  1PWC A;  1VB6 A;  1G6O A;  1CEF A;  4Q8I A;  5A91 A;  4CJN A;  2J7V A;  2ZM2 A;  4Y0U A;  2NUT C;  3ZFZ A;  2O0Y A;  5DFX A;  2WK0 A;  2C6W B;  3PXP A;  1ES5 A;  2VZW A;  2WAD A;  4O7D A;  5TBM B;  1J3W A;  1MWR A;  2J8Y A;  2ZQ7 A;  5KIZ A;  5CX7 A;  3T4S A;  4JPM A;  4HNB A;  1UGU A;  3UE0 A;  2ZC7 A;  3MF0 A;  3BFG A;  4GZB A;  2K2N A;  2P04 A;  3CG5 A;  4XT2 B;  5EVE A;  4K0W A;  3UO9 A;  1T19 A;  3MFD A;  3L7H A;  4UHU A;  4PM6 A;  2PAV P;  3C7U A;  3T1X A;  5EV0 A;  3IX3 A;  1J9M A;  4L9E A;  2E8J A;  2W3D A;  4BD0 A;  2XRO A;  1I2S A;  4GS9 A;  2XH9 A;  3C7V A;  4X68 A;  5L8M A;  1H8Z A;  2HJ9 C;  2KOI A;  2Y91 A;  2JHE A;  4CLC E;  4WEL A;  4DDS A;  3BY9 A;  3OLO A;  1YAX A;  3VSL A;  3O88 A;  5CGW A;  2W3F A;  5FAQ A;  2BTF P;  4E3K A;  3UDF A;  4E3M A;  3OCN A;  1ES3 A;  4E6X A;  1SKO A;  1H5X A;  1SDE A;  5EUA A;  3PBN A;  4EET B;  4BD1 A;  2PBD P;  2PYR A;  3T50 A;  4OOM A;  3O3V A;  3N4I A;  4HBT A;  4ZJ2 A;  1F5M A;  2PR6 A;  4M4X A;  4WZ5 A;  3F1P A;  1YSQ A;  1PW1 A;  1YKD A;  2JKF A;  2UWX A;  5DVA A;  4DE0 A;  4N1X A;  1ALQ A;  3C30 A;  4R3J A;  1D7E A;  1K4E A;  3W8K A;  5AQ7 A;  3ZDJ A;  1ZTU A;  4Y5F A;  4PM9 A;  3MQ0 A;  1PI4 A;  1Z09 A;  4MN7 A;  5MC7 A;  3LR3 A;  4MCW A;  3BW6 A;  2XK1 A;  2EWW A;  3LYX A;  2D01 A;  2OV5 A;  4ID4 A;  4EXO A;  3CMZ A;  1CQA A;  4ARZ B;  2OWH A;  4BWI A;  1PWD A;  3WWX A;  1MXO A;  5A90 A;  1TS0 A;  1D06 A;  5DTT A;  3CI6 A;  5FI7 A;  4Y3I A;  3LEQ A;  2EA9 A;  1HVB A;  2HJE A;  5M1A A;  2IWC A;  3D72 A;  1FR6 A;  3R7W B;  2QYB A;  2XA7 M;  1W63 Q;  4KQO A;  3UPP A;  5DJT A;  4H6J A;  3PHY A;  3HLW A;  4Y15 A;  1XGJ A;  3MBZ A;  1XX2 A;  5IS1 A;  1XGI A;  3PYP A;  4BJP A;  1XA7 A;  2V0U A;  4OVD A;  3Q7V B;  3OCL A;  3NEC A;  1C3B A;  3B33 A;  5EVI D;  1LSW A;  3FPW A;  1BLH A;  2WKE A;  4GD6 A;  4QWO A;  4P85 A;  1LL9 A;  1ODV A;  2HF6 A;  2ZOI A;  2ZQ9 A;  1LL8 A;  3MXQ A;  4JLF A;  4WZ4 A;  4JXW A;  3CIT A;  4Q0H A;  3N8L A;  4LV0 A;  4KG2 A;  3E2L A;  4LV3 A;  1KGE A;  5AQA A;  3DTI A;  4ZJ3 A;  3KYZ A;  4GHI B;  2ZMV A;  3IXH A;  1G5U A;  2CC1 A;  3W2Z A;  2L1M A;  3GMW A;  3S7N A;  5HX9 A;  4D2O A;  5I94 A;  2W1R A;  2EX8 A;  1K54 C;  1N9B A;  4WMC D;  5HWT A;  5CHM A;  4DXC A;  3I7J A;  4WM9 A;  3SH8 A;  2OSU A;  3EOI A;  1RCJ A;  2VV7 A;  1P9W A;  3QP1 A;  1DP8 A;  3LCE A;  4CPK A;  4PM5 A;  4EUV A;  3WS2 A;  2VX8 A;  5DF7 A;  5C5K A;  1BZA A;  5HSQ A;  3ZNT A;  1ZHH B;  2J9P A;  3E4P A;  4RX2 A;  1RP5 A;  2J9O A;  5AVF A;  3T4L A;  4R4R A;  1HD8 A;  4NXG A;  4H6J B;  2ZC6 B;  2Y2L A;  1K25 A;  3BLS A;  4EW7 A;  5HAR A;  1TDG A;  3MJQ A;  4KUK A;  3IXD A;  1JVJ A;  3WS4 A;  2O99 A;  3MR0 A;  5CGS A;  2ZLY A;  4LCM A;  4GJ4 A;  3LFV A;  1I2W A;  4MBK A;  1MWU A;  1H8M A;  4E04 A;  3WRZ A;  1KE0 A;  1YLY A;  3A0S A;  4YFM A;  2YKH A;  1IEM A;  3ZG9 B;  2WZZ A;  1CK3 A;  5EVI C;  2Y2H A;  2HPB A;  1HTZ A;  1YLJ A;  4OPR A;  2AVX A;  4BL2 A;  3SH7 A;  4LFU A;  1IEL A;  3BQA A;  3T1S A;  1FCO A;  1MZU A;  2J3T D;  4GCZ A;  2PR5 A;  3S7Q A;  4IUK A;  3QP2 A;  1K55 A;  4S2N C;  3ZG5 A;  3D4F A;  4EUZ A;  3ZG0 A;  3IF6 B;  1S6R A;  1XFQ A;  4UEY A;  2QJ7 A;  5GL9 A;  2Y59 A;  3VP4 A;  1T1B A;  1LLB A;  1AXB A;  2Y2K A;  3T4O A;  5A93 A;  3KYQ A;  1NXY A;  3MKE A;  3IBJ A;  1JTG A;  2DMW A;  4QB8 A;  5F83 A;  4EEU A;  3PAG A;  2G2W A;  3NOT C;  4KZ3 A;  5KMW A;  5EOO A;  3VOZ A;  4NXB A;  1MWS A;  4P6Z M;  5HFO A;  3LGO A;  1S1Z A;  5G18 A;  1E25 A;  5FAP A;  4YOF A;  5IT5 A;  4NG2 A;  1YMS A;  3NHQ A;  2C5W B;  4FSF A;  4EQ1 A;  4II7 A;  3IXB A;  4JKT A;  4OOY A;  1L2S A;  1NZU A;  3QNC A;  1IOU A;  2BAS A;  1E4D A;  4ETZ A;  2IWB A;  3G34 A;  2GZA A;  4U3T A;  1WE4 A;  2W3H A;  1EW0 A;  1O07 A;  3LY3 A;  4UA9 A;  3DTE A;  5M19 A;  3OPR A;  3CAX A;  3VP1 A;  2I9V A;  4FTX A;  3MKF A;  2B5R A;  3BJN A;  2ZQD A;  3Q81 A;  1PWG A;  1QME A;  4YIN A;  3VE3 A;  4OKP A;  5TJJ A;  4UA6 A;  5CRF A;  4G3W A;  2HGV A;  3S22 A;  1G6A A;  3FYZ A;  1VHM A;  5FEG A;  3UDX A;  3IF5 A;  4LGW A;  1FQG A;  4E3N A;  3NDG A;  4ZDX A;  4PAU A;  2A24 B;  2PHY A;  2H28 A;  3L9K A;  3PTE A;  4UA7 A;  2VEA A;  1G68 A;  5F5Y A;  1S4R A;  1PZP A;  3WS5 A;  2B95 A;  4DJ2 A;  2VLG A;  5FQM A;  5EFW A;  3DTK A;  5HDS A;  1YLP A;  2ZC4 B;  2EXA A;  4RVA A;  5HDC A;  2R9W A;  4P6Z S;  4Z1W A;  5F1G A;  1LI9 A;  1LT0 A;  1WA9 A;  2FFF B;  3GSG A;  5HL1 A;  3T1Q B;  1CJF A;  1FR1 A;  4DN0 A;  1STZ A;  4CLC B;  1VEU A;  3V39 A;  1IKI A;  3G31 A;  5FQJ A;  4PKY G;  1DRM A;  3HBR A;  4X6T A;  2HDQ A;  3CWF A;  2ZC3 B;  5FQ9 A;  4HH2 A;  3WS0 A;  3HJK A;  3A0R A;  2M7V A;  3KSF A;  3QHY A;  2IWD A;  3VFH A;  2PT7 A;  5FA7 A;  3MQO A;  4O0P A;  4MNR A;  3JVV A;  5D3O A;  1K54 A;  4L9F A;  3UE3 A;  3ICY A;  4JGQ A;  3LUQ A;  3V5M A;  2D02 A;  2ZM8 A;  1UWN X;  3DTM A;  4EU0 A;  3HJI A;  2O9C A;  3N7W A;  3QP4 A;  1P9R A;  4XUX A;  1N9N A;  4HH3 A;  1NLZ A;  2QKP A;  4BBV A;  4D60 A;  4KEN B;  1RGY A;  3T4J A;  3KYE A;  3HLG A;  3CUE C;  5HWW A;  3MXR A;  5I5L A;  5FAT A;  3KX0 X;  2ZC5 B;  2OAP 1;  2VV8 A;  3IQA A;  3ITB A;  4S2J A;  1BYW A;  1SKF A;  3U4L P;  2WUQ A;  1Y4O A;  2VGL S;  2Z6C A;  4BBT A;  3EQV A;  3TG9 A;  3H7W B;  3IH8 A;  3JVU A;  3VOL A;  3M6B A;  3PBO A;  2HP6 A;  2P74 A;  5K5B A;  1BLP A;  2XR0 A;  3QP5 A;  5GLC A;  3VSK A;  2A49 A;  3E2K A;  4KZ8 A;  1PIO A;  4P6B A;  4KZ7 A;  2XFT A;  3R4K A;  2X71 A;  1L0D A;  4R3B A;  3Q07 A;  3VP2 A;  1KOU A;  1EWZ A;  1XPB A;  4GW9 A;  3P98 A;  4LLO B;  3GRJ A;  4B4X A;  4X25 A;  2FZ0 A;  3NIA A;  4FH4 A;  5HW3 A;  5DTS A;  1XFN A;  4X1M A;  4WLA A;  1NLY A;  3ZQ5 A;  3KSI A;  4DE2 A;  3GTC A;  3PBT A;  3G2Z A;  1K55 C;  1WYB A;  4ZJ1 A;  2Y2O A;  3LO7 A;  3P01 A;  2E8I A;  4XXR A;  1IYQ A;  2WAF A;  2V1A A;  2JKR I;  4DKI A;  1MPL A;  1PZO A;  3TW8 A;  2OLU A;  2L0W A;  4FH2 A;  2ACG A;  5CTN A;  3UY6 A;  5L07 A;  3SS3 A;  3G32 A;  2A3U A;  1N9O A;  4KZB A;  4JF5 A;  1BSG A;  2R78 A;  3UB6 A;  3HUN A;  3T4K A;  2PBY A;  4HQA A;  4PM7 A;  1L3L A;  4QPR A;  2KX6 A;  5HZH A;  4GD8 A;  4HIA A;  5HDD A;  3AGD A;  3EEH A;  1ERM A;  2HDU A;  4RA7 A;  1W8Y A;  1XJ6 A;  3MSH A;  2JKT I;  3BEC A;  1GA0 A;  2Q0O A;  4CQH A;  2W0N A;  2H5S A;  4S2N A;  1GHP A;  4HP4 A;  2JKR M;  4WL9 A;  5GLD A;  1VET A;  4RYE A;  2QHK A;  3IX8 A;  1ONH A;  1T18 A;  2LB5 A;  3S7P A;  1JNU A;  2EFU A;  4WN5 A;  3P7N A;  3SH9 A;  1YQS A;  2XDM A;  4Y2F A;  3BEB A;  5G4Y A;  1A0K A;  3HVF A;  1XJ2 A;  3BFD A;  1K56 D;  1BUL A;  4MEZ A;  1XKZ A;  4HI4 A;  4IUH A;  5CER A;  2DNS A;  2VGJ A;  1IFQ A;  5M18 A;  1SKO B;  2XRN A;  2JE5 A;  3HL9 A;  5DTK A;  5F69 A;  2K7S A;  2JBF A;  4Q0I A;  3FKW A;  3DAV A;  3T12 B;  1NY0 A;  4ZTK A;  3S7O A;  3SW1 A;  3AGE A;  4KQD A;  3RJU A;  3DWZ A;  5DF8 A;  2VK3 A;  4HJ3 A;  2PD7 A;  1DP9 A;  4F3L B;  1IKG A;  4XT2 A;  5CEB A;  3IWQ A;  1KGG A;  3LY4 A;  4EBN A;  1ZC2 A;  5FAO A;  3B47 A;  4LV1 A;  5J8X A;  3P09 A;  4R6L A;  4CLC D;  1PFL A;  2ZL1 A;  2FFY A;  2Z2M B;  2Y2P A;  2JC7 A;  1OJ5 A;  4N9K A;  3UE6 A;  4B93 A;  5FEF A;  1KE3 A;  4S2I A;  1XJ4 A;  1OTB A;  1VEU B;  1DJB A;  2ZM0 A;  3OZH A;  3OOV A;  3Q7Z A;  3PAE A;  2XQZ A;  4JBF A;  3ZG7 B;  2JN7 A;  4NXF A;  5AJG A;  2EWV A;  3UB9 A;  3RH8 B;  3MQQ A;  2WAE A;  4IJG A;  3GVB A;  2Y2Q A;  3PR6 A;  1MWT A;  2BG1 A;  4C6Y A;  3MS6 A;  5JYP A;  4MMN A;  3IF6 C;  4QHC A;  1TF1 A;  2VKS A;  4R38 A;  1FIL A;  3PBR A;  4N9L A;  1S0W A;  4RQ9 A;  3G6O A;  2XSS A;  1XXM A;  5DF9 A;  3Q82 A;  3A0V A;  5EVI B;  3HLE A;  4JXS A;  3A3F A;  3TRC A;  5DKL A;  4GHI A;  1BUE A;  1PRQ A;  2ZBB A;  4RX3 A;  2V1B A;  3EGX C;  3FZC A;  1GSX A;  4G3V A;  1Y28 A;  2XF3 A;  4E3J A;  3K3C A;  3E0Y A;  5DKK A;  4DE3 A;  3LR0 A;  4IHQ A;  3K2N A;  1S4S A;  3GQZ A;  2I72 A;  4X69 A;  5EE8 A;  1O7E A;  3SS5 A;  5E2E A;  3LI8 A;  1K6S A;  3T1R A;  5J4E A;  2WKQ A;  1XP4 A;  2RL3 A;  2PDR A;  4QU3 A;  2QPN A;  5FQQ A;  1MKI A;  5FI2 A;  4E3O A;  5U47 A;  4ZRR A;  1SDN A;  4HEF A;  4Y0O A;  3LIB A;  4MBF A;  4EES A;  5GLB A;  5FAS A;  3ZGA B;  1DP6 A;  3TSG A;  4HOI A;  4EQI A;  5E2H A;  3FWL A;  1K0K A;  2HDS A;  5L10 A;  1LL5 A;  5CED A;  5TGF A;  5CEC A;  2WGI A;  1MC0 A;  1F98 A;  5EVL A;  3S4X A;  3UDI A;  1FCM A;  2V0W A;  5EOE A;  5DJU A;  4K08 A;  1FSY A;  3W4Q A;  4JGO A;  5EPH A;  3E98 A;  1OT9 A;  5CHJ A;  5TBM A;  4ME4 A;  3G2Y A;  2Y2I A;  1NRJ A;  4IVK A;  3G35 A;  3BWL A;  1E3U A;  4ARZ A;  2WYX A;  3IWO A;  1H3Q A;  3K3D A;  3E4O A;  3IHB A;  4ZBE A;  2OAQ 1;  2W1T A;  4NXE A;  3FC7 A;  2L4R A;  4FOF A;  2WKR A;  1TVF A;  4JF4 A;  3HUM A;  4KG5 A;  2VGL M;  1CI9 A;  2W1T B;  3BFF A;  1K38 A;  1S1Y A;  2ZD8 A;  1F9I A;  1HZO A;  2HP5 A;  4IVI A;  3ZHH A;  4N1H A;  3G4P A;  3F1O B;  4DRT A;  1V9Z A;  2A2L A;  1OTA A;  4OPY A;  1RGZ A;  3IH9 A;  1YM1 A;  4F94 A;  3HLD A;  4GOG A;  3NOU C;  3RTY A;  1TD5 A;  3VE4 A;  4OLD A;  1SZV A;  5HPF A;  2XLN A;  3IWI A;  4QY6 A;  4JXV A;  3C38 A;  1T1C A;  3S1Y A;  5G4Z A;  3A3D A;  3NDE A;  4GDN A;  4Y13 A;  4Y0T A;  1CI8 A;  1K56 A;  2Y2N A;  1TDL A;  3C5A A;  1N4O A;  5AVE A;  1FCN A;  3H9W A;  4WYY A;  3UME A;  4NK3 A;  3KSG A;  2JKT M;  2PYP A;  3MXS A;  3N8S A;  4BBU A;  3GV9 A;  3V50 A;  1YLW A;  1GHI A;  4ZAM A;  4HES A;  3GDI A;  3CZD A;  4C3Q A;  2JCH A;  1GSW A;  3SZT A;  5JYO A;  2J80 A;  4KZ9 A;  4K0X A;  3ITA A;  4Y7P A;  1ERQ A;  4DMZ A; 
#chains in the Genus database with same CATH homology
 2W1R A;  1N9O A;  3KSH A;  2R78 A;  5F68 A;  1OTE A;  3UB6 A;  2MJ6 A;  3T4K A;  5HWT A;  3MFX A;  4HQA A;  4QPR A;  2KX6 A;  3OBF A;  5HZH A;  3R7W A;  4JGP A;  3EOI A;  4HIA A;  5HDD A;  2VV7 A;  1P9W A;  1DP8 A;  3UB7 A;  2J3T C;  3EEH A;  2NUP C;  4I5S A;  4EUV A;  2Y8H A;  2VX8 A;  5C5K A;  1XJ6 A;  4AFI A;  2JKT I;  5HPI A;  5HSQ A;  3GEC A;  3DBA A;  4HP9 A;  2O9B A;  4CQH A;  1ZHH B;  5J7E A;  2W0N A;  1OPX A;  3E4P A;  3LI9 A;  3C2W A;  3FG8 A;  4HP4 A;  1S67 L;  2JKR M;  3TE8 A;  4WL9 A;  5AVF A;  4YNR A;  3D3O A;  3EQU A;  2QHK A;  3T4L A;  4NXG A;  4H6J B;  2W3E A;  1T18 A;  4EW7 A;  4WEJ A;  3MJQ A;  4KUK A;  1XJ3 A;  2O99 A;  2LB5 A;  3MR0 A;  3S7P A;  3UB8 A;  1JNU A;  4CLC A;  1N9L A;  4WN5 A;  3P7N A;  4GJ4 A;  3LFV A;  3LIE A;  2Y79 A;  1H8M A;  4E04 A;  4Y2F A;  4O01 A;  5G4Y A;  1S66 L;  3OC2 A;  1XJ2 A;  3A0S A;  4F3L A;  2O9A A;  2YKH A;  5J3W A;  2OOL A;  3U2A A;  4LRX C;  3KO6 A;  4HI4 A;  3ULF A;  4R3A A;  4GS9 B;  3BY8 A;  4IUH A;  4HHD A;  1P97 A;  4I39 A;  1IFQ A;  1GSV A;  2XRN A;  3EGD C;  5F69 A;  2K7S A;  3BQA A;  3IBR A;  4Q0I A;  1MZU A;  4HY8 A;  2J3T D;  4GCZ A;  1LSX A;  2PR5 A;  3S7Q A;  4I3J A;  4IUK A;  1T1A A;  3S7O A;  3SW1 A;  4KQD A;  3NJA A;  3FPV A;  4HJ3 A;  2PD7 A;  1OJG A;  2ZOH A;  2YKF A;  1DP9 A;  4F3L B;  2XA7 S;  2P7J A;  1YSP A;  4XT2 A;  4OOL A;  3BQ8 A;  4YWZ A;  2ZMF A;  1XFQ A;  4UEY A;  2QJ7 A;  4DJ3 A;  3B47 A;  4R6L A;  4CLC D;  4PHT A;  1T1B A;  1MKM A;  1OTI A;  2VA0 A;  3E4Q A;  3T4O A;  5KSH A;  3IS2 A;  1OJ5 A;  3KYQ A;  2QWS A;  4MN5 A;  3UE6 A;  4B93 A;  4GLQ A;  2GX5 A;  3LR5 A;  2IA2 A;  3IBJ A;  1XJ4 A;  1OTB A;  2P08 A;  2DMW A;  3H7W A;  3OOV A;  4EEU A;  4EER A;  3T4Q A;  3F1N B;  2KLI A;  1TS8 A;  2M7U A;  4LRY C;  2JN7 A;  4NXF A;  5AJG A;  3UMD A;  2EWV A;  3EEA A;  3UB9 A;  3NOT C;  2B02 A;  3RH8 B;  4WEK A;  4MDZ A;  4NXB A;  3MQQ A;  3H82 A;  4B9O A;  4IJG A;  3F1N A;  3PR6 A;  4P6Z M;  2VV6 A;  3V67 A;  1S1Z A;  4YOF A;  4MMN A;  5IT5 A;  1TF1 A;  2VKS A;  1OT6 A;  3IS2 B;  3CLO A;  2G7U A;  4R38 A;  3PBR A;  3NHQ A;  4RQ9 A;  1VB6 A;  1G6O A;  3G6O A;  4HJ4 A;  2XSS A;  4FSF A;  4EQ1 A;  5DF9 A;  4II7 A;  5HD5 A;  3A0V A;  2NUT C;  2O0Y A;  5DFX A;  5A8B A;  4UQI M;  3TRC A;  1IOU A;  3PXP A;  5DKL A;  2BAS A;  4GHI A;  2VZW A;  2GJ3 A;  4ETZ A;  2GZA A;  1P0Z A;  2ZBB A;  2W3H A;  5TBM B;  1EW0 A;  3RFB A;  2A24 A;  2V1B A;  3EGX C;  3CAX A;  2V9A A;  1GSX A;  4WUJ A;  5KIZ A;  2QJ5 A;  5CX7 A;  2I9V A;  3H82 B;  4G3V A;  1Y28 A;  4I38 A;  3K3C A;  3T4S A;  3BJN A;  3E0Y A;  5DKK A;  1LSV A;  4HNB A;  1UGU A;  3LR0 A;  3VE3 A;  3MF0 A;  4IHQ A;  2K2N A;  2P04 A;  3K2N A;  4XT2 B;  5TJJ A;  1S4S A;  4G3W A;  5HL6 A;  2HGV A;  5LBR A;  2PD8 A;  1VHM A;  1W63 M;  4R70 A;  4UQI S;  3LI8 A;  1T19 A;  3PBQ A;  4PAU A;  2A24 B;  2PHY A;  4BMW A;  2H28 A;  4MN6 A;  5J4E A;  2WKQ A;  2VEA A;  3HCY A;  5F5Y A;  1S4R A;  4L9E A;  2PDR A;  2W3D A;  3MMH A;  4DJ2 A;  1UWP X;  2W3G A;  2VLG A;  2XRO A;  4GS9 A;  5EFW A;  4ZRR A;  5L8M A;  3C8C A;  5HDS A;  2HJ9 C;  2KOI A;  1NWZ A;  5HDC A;  2JHE A;  4PKY A;  4CLC E;  4WEL A;  3VV4 A;  4P6Z S;  3F1O A;  1TS7 A;  3LIC A;  3ZYT A;  5IU1 A;  3LIB A;  3BY9 A;  3OLO A;  1YAX A;  4EES A;  4Z1W A;  1WA9 A;  1LT0 A;  1DP6 A;  2W3F A;  4I3I A;  4HOI A;  4DN0 A;  1STZ A;  4CLC B;  4WF0 A;  3OCN A;  4PKY G;  1DRM A;  3CWF A;  2W27 A;  4HH2 A;  3LIF A;  4L9G A;  4LPZ A;  1OTD A;  3HJK A;  2M1C A;  1MC0 A;  1F98 A;  1X0O A;  1G28 A;  3A0R A;  3LID A;  2M7V A;  3KSF A;  3PBN A;  2FH5 A;  2PT7 A;  2V0W A;  3MQO A;  4EET B;  5DJU A;  4O0P A;  4K08 A;  2PYR A;  3T50 A;  4CLC C;  3JVV A;  3T4T A;  4JGO A;  4OOM A;  3NOP C;  3E98 A;  1OT9 A;  2WKP A;  4L9F A;  3UE3 A;  5TBM A;  5HWV A;  4ME4 A;  1F5M A;  3ICY A;  2PR6 A;  3LUQ A;  4JGQ A;  2D02 A;  4NEE D;  1NRJ A;  4M4X A;  1UWN X;  3BWL A;  4ARZ A;  3F1P A;  1YSQ A;  4EU0 A;  1YKD A;  3HJI A;  1H3Q A;  2O9C A;  1P9R A;  1N9N A;  3K3D A;  3E4O A;  4HH3 A;  1NLZ A;  2QKP A;  4NKP A;  4BBV A;  2OAQ 1;  2W1T A;  4NXE A;  3FC7 A;  3T4J A;  3C30 A;  3CUE C;  1D7E A;  2L4R A;  5HWW A;  1ZTU A;  5I5L A;  4FOF A;  2WKR A;  3KX0 X;  3MQ0 A;  4Y5F A;  3TJZ C;  2OAP 1;  2VV8 A;  2J3W A;  2VGL M;  1V9Y A;  1BYW A;  5MC7 A;  4MN7 A;  3LR3 A;  2INW A;  4MCW A;  2K31 A;  2W1T B;  3BW6 A;  2EWW A;  3LYX A;  2VGL S;  2D01 A;  2Z6C A;  1S1Y A;  4EXO A;  4BBT A;  3EQV A;  3H7W B;  3JVU A;  3VOL A;  2KDK A;  1F9I A;  3PBO A;  5K5B A;  4ARZ B;  2OWH A;  4BWI A;  2GNX A;  3F1O B;  2Z6D A;  2B18 A;  1TS0 A;  1V9Z A;  1D06 A;  2A2L A;  1OTA A;  3CI6 A;  4Y3I A;  2EA9 A;  2CMN A;  4JGR A;  2HJE A;  4EEP A;  3D72 A;  2HV1 A;  2QYB A;  2XA7 M;  1W63 Q;  3EWK A;  4L0L A;  5DFY A;  3R7W B;  4KQO A;  5DJT A;  3R4K A;  3NOU C;  3RTY A;  3PBS A;  4H6J A;  5F6A A;  3PHY A;  5HD3 A;  1TD5 A;  3LR4 A;  4LRZ E;  3VE4 A;  5HPF A;  5IS1 A;  3PYP A;  1KOU A;  4BJP A;  3LIA A;  2V0U A;  3C38 A;  1T1C A;  4GW9 A;  5G4Z A;  3OCL A;  4LLO B;  3O5Y A;  2FZ0 A;  3CUE A;  4ETX A;  3B33 A;  5FL3 A;  5AVE A;  1LSW A;  3FPW A;  1XFN A;  3F1P B;  3H9W A;  2VJW A;  3UME A;  3KSG A;  2JKT M;  4WLA A;  1NLY A;  3ZQ5 A;  2PYP A;  4BBU A;  4HJ6 A;  3KSI A;  1ODV A;  2HF6 A;  2ZOI A;  4G3K A;  1LL8 A;  3MXQ A;  4KUO A;  2OWJ A;  3GDI A;  3PBT A;  3CIT A;  1GSW A;  3P01 A;  4Q0H A;  2V1A A;  2JKR I;  4Q0J A;  2LB9 A;  3KYZ A;  3TW8 A;  4GHI B;  4O8G A;  2J80 A;  2L0W A;  2ZMV A;  4I3A A;  3B42 A;  3W2Z A;  1TS6 A;  2L1M A;  4DMZ A;  3S7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...