1IFVA

Crystal structure of pathogenesis-related protein llpr10.1b from yellow lupine
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
155
structure length
155
Chain Sequence
GVFAFEDEHPSAVAQAKLFKALTKDSDDIIPKVIEQIQSVEIVEGNGGPGTVKKITASHGGHTSYVLHKIDAIDEASFEYNYSIVGGTGLDESLEKITFESKLLSGPDGGSIGKIKVKFHTKGDVLSDAVREEAKARGTGLFKAVEGYVLANPNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN LLR18B
publication title Crystal structures of two homologous pathogenesis-related proteins from yellow lupine.
pubmed doi rcsb
source organism Lupinus luteus
molecule tags Allergen
total genus 38
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 1ifvA00
4A88A 1Z94A 2N4AA 4MNSA 5E4BA 4DSCA 1ZXFA 2NS9A 4N3EA 4JDAA 3NI8A 2E3PA 2KF2A 1FSKA 3E85A 2REZA 4MA6A 2R55A 2EJXA 3IJTA 3Q6AA 4REHA 3OQUA 4A81A 2LDKA 2L65A 3W9KA 5C9YA 1T17A 3NR4A 4IGXA 5JO1A 1UW5A 1E09A 3K90A 3H3TA 4RYVA 4A87A 4A8UA 3NEFA 2PSOA 3CNWA 3NMNA 5AMWA 3RD6A 2PCSA 1TW0A 3NJ0A 4A86A 4BK6A 1IFVA 1QMRA 3NMTA 2E3SA 3IE5A 3RT0C 5I8FA 3KDHA 3NJOA 1LLTA 4Z3LA 4LG5A 3P9VA 3TVQA 2BK0A 2FLHA 4OICA 3H3RA 4BKDA 3H3SA 3KLXA 3P51A 4A80A 1H2OA 2E3RA 4IH0A 4N0GC 2WQLA 4IGYA 4BTZA 3KL1A 2LCGA 3KB0A 1LN3A 5BRLA 3QN1A 3OTLA 4M9BA 2QPVA 1FM4A 4A8GA 1EM2A 3NJ1A 2M89A 4C9CA 3ZVUA 3F08A 2LF2A 3FO5A 4REIA 4C9IA 4WVOA 4LGBA 3OJIA 4Q0KA 3KDJA 1XFSA 3NMHA 4LGAA 4A84A 1XN6A 2M47A 2I9YA 3NEGA 1KCMA 4JHGA 2IL5A 2RERA 4LA7A 2Z9ZA 2D4RA 5JO2A 1VJHA 1LN2A 3K3KA 4XRTA 3RT2A 2MOUA 4BK7A 1X53A 4A85A 4C94A 4M9WA 3WG8A 2K7HA 2LEQA 4IH2A 4JHHA 3C0VA 4JDLA 2GKDA 1XN5A 3P0LA 1BV1A 2L9PA 2KTEA 2L8OA 2Z9YA 4R7KA 2K5GA 3TVRA 1XUVA 2NN5A 1JSSA 3NMVA 3KDIA 4A83A 2LAKA 4IGVA 4Y31A 3ELIA 1BTVA 4QIPA 4B9RA 3JRSA 1T27A 2FFSA 2KCZA 2LE1A 4REJA 2RESA 2KEWA 2N4BA 2QIMA 2VNEA 4DSBA 4FPWA 2E3MA 2VQ5A 3NMPA 3R6PA 4IGWA 5E4DA 2E3NA 3QSZA 3TFZA 3KAYA 3UJLA 2LUZA 3W9RA 1B6FA 5E4MA 3NS2A 5JNNA 1TXCA 1XDFA 4DS8A 3Q63A 2Q3QA 4A8VA 3PUTA 3UIDA 2LIOA 3H3QA 3JRQB 3KAZA 4PSBA 3OH8A 2E3OA 3Q64A 4MAPA 5I9JA 3TL1A 2A1LA 3PU2A 2E3QA 1LN1A 2LGHA 3GGNA 4BKCA 3UQHA 5E46A 2LPXA 4IHRA 3KB3A 4GY9A 4XRWA 1ICXA 4JHIA
chains in the Genus database with same CATH superfamily
3GL0A 4A88A 1Z94A 2N4AA 4MNSA 5E4BA 4DSCA 1ZXFA 2NS9A 4N3EA 4JDAA 3NI8A 2E3PA 2KF2A 1FSKA 3E85A 2REZA 4MA6A 2R55A 2EJXA 3IJTA 3Q6AA 4REHA 3OQUA 4A81A 2LDKA 2L65A 3W9KA 3HO1A 5C9YA 1T17A 3NR4A 4IGXA 3GTEA 1UW5A 4QDCA 5JO1A 3K90A 3H3TA 4RYVA 1E09A 4A87A 4A8UA 3TGOC 4E6FA 3NEFA 2PSOA 4N41A 4QCKA 3CNWA 3NMNA 5AMWA 3RD6A 2PCSA 1TW0A 3HM9A 3NJ0A 4A86A 3HXMA 4BK6A 1IFVA 1QMRA 3NMTA 2E3SA 3HK2A 3IE5A 3RT0C 5I8FA 3KDHA 5EKQC 3NJOA 1LLTA 4Z3LA 4LG5A 3P9VA 3TVQA 4NCBA 2BK0A 2FLHA 4OICA 3H3RA 4BKDA 3H3SA 3KLXA 3P51A 4A80A 1H2OA 2E3RA 4IH0A 4N0GC 2WQLA 4IGYA 4BTZA 3KL1A 2LCGA 3KB0A 1LN3A 5BRLA 3DLBA 3QN1A 2LAFA 2ZYLA 3OTLA 4M9BA 2QPVA 1FM4A 4A8GA 1EM2A 3NJ1A 2M89A 4N47A 4C9CA 3ZVUA 3F08A 2LF2A 3FO5A 4REIA 4C9IA 3F73A 4WVOA 4LGBA 3OJIA 4Q0KA 3KDJA 1XFSA 3NMHA 4LGAA 4A84A 1XN6A 2M47A 2I9YA 3NEGA 1KCMA 4JHGA 2IL5A 2RERA 4LA7A 2Z9ZA 2D4RA 5JO2A 1VJHA 1LN2A 3K3KA 4XRTA 3RT2A 2MOUA 4BK7A 1X53A 4A85A 4C94A 4M9WA 3WG8A 2K7HA 2LEQA 4IH2A 4JHHA 3C0VA 4JDLA 2GKDA 1XN5A 3P0LA 1BV1A 2L9PA 2KTEA 2L8OA 2Z9YA 4QDFB 2K5GA 4R7KA 3TVRA 3HVRA 1XUVA 2NN5A 1JSSA 4QDFA 4QDDA 3HJFA 3NMVA 3KDIA 4A83A 2LAKA 4IGVA 4Y31A 4N76A 3GOBA 3ELIA 4KPYA 4QIPA 4B9RA 1BTVA 3JRSA 3GB4A 3NQNA 1T27A 2FFSA 3GKEA 2KCZA 2LE1A 4REJA 2RESA 2KEWA 2N4BA 2QIMA 2VNEA 4DSBA 4FPWA 2E3MA 2VQ5A 3NMPA 3R6PA 4IGWA 5E4DA 2E3NA 3QSZA 3TFZA 3KAYA 3GTSA 3UJLA 2LUZA 2YH6A 3W9RA 1B6FA 5E4MA 3NS2A 5JNNA 1TXCA 1XDFA 4DS8A 3Q63A 2Q3QA 4A8VA 3PUTA 3UIDA 2LIOA 3H3QA 3JRQB 3KAZA 3GL2A 3OH8A 2E3OA 3Q64A 4MAPA 4PSBA 5I9JA 3TL1A 2A1LA 3PU2A 3DLHA 4NCAA 2E3QA 1LN1A 2LGHA 3GGNA 4JHYA 4BKCA 3UQHA 5E46A 2LPXA 4IHRA 3KB3A 4GY9A 4XRWA 1ICXA 4JHIA
chains in the Genus database with same CATH topology
3GL0A 4A88A 1Z94A 2N4AA 4MNSA 5E4BA 4DSCA 1ZXFA 2NS9A 4N3EA 4JDAA 3NI8A 2E3PA 2KF2A 1FSKA 3E85A 2REZA 4MA6A 2R55A 2EJXA 3IJTA 3Q6AA 4REHA 3OQUA 4A81A 2LDKA 2L65A 3W9KA 3HO1A 5C9YA 1T17A 3NR4A 4IGXA 3GTEA 1UW5A 4QDCA 5JO1A 3K90A 3H3TA 4RYVA 1E09A 4A87A 4A8UA 3TGOC 4E6FA 3NEFA 2PSOA 4N41A 4QCKA 3CNWA 3NMNA 5AMWA 3RD6A 2PCSA 1TW0A 3HM9A 3NJ0A 4A86A 3HXMA 4BK6A 1IFVA 1QMRA 3NMTA 2E3SA 3HK2A 3IE5A 3RT0C 5I8FA 3KDHA 5EKQC 3NJOA 1LLTA 4Z3LA 4LG5A 3P9VA 3TVQA 4NCBA 2BK0A 2FLHA 4OICA 3H3RA 4BKDA 3H3SA 3KLXA 3P51A 4A80A 1H2OA 2E3RA 4IH0A 4N0GC 2WQLA 4IGYA 4BTZA 3KL1A 2LCGA 3KB0A 1LN3A 5BRLA 3DLBA 3QN1A 2LAFA 2ZYLA 3OTLA 4M9BA 2QPVA 1FM4A 4A8GA 1EM2A 3NJ1A 2M89A 4N47A 4C9CA 3ZVUA 3F08A 2LF2A 3FO5A 4REIA 4C9IA 3F73A 4WVOA 4LGBA 3OJIA 4Q0KA 3KDJA 1XFSA 3NMHA 4LGAA 4A84A 1XN6A 2M47A 2I9YA 3NEGA 1KCMA 4JHGA 2IL5A 2RERA 4LA7A 2Z9ZA 2D4RA 5JO2A 1VJHA 1LN2A 3K3KA 4XRTA 3RT2A 2MOUA 4BK7A 1X53A 4A85A 4C94A 4M9WA 3WG8A 2K7HA 2LEQA 4IH2A 4JHHA 3C0VA 4JDLA 2GKDA 1XN5A 3P0LA 1BV1A 2L9PA 2KTEA 2L8OA 2Z9YA 4QDFB 2K5GA 4R7KA 3TVRA 3HVRA 1XUVA 2NN5A 1JSSA 4QDFA 4QDDA 3HJFA 3NMVA 3KDIA 4A83A 2LAKA 4IGVA 4Y31A 4N76A 3GOBA 3ELIA 4KPYA 4QIPA 4B9RA 1BTVA 3JRSA 3GB4A 3NQNA 1T27A 2FFSA 3GKEA 2KCZA 2LE1A 4REJA 2RESA 2KEWA 2N4BA 2QIMA 2VNEA 4DSBA 4FPWA 2E3MA 2VQ5A 3NMPA 3R6PA 4IGWA 5E4DA 2E3NA 3QSZA 3TFZA 3KAYA 3GTSA 3UJLA 2LUZA 2YH6A 3W9RA 1B6FA 5E4MA 3NS2A 5JNNA 1TXCA 1XDFA 4DS8A 3Q63A 2Q3QA 4A8VA 3PUTA 3UIDA 2LIOA 3H3QA 3JRQB 3KAZA 3GL2A 3OH8A 2E3OA 3Q64A 4MAPA 4PSBA 5I9JA 3TL1A 2A1LA 3PU2A 3DLHA 4NCAA 2E3QA 1LN1A 2LGHA 3GGNA 4JHYA 4BKCA 3UQHA 5E46A 2LPXA 4IHRA 3KB3A 4GY9A 4XRWA 1ICXA 4JHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A88 A;  1Z94 A;  2N4A A;  4MNS A;  5E4B A;  4DSC A;  1ZXF A;  2NS9 A;  4N3E A;  4JDA A;  3NI8 A;  2E3P A;  2KF2 A;  1FSK A;  3E85 A;  2REZ A;  4MA6 A;  2R55 A;  2EJX A;  3IJT A;  3Q6A A;  4REH A;  3OQU A;  4A81 A;  2LDK A;  2L65 A;  3W9K A;  5C9Y A;  1T17 A;  3NR4 A;  4IGX A;  5JO1 A;  1UW5 A;  1E09 A;  3K90 A;  3H3T A;  4RYV A;  4A87 A;  4A8U A;  3NEF A;  2PSO A;  3CNW A;  3NMN A;  5AMW A;  3RD6 A;  2PCS A;  1TW0 A;  3NJ0 A;  4A86 A;  4BK6 A;  1IFV A;  1QMR A;  3NMT A;  2E3S A;  3IE5 A;  3RT0 C;  5I8F A;  3KDH A;  3NJO A;  1LLT A;  4Z3L A;  4LG5 A;  3P9V A;  3TVQ A;  2BK0 A;  2FLH A;  4OIC A;  3H3R A;  4BKD A;  3H3S A;  3KLX A;  3P51 A;  4A80 A;  1H2O A;  2E3R A;  4IH0 A;  4N0G C;  2WQL A;  4IGY A;  4BTZ A;  3KL1 A;  2LCG A;  3KB0 A;  1LN3 A;  5BRL A;  3QN1 A;  3OTL A;  4M9B A;  2QPV A;  1FM4 A;  4A8G A;  1EM2 A;  3NJ1 A;  2M89 A;  4C9C A;  3ZVU A;  3F08 A;  2LF2 A;  3FO5 A;  4REI A;  4C9I A;  4WVO A;  4LGB A;  3OJI A;  4Q0K A;  3KDJ A;  1XFS A;  3NMH A;  4LGA A;  4A84 A;  1XN6 A;  2M47 A;  2I9Y A;  3NEG A;  1KCM A;  4JHG A;  2IL5 A;  2RER A;  4LA7 A;  2Z9Z A;  2D4R A;  5JO2 A;  1VJH A;  1LN2 A;  3K3K A;  4XRT A;  3RT2 A;  2MOU A;  4BK7 A;  1X53 A;  4A85 A;  4C94 A;  4M9W A;  3WG8 A;  2K7H A;  2LEQ A;  4IH2 A;  4JHH A;  3C0V A;  4JDL A;  2GKD A;  1XN5 A;  3P0L A;  1BV1 A;  2L9P A;  2KTE A;  2L8O A;  2Z9Y A;  4R7K A;  2K5G A;  3TVR A;  1XUV A;  2NN5 A;  1JSS A;  3NMV A;  3KDI A;  4A83 A;  2LAK A;  4IGV A;  4Y31 A;  3ELI A;  1BTV A;  4QIP A;  4B9R A;  3JRS A;  1T27 A;  2FFS A;  2KCZ A;  2LE1 A;  4REJ A;  2RES A;  2KEW A;  2N4B A;  2QIM A;  2VNE A;  4DSB A;  4FPW A;  2E3M A;  2VQ5 A;  3NMP A;  3R6P A;  4IGW A;  5E4D A;  2E3N A;  3QSZ A;  3TFZ A;  3KAY A;  3UJL A;  2LUZ A;  3W9R A;  1B6F A;  5E4M A;  3NS2 A;  5JNN A;  1TXC A;  1XDF A;  4DS8 A;  3Q63 A;  2Q3Q A;  4A8V A;  3PUT A;  3UID A;  2LIO A;  3H3Q A;  3JRQ B;  3KAZ A;  4PSB A;  3OH8 A;  2E3O A;  3Q64 A;  4MAP A;  5I9J A;  3TL1 A;  2A1L A;  3PU2 A;  2E3Q A;  1LN1 A;  2LGH A;  3GGN A;  4BKC A;  3UQH A;  5E46 A;  2LPX A;  4IHR A;  3KB3 A;  4GY9 A;  4XRW A;  1ICX A;  4JHI A; 
#chains in the Genus database with same CATH topology
 3GL0 A;  4A88 A;  1Z94 A;  2N4A A;  4MNS A;  5E4B A;  4DSC A;  1ZXF A;  2NS9 A;  4N3E A;  4JDA A;  3NI8 A;  2E3P A;  2KF2 A;  1FSK A;  3E85 A;  2REZ A;  4MA6 A;  2R55 A;  2EJX A;  3IJT A;  3Q6A A;  4REH A;  3OQU A;  4A81 A;  2LDK A;  2L65 A;  3W9K A;  3HO1 A;  5C9Y A;  1T17 A;  3NR4 A;  4IGX A;  3GTE A;  1UW5 A;  4QDC A;  5JO1 A;  3K90 A;  3H3T A;  4RYV A;  1E09 A;  4A87 A;  4A8U A;  3TGO C;  4E6F A;  3NEF A;  2PSO A;  4N41 A;  4QCK A;  3CNW A;  3NMN A;  5AMW A;  3RD6 A;  2PCS A;  1TW0 A;  3HM9 A;  3NJ0 A;  4A86 A;  3HXM A;  4BK6 A;  1IFV A;  1QMR A;  3NMT A;  2E3S A;  3HK2 A;  3IE5 A;  3RT0 C;  5I8F A;  3KDH A;  5EKQ C;  3NJO A;  1LLT A;  4Z3L A;  4LG5 A;  3P9V A;  3TVQ A;  4NCB A;  2BK0 A;  2FLH A;  4OIC A;  3H3R A;  4BKD A;  3H3S A;  3KLX A;  3P51 A;  4A80 A;  1H2O A;  2E3R A;  4IH0 A;  4N0G C;  2WQL A;  4IGY A;  4BTZ A;  3KL1 A;  2LCG A;  3KB0 A;  1LN3 A;  5BRL A;  3DLB A;  3QN1 A;  2LAF A;  2ZYL A;  3OTL A;  4M9B A;  2QPV A;  1FM4 A;  4A8G A;  1EM2 A;  3NJ1 A;  2M89 A;  4N47 A;  4C9C A;  3ZVU A;  3F08 A;  2LF2 A;  3FO5 A;  4REI A;  4C9I A;  3F73 A;  4WVO A;  4LGB A;  3OJI A;  4Q0K A;  3KDJ A;  1XFS A;  3NMH A;  4LGA A;  4A84 A;  1XN6 A;  2M47 A;  2I9Y A;  3NEG A;  1KCM A;  4JHG A;  2IL5 A;  2RER A;  4LA7 A;  2Z9Z A;  2D4R A;  5JO2 A;  1VJH A;  1LN2 A;  3K3K A;  4XRT A;  3RT2 A;  2MOU A;  4BK7 A;  1X53 A;  4A85 A;  4C94 A;  4M9W A;  3WG8 A;  2K7H A;  2LEQ A;  4IH2 A;  4JHH A;  3C0V A;  4JDL A;  2GKD A;  1XN5 A;  3P0L A;  1BV1 A;  2L9P A;  2KTE A;  2L8O A;  2Z9Y A;  4QDF B;  2K5G A;  4R7K A;  3TVR A;  3HVR A;  1XUV A;  2NN5 A;  1JSS A;  4QDF A;  4QDD A;  3HJF A;  3NMV A;  3KDI A;  4A83 A;  2LAK A;  4IGV A;  4Y31 A;  4N76 A;  3GOB A;  3ELI A;  4KPY A;  4QIP A;  4B9R A;  1BTV A;  3JRS A;  3GB4 A;  3NQN A;  1T27 A;  2FFS A;  3GKE A;  2KCZ A;  2LE1 A;  4REJ A;  2RES A;  2KEW A;  2N4B A;  2QIM A;  2VNE A;  4DSB A;  4FPW A;  2E3M A;  2VQ5 A;  3NMP A;  3R6P A;  4IGW A;  5E4D A;  2E3N A;  3QSZ A;  3TFZ A;  3KAY A;  3GTS A;  3UJL A;  2LUZ A;  2YH6 A;  3W9R A;  1B6F A;  5E4M A;  3NS2 A;  5JNN A;  1TXC A;  1XDF A;  4DS8 A;  3Q63 A;  2Q3Q A;  4A8V A;  3PUT A;  3UID A;  2LIO A;  3H3Q A;  3JRQ B;  3KAZ A;  3GL2 A;  3OH8 A;  2E3O A;  3Q64 A;  4MAP A;  4PSB A;  5I9J A;  3TL1 A;  2A1L A;  3PU2 A;  3DLH A;  4NCA A;  2E3Q A;  1LN1 A;  2LGH A;  3GGN A;  4JHY A;  4BKC A;  3UQH A;  5E46 A;  2LPX A;  4IHR A;  3KB3 A;  4GY9 A;  4XRW A;  1ICX A;  4JHI A; 
#chains in the Genus database with same CATH homology
 3GL0 A;  4A88 A;  1Z94 A;  2N4A A;  4MNS A;  5E4B A;  4DSC A;  1ZXF A;  2NS9 A;  4N3E A;  4JDA A;  3NI8 A;  2E3P A;  2KF2 A;  1FSK A;  3E85 A;  2REZ A;  4MA6 A;  2R55 A;  2EJX A;  3IJT A;  3Q6A A;  4REH A;  3OQU A;  4A81 A;  2LDK A;  2L65 A;  3W9K A;  3HO1 A;  5C9Y A;  1T17 A;  3NR4 A;  4IGX A;  3GTE A;  1UW5 A;  4QDC A;  5JO1 A;  3K90 A;  3H3T A;  4RYV A;  1E09 A;  4A87 A;  4A8U A;  3TGO C;  4E6F A;  3NEF A;  2PSO A;  4N41 A;  4QCK A;  3CNW A;  3NMN A;  5AMW A;  3RD6 A;  2PCS A;  1TW0 A;  3HM9 A;  3NJ0 A;  4A86 A;  3HXM A;  4BK6 A;  1IFV A;  1QMR A;  3NMT A;  2E3S A;  3HK2 A;  3IE5 A;  3RT0 C;  5I8F A;  3KDH A;  5EKQ C;  3NJO A;  1LLT A;  4Z3L A;  4LG5 A;  3P9V A;  3TVQ A;  4NCB A;  2BK0 A;  2FLH A;  4OIC A;  3H3R A;  4BKD A;  3H3S A;  3KLX A;  3P51 A;  4A80 A;  1H2O A;  2E3R A;  4IH0 A;  4N0G C;  2WQL A;  4IGY A;  4BTZ A;  3KL1 A;  2LCG A;  3KB0 A;  1LN3 A;  5BRL A;  3DLB A;  3QN1 A;  2LAF A;  2ZYL A;  3OTL A;  4M9B A;  2QPV A;  1FM4 A;  4A8G A;  1EM2 A;  3NJ1 A;  2M89 A;  4N47 A;  4C9C A;  3ZVU A;  3F08 A;  2LF2 A;  3FO5 A;  4REI A;  4C9I A;  3F73 A;  4WVO A;  4LGB A;  3OJI A;  4Q0K A;  3KDJ A;  1XFS A;  3NMH A;  4LGA A;  4A84 A;  1XN6 A;  2M47 A;  2I9Y A;  3NEG A;  1KCM A;  4JHG A;  2IL5 A;  2RER A;  4LA7 A;  2Z9Z A;  2D4R A;  5JO2 A;  1VJH A;  1LN2 A;  3K3K A;  4XRT A;  3RT2 A;  2MOU A;  4BK7 A;  1X53 A;  4A85 A;  4C94 A;  4M9W A;  3WG8 A;  2K7H A;  2LEQ A;  4IH2 A;  4JHH A;  3C0V A;  4JDL A;  2GKD A;  1XN5 A;  3P0L A;  1BV1 A;  2L9P A;  2KTE A;  2L8O A;  2Z9Y A;  4QDF B;  2K5G A;  4R7K A;  3TVR A;  3HVR A;  1XUV A;  2NN5 A;  1JSS A;  4QDF A;  4QDD A;  3HJF A;  3NMV A;  3KDI A;  4A83 A;  2LAK A;  4IGV A;  4Y31 A;  4N76 A;  3GOB A;  3ELI A;  4KPY A;  4QIP A;  4B9R A;  1BTV A;  3JRS A;  3GB4 A;  3NQN A;  1T27 A;  2FFS A;  3GKE A;  2KCZ A;  2LE1 A;  4REJ A;  2RES A;  2KEW A;  2N4B A;  2QIM A;  2VNE A;  4DSB A;  4FPW A;  2E3M A;  2VQ5 A;  3NMP A;  3R6P A;  4IGW A;  5E4D A;  2E3N A;  3QSZ A;  3TFZ A;  3KAY A;  3GTS A;  3UJL A;  2LUZ A;  2YH6 A;  3W9R A;  1B6F A;  5E4M A;  3NS2 A;  5JNN A;  1TXC A;  1XDF A;  4DS8 A;  3Q63 A;  2Q3Q A;  4A8V A;  3PUT A;  3UID A;  2LIO A;  3H3Q A;  3JRQ B;  3KAZ A;  3GL2 A;  3OH8 A;  2E3O A;  3Q64 A;  4MAP A;  4PSB A;  5I9J A;  3TL1 A;  2A1L A;  3PU2 A;  3DLH A;  4NCA A;  2E3Q A;  1LN1 A;  2LGH A;  3GGN A;  4JHY A;  4BKC A;  3UQH A;  5E46 A;  2LPX A;  4IHR A;  3KB3 A;  4GY9 A;  4XRW A;  1ICX A;  4JHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...