1IFVA

Crystal structure of pathogenesis-related protein llpr10.1b from yellow lupine
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
155
structure length
155
Chain Sequence
b'GVFAFEDEHPSAVAQAKLFKALTKDSDDIIPKVIEQIQSVEIVEGNGGPGTVKKITASHGGHTSYVLHKIDAIDEASFEYNYSIVGGTGLDESLEKITFESKLLSGPDGGSIGKIKVKFHTKGDVLSDAVREEAKARGTGLFKAVEGYVLANPNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN LLR18B
publication title Crystal structures of two homologous pathogenesis-related proteins from yellow lupine.
pubmed doi rcsb
source organism Lupinus luteus
molecule tags Allergen
total genus 38
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 1ifvA00
3K90A 4C94A 2LEQA 3NMPA 3FO5A 3NJOA 3IJTA 4BTZA 2LPXA 2N4AA 5E4BA 2RERA 4IGYA 1H2OA 2QPVA 1B6FA 2EJXA 3KLXA 3OH8A 3JRQB 1TXCA 3NEFA 3Q64A 4REJA 3NMNA 2E3PA 4IGXA 3GGNA 4MA6A 1XFSA 1XDFA 3NJ1A 3E85A 3UJLA 1XUVA 2K7HA 2PSOA 4IH2A 2NN5A 1EM2A 3KDJA 4A81A 4A8UA 1IFVA 2VNEA 2L8OA 3QSZA 1BV1A 1JSSA 3H3QA 4JHGA 3WG8A 3KB0A 3P51A 1T17A 2LCGA 2NS9A 3H3TA 4Z3LA 3QN1A 4XRTA 1XN6A 2BK0A 2IL5A 2LF2A 4IGWA 3NMHA 5E4DA 3RT0C 1LN2A 3KDIA 4BK6A 3UIDA 3KDHA 3CNWA 2LIOA 3TFZA 2KF2A 2E3MA 2LGHA 3NR4A 2KCZA 3F08A 2LUZA 2VQ5A 3UQHA 4LG5A 4B9RA 3Q63A 4IHRA 1XN5A 3H3RA 2E3NA 4LGAA 5JO1A 4OICA 3TL1A 2E3RA 2KTEA 3C0VA 3NI8A 3NMTA 3TVQA 4XRWA 2MOUA 2E3QA 4N0GC 4PSBA 2LE1A 3NJ0A 2FLHA 2M47A 5I9JA 2A1LA 1Z94A 2REZA 1LLTA 3ZVUA 4DSBA 4JDAA 4GY9A 4A84A 1UW5A 5I8FA 4A88A 2K5GA 2Q3QA 4Y31A 1FM4A 5E46A 2KEWA 4A83A 4C9CA 3OQUA 2R55A 4DSCA 4A80A 1QMRA 1X53A 3W9RA 2L65A 4A86A 4BKCA 4A8VA 3NEGA 1LN1A 4BKDA 3NS2A 3OJIA 4JHHA 4A85A 4REHA 4M9WA 3NMVA 3P9VA 5JO2A 4LA7A 4QIPA 1ZXFA 4DS8A 4WVOA 2E3SA 4Q0KA 4C9IA 5BRLA 1TW0A 4N3EA 5AMWA 3H3SA 3P0LA 5E4MA 4M9BA 2LDKA 4IH0A 3RD6A 1BTVA 1LN3A 2GKDA 5C9YA 3TVRA 3KAZA 4JHIA 3ELIA 3KAYA 4R7KA 2FFSA 2PCSA 2QIMA 2RESA 3K3KA 4LGBA 4MAPA 4RYVA 3RT2A 3OTLA 2N4BA 3JRSA 2WQLA 3W9KA 1KCMA 4A87A 1T27A 1VJHA 4REIA 3KL1A 3R6PA 1ICXA 2Z9ZA 3KB3A 5JNNA 1E09A 1FSKA 2E3OA 2Z9YA 3PU2A 2L9PA 4JDLA 4BK7A 4MNSA 4IGVA 3IE5A 2D4RA 2LAKA 2I9YA 3Q6AA 2M89A 4FPWA 4A8GA 3PUTA
chains in the Genus database with same CATH superfamily
3K90A 2YH6A 4C94A 2LEQA 3NMPA 3FO5A 3NJOA 3IJTA 4BTZA 2LPXA 2N4AA 5E4BA 2RERA 4IGYA 1H2OA 2QPVA 1B6FA 2EJXA 3KLXA 3OH8A 3JRQB 1TXCA 3NEFA 3Q64A 4REJA 3NMNA 2ZYLA 2E3PA 4IGXA 3GGNA 4MA6A 1XFSA 1XDFA 3NJ1A 3E85A 3UJLA 1XUVA 2K7HA 2PSOA 4IH2A 2NN5A 1EM2A 3KDJA 4A81A 4A8UA 1IFVA 2VNEA 2L8OA 3QSZA 1BV1A 1JSSA 3H3QA 4JHGA 3WG8A 3KB0A 3P51A 1T17A 4QCKA 2LCGA 2NS9A 3H3TA 4Z3LA 3QN1A 4XRTA 1XN6A 2BK0A 2IL5A 2LF2A 2LAFA 4IGWA 3NMHA 5E4DA 3RT0C 4N76A 1LN2A 3KDIA 4BK6A 3UIDA 3KDHA 3CNWA 2LIOA 3GB4A 3TFZA 3HO1A 2KF2A 2E3MA 2LGHA 3GL0A 3NR4A 2KCZA 4JHYA 3F08A 3HK2A 4QDFA 2LUZA 2VQ5A 3UQHA 4LG5A 4B9RA 3DLBA 3Q63A 4IHRA 1XN5A 3GTEA 3H3RA 2E3NA 4LGAA 5JO1A 4OICA 3HM9A 3TL1A 2E3RA 2KTEA 3C0VA 3NI8A 3NMTA 3TVQA 4XRWA 2MOUA 2E3QA 4N0GC 4PSBA 2LE1A 3NJ0A 2FLHA 2M47A 4QDCA 5I9JA 2A1LA 1Z94A 2REZA 4N47A 1LLTA 3ZVUA 4DSBA 5EKQC 4JDAA 4GY9A 4N41A 4QDFB 4A84A 1UW5A 5I8FA 4A88A 2K5GA 2Q3QA 4Y31A 1FM4A 3NQNA 2KEWA 5E46A 4A83A 4C9CA 3OQUA 2R55A 4DSCA 4A80A 1QMRA 1X53A 3W9RA 2L65A 4A86A 4BKCA 3HXMA 4A8VA 3NEGA 1LN1A 4KPYA 4BKDA 3NS2A 3OJIA 4JHHA 4QDDA 4A85A 4REHA 3GKEA 3NMVA 4M9WA 3P9VA 5JO2A 4LA7A 4QIPA 1ZXFA 4DS8A 4WVOA 2E3SA 4Q0KA 4C9IA 3DLHA 5BRLA 3F73A 1TW0A 3GOBA 4N3EA 3GL2A 5AMWA 3H3SA 3P0LA 5E4MA 4M9BA 2LDKA 4IH0A 3RD6A 1BTVA 1LN3A 2GKDA 5C9YA 3TVRA 4NCBA 3KAZA 4JHIA 3ELIA 3KAYA 4R7KA 2FFSA 2PCSA 2QIMA 2RESA 3K3KA 4LGBA 4MAPA 4RYVA 3RT2A 3OTLA 2N4BA 3TGOC 4E6FA 3JRSA 2WQLA 3W9KA 1KCMA 3HVRA 4A87A 1T27A 4NCAA 1VJHA 4REIA 3KL1A 3R6PA 1ICXA 2Z9ZA 3KB3A 5JNNA 1E09A 1FSKA 2E3OA 2Z9YA 3PU2A 2L9PA 4JDLA 4BK7A 4MNSA 3GTSA 3IE5A 4IGVA 2D4RA 2LAKA 2I9YA 3Q6AA 2M89A 4FPWA 3HJFA 4A8GA 3PUTA
chains in the Genus database with same CATH topology
3K90A 2YH6A 4C94A 2LEQA 3NMPA 3FO5A 3NJOA 3IJTA 4BTZA 2LPXA 2N4AA 5E4BA 2RERA 4IGYA 1H2OA 2QPVA 1B6FA 2EJXA 3KLXA 3OH8A 3JRQB 1TXCA 3NEFA 3Q64A 4REJA 3NMNA 2ZYLA 2E3PA 4IGXA 3GGNA 4MA6A 1XFSA 1XDFA 3NJ1A 3E85A 3UJLA 1XUVA 2K7HA 2PSOA 4IH2A 2NN5A 1EM2A 3KDJA 4A81A 4A8UA 1IFVA 2VNEA 2L8OA 3QSZA 1BV1A 1JSSA 3H3QA 4JHGA 3WG8A 3KB0A 3P51A 1T17A 4QCKA 2LCGA 2NS9A 3H3TA 4Z3LA 3QN1A 4XRTA 1XN6A 2BK0A 2IL5A 2LF2A 2LAFA 4IGWA 3NMHA 5E4DA 3RT0C 4N76A 1LN2A 3KDIA 4BK6A 3UIDA 3KDHA 3CNWA 2LIOA 3GB4A 3TFZA 3HO1A 2KF2A 2E3MA 2LGHA 3GL0A 3NR4A 2KCZA 4JHYA 3F08A 3HK2A 4QDFA 2LUZA 2VQ5A 3UQHA 4LG5A 4B9RA 3DLBA 3Q63A 4IHRA 1XN5A 3GTEA 3H3RA 2E3NA 4LGAA 5JO1A 4OICA 3HM9A 3TL1A 2E3RA 2KTEA 3C0VA 3NI8A 3NMTA 3TVQA 4XRWA 2MOUA 2E3QA 4N0GC 4PSBA 2LE1A 3NJ0A 2FLHA 2M47A 4QDCA 5I9JA 2A1LA 1Z94A 2REZA 4N47A 1LLTA 3ZVUA 4DSBA 5EKQC 4JDAA 4GY9A 4N41A 4QDFB 4A84A 1UW5A 5I8FA 4A88A 2K5GA 2Q3QA 4Y31A 1FM4A 3NQNA 2KEWA 5E46A 4A83A 4C9CA 3OQUA 2R55A 4DSCA 4A80A 1QMRA 1X53A 3W9RA 2L65A 4A86A 4BKCA 3HXMA 4A8VA 3NEGA 1LN1A 4KPYA 4BKDA 3NS2A 3OJIA 4JHHA 4QDDA 4A85A 4REHA 3GKEA 3NMVA 4M9WA 3P9VA 5JO2A 4LA7A 4QIPA 1ZXFA 4DS8A 4WVOA 2E3SA 4Q0KA 4C9IA 3DLHA 5BRLA 3F73A 1TW0A 3GOBA 4N3EA 3GL2A 5AMWA 3H3SA 3P0LA 5E4MA 4M9BA 2LDKA 4IH0A 3RD6A 1BTVA 1LN3A 2GKDA 5C9YA 3TVRA 4NCBA 3KAZA 4JHIA 3ELIA 3KAYA 4R7KA 2FFSA 2PCSA 2QIMA 2RESA 3K3KA 4LGBA 4MAPA 4RYVA 3RT2A 3OTLA 2N4BA 3TGOC 4E6FA 3JRSA 2WQLA 3W9KA 1KCMA 3HVRA 4A87A 1T27A 4NCAA 1VJHA 4REIA 3KL1A 3R6PA 1ICXA 2Z9ZA 3KB3A 5JNNA 1E09A 1FSKA 2E3OA 2Z9YA 3PU2A 2L9PA 4JDLA 4BK7A 4MNSA 3GTSA 3IE5A 4IGVA 2D4RA 2LAKA 2I9YA 3Q6AA 2M89A 4FPWA 3HJFA 4A8GA 3PUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K90 A;  4C94 A;  2LEQ A;  3NMP A;  3FO5 A;  3NJO A;  3IJT A;  4BTZ A;  2LPX A;  2N4A A;  5E4B A;  2RER A;  4IGY A;  1H2O A;  2QPV A;  1B6F A;  2EJX A;  3KLX A;  3OH8 A;  3JRQ B;  1TXC A;  3NEF A;  3Q64 A;  4REJ A;  3NMN A;  2E3P A;  4IGX A;  3GGN A;  4MA6 A;  1XFS A;  1XDF A;  3NJ1 A;  3E85 A;  3UJL A;  1XUV A;  2K7H A;  2PSO A;  4IH2 A;  2NN5 A;  1EM2 A;  3KDJ A;  4A81 A;  4A8U A;  1IFV A;  2VNE A;  2L8O A;  3QSZ A;  1BV1 A;  1JSS A;  3H3Q A;  4JHG A;  3WG8 A;  3KB0 A;  3P51 A;  1T17 A;  2LCG A;  2NS9 A;  3H3T A;  4Z3L A;  3QN1 A;  4XRT A;  1XN6 A;  2BK0 A;  2IL5 A;  2LF2 A;  4IGW A;  3NMH A;  5E4D A;  3RT0 C;  1LN2 A;  3KDI A;  4BK6 A;  3UID A;  3KDH A;  3CNW A;  2LIO A;  3TFZ A;  2KF2 A;  2E3M A;  2LGH A;  3NR4 A;  2KCZ A;  3F08 A;  2LUZ A;  2VQ5 A;  3UQH A;  4LG5 A;  4B9R A;  3Q63 A;  4IHR A;  1XN5 A;  3H3R A;  2E3N A;  4LGA A;  5JO1 A;  4OIC A;  3TL1 A;  2E3R A;  2KTE A;  3C0V A;  3NI8 A;  3NMT A;  3TVQ A;  4XRW A;  2MOU A;  2E3Q A;  4N0G C;  4PSB A;  2LE1 A;  3NJ0 A;  2FLH A;  2M47 A;  5I9J A;  2A1L A;  1Z94 A;  2REZ A;  1LLT A;  3ZVU A;  4DSB A;  4JDA A;  4GY9 A;  4A84 A;  1UW5 A;  5I8F A;  4A88 A;  2K5G A;  2Q3Q A;  4Y31 A;  1FM4 A;  5E46 A;  2KEW A;  4A83 A;  4C9C A;  3OQU A;  2R55 A;  4DSC A;  4A80 A;  1QMR A;  1X53 A;  3W9R A;  2L65 A;  4A86 A;  4BKC A;  4A8V A;  3NEG A;  1LN1 A;  4BKD A;  3NS2 A;  3OJI A;  4JHH A;  4A85 A;  4REH A;  4M9W A;  3NMV A;  3P9V A;  5JO2 A;  4LA7 A;  4QIP A;  1ZXF A;  4DS8 A;  4WVO A;  2E3S A;  4Q0K A;  4C9I A;  5BRL A;  1TW0 A;  4N3E A;  5AMW A;  3H3S A;  3P0L A;  5E4M A;  4M9B A;  2LDK A;  4IH0 A;  3RD6 A;  1BTV A;  1LN3 A;  2GKD A;  5C9Y A;  3TVR A;  3KAZ A;  4JHI A;  3ELI A;  3KAY A;  4R7K A;  2FFS A;  2PCS A;  2QIM A;  2RES A;  3K3K A;  4LGB A;  4MAP A;  4RYV A;  3RT2 A;  3OTL A;  2N4B A;  3JRS A;  2WQL A;  3W9K A;  1KCM A;  4A87 A;  1T27 A;  1VJH A;  4REI A;  3KL1 A;  3R6P A;  1ICX A;  2Z9Z A;  3KB3 A;  5JNN A;  1E09 A;  1FSK A;  2E3O A;  2Z9Y A;  3PU2 A;  2L9P A;  4JDL A;  4BK7 A;  4MNS A;  4IGV A;  3IE5 A;  2D4R A;  2LAK A;  2I9Y A;  3Q6A A;  2M89 A;  4FPW A;  4A8G A;  3PUT A; 
#chains in the Genus database with same CATH topology
 3K90 A;  2YH6 A;  4C94 A;  2LEQ A;  3NMP A;  3FO5 A;  3NJO A;  3IJT A;  4BTZ A;  2LPX A;  2N4A A;  5E4B A;  2RER A;  4IGY A;  1H2O A;  2QPV A;  1B6F A;  2EJX A;  3KLX A;  3OH8 A;  3JRQ B;  1TXC A;  3NEF A;  3Q64 A;  4REJ A;  3NMN A;  2ZYL A;  2E3P A;  4IGX A;  3GGN A;  4MA6 A;  1XFS A;  1XDF A;  3NJ1 A;  3E85 A;  3UJL A;  1XUV A;  2K7H A;  2PSO A;  4IH2 A;  2NN5 A;  1EM2 A;  3KDJ A;  4A81 A;  4A8U A;  1IFV A;  2VNE A;  2L8O A;  3QSZ A;  1BV1 A;  1JSS A;  3H3Q A;  4JHG A;  3WG8 A;  3KB0 A;  3P51 A;  1T17 A;  4QCK A;  2LCG A;  2NS9 A;  3H3T A;  4Z3L A;  3QN1 A;  4XRT A;  1XN6 A;  2BK0 A;  2IL5 A;  2LF2 A;  2LAF A;  4IGW A;  3NMH A;  5E4D A;  3RT0 C;  4N76 A;  1LN2 A;  3KDI A;  4BK6 A;  3UID A;  3KDH A;  3CNW A;  2LIO A;  3GB4 A;  3TFZ A;  3HO1 A;  2KF2 A;  2E3M A;  2LGH A;  3GL0 A;  3NR4 A;  2KCZ A;  4JHY A;  3F08 A;  3HK2 A;  4QDF A;  2LUZ A;  2VQ5 A;  3UQH A;  4LG5 A;  4B9R A;  3DLB A;  3Q63 A;  4IHR A;  1XN5 A;  3GTE A;  3H3R A;  2E3N A;  4LGA A;  5JO1 A;  4OIC A;  3HM9 A;  3TL1 A;  2E3R A;  2KTE A;  3C0V A;  3NI8 A;  3NMT A;  3TVQ A;  4XRW A;  2MOU A;  2E3Q A;  4N0G C;  4PSB A;  2LE1 A;  3NJ0 A;  2FLH A;  2M47 A;  4QDC A;  5I9J A;  2A1L A;  1Z94 A;  2REZ A;  4N47 A;  1LLT A;  3ZVU A;  4DSB A;  5EKQ C;  4JDA A;  4GY9 A;  4N41 A;  4QDF B;  4A84 A;  1UW5 A;  5I8F A;  4A88 A;  2K5G A;  2Q3Q A;  4Y31 A;  1FM4 A;  3NQN A;  2KEW A;  5E46 A;  4A83 A;  4C9C A;  3OQU A;  2R55 A;  4DSC A;  4A80 A;  1QMR A;  1X53 A;  3W9R A;  2L65 A;  4A86 A;  4BKC A;  3HXM A;  4A8V A;  3NEG A;  1LN1 A;  4KPY A;  4BKD A;  3NS2 A;  3OJI A;  4JHH A;  4QDD A;  4A85 A;  4REH A;  3GKE A;  3NMV A;  4M9W A;  3P9V A;  5JO2 A;  4LA7 A;  4QIP A;  1ZXF A;  4DS8 A;  4WVO A;  2E3S A;  4Q0K A;  4C9I A;  3DLH A;  5BRL A;  3F73 A;  1TW0 A;  3GOB A;  4N3E A;  3GL2 A;  5AMW A;  3H3S A;  3P0L A;  5E4M A;  4M9B A;  2LDK A;  4IH0 A;  3RD6 A;  1BTV A;  1LN3 A;  2GKD A;  5C9Y A;  3TVR A;  4NCB A;  3KAZ A;  4JHI A;  3ELI A;  3KAY A;  4R7K A;  2FFS A;  2PCS A;  2QIM A;  2RES A;  3K3K A;  4LGB A;  4MAP A;  4RYV A;  3RT2 A;  3OTL A;  2N4B A;  3TGO C;  4E6F A;  3JRS A;  2WQL A;  3W9K A;  1KCM A;  3HVR A;  4A87 A;  1T27 A;  4NCA A;  1VJH A;  4REI A;  3KL1 A;  3R6P A;  1ICX A;  2Z9Z A;  3KB3 A;  5JNN A;  1E09 A;  1FSK A;  2E3O A;  2Z9Y A;  3PU2 A;  2L9P A;  4JDL A;  4BK7 A;  4MNS A;  3GTS A;  3IE5 A;  4IGV A;  2D4R A;  2LAK A;  2I9Y A;  3Q6A A;  2M89 A;  4FPW A;  3HJF A;  4A8G A;  3PUT A; 
#chains in the Genus database with same CATH homology
 3K90 A;  2YH6 A;  4C94 A;  2LEQ A;  3NMP A;  3FO5 A;  3NJO A;  3IJT A;  4BTZ A;  2LPX A;  2N4A A;  5E4B A;  2RER A;  4IGY A;  1H2O A;  2QPV A;  1B6F A;  2EJX A;  3KLX A;  3OH8 A;  3JRQ B;  1TXC A;  3NEF A;  3Q64 A;  4REJ A;  3NMN A;  2ZYL A;  2E3P A;  4IGX A;  3GGN A;  4MA6 A;  1XFS A;  1XDF A;  3NJ1 A;  3E85 A;  3UJL A;  1XUV A;  2K7H A;  2PSO A;  4IH2 A;  2NN5 A;  1EM2 A;  3KDJ A;  4A81 A;  4A8U A;  1IFV A;  2VNE A;  2L8O A;  3QSZ A;  1BV1 A;  1JSS A;  3H3Q A;  4JHG A;  3WG8 A;  3KB0 A;  3P51 A;  1T17 A;  4QCK A;  2LCG A;  2NS9 A;  3H3T A;  4Z3L A;  3QN1 A;  4XRT A;  1XN6 A;  2BK0 A;  2IL5 A;  2LF2 A;  2LAF A;  4IGW A;  3NMH A;  5E4D A;  3RT0 C;  4N76 A;  1LN2 A;  3KDI A;  4BK6 A;  3UID A;  3KDH A;  3CNW A;  2LIO A;  3GB4 A;  3TFZ A;  3HO1 A;  2KF2 A;  2E3M A;  2LGH A;  3GL0 A;  3NR4 A;  2KCZ A;  4JHY A;  3F08 A;  3HK2 A;  4QDF A;  2LUZ A;  2VQ5 A;  3UQH A;  4LG5 A;  4B9R A;  3DLB A;  3Q63 A;  4IHR A;  1XN5 A;  3GTE A;  3H3R A;  2E3N A;  4LGA A;  5JO1 A;  4OIC A;  3HM9 A;  3TL1 A;  2E3R A;  2KTE A;  3C0V A;  3NI8 A;  3NMT A;  3TVQ A;  4XRW A;  2MOU A;  2E3Q A;  4N0G C;  4PSB A;  2LE1 A;  3NJ0 A;  2FLH A;  2M47 A;  4QDC A;  5I9J A;  2A1L A;  1Z94 A;  2REZ A;  4N47 A;  1LLT A;  3ZVU A;  4DSB A;  5EKQ C;  4JDA A;  4GY9 A;  4N41 A;  4QDF B;  4A84 A;  1UW5 A;  5I8F A;  4A88 A;  2K5G A;  2Q3Q A;  4Y31 A;  1FM4 A;  3NQN A;  2KEW A;  5E46 A;  4A83 A;  4C9C A;  3OQU A;  2R55 A;  4DSC A;  4A80 A;  1QMR A;  1X53 A;  3W9R A;  2L65 A;  4A86 A;  4BKC A;  3HXM A;  4A8V A;  3NEG A;  1LN1 A;  4KPY A;  4BKD A;  3NS2 A;  3OJI A;  4JHH A;  4QDD A;  4A85 A;  4REH A;  3GKE A;  3NMV A;  4M9W A;  3P9V A;  5JO2 A;  4LA7 A;  4QIP A;  1ZXF A;  4DS8 A;  4WVO A;  2E3S A;  4Q0K A;  4C9I A;  3DLH A;  5BRL A;  3F73 A;  1TW0 A;  3GOB A;  4N3E A;  3GL2 A;  5AMW A;  3H3S A;  3P0L A;  5E4M A;  4M9B A;  2LDK A;  4IH0 A;  3RD6 A;  1BTV A;  1LN3 A;  2GKD A;  5C9Y A;  3TVR A;  4NCB A;  3KAZ A;  4JHI A;  3ELI A;  3KAY A;  4R7K A;  2FFS A;  2PCS A;  2QIM A;  2RES A;  3K3K A;  4LGB A;  4MAP A;  4RYV A;  3RT2 A;  3OTL A;  2N4B A;  3TGO C;  4E6F A;  3JRS A;  2WQL A;  3W9K A;  1KCM A;  3HVR A;  4A87 A;  1T27 A;  4NCA A;  1VJH A;  4REI A;  3KL1 A;  3R6P A;  1ICX A;  2Z9Z A;  3KB3 A;  5JNN A;  1E09 A;  1FSK A;  2E3O A;  2Z9Y A;  3PU2 A;  2L9P A;  4JDL A;  4BK7 A;  4MNS A;  3GTS A;  3IE5 A;  4IGV A;  2D4R A;  2LAK A;  2I9Y A;  3Q6A A;  2M89 A;  4FPW A;  3HJF A;  4A8G A;  3PUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...