1IFVA

Crystal structure of pathogenesis-related protein llpr10.1b from yellow lupine
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
155
structure length
155
Chain Sequence
GVFAFEDEHPSAVAQAKLFKALTKDSDDIIPKVIEQIQSVEIVEGNGGPGTVKKITASHGGHTSYVLHKIDAIDEASFEYNYSIVGGTGLDESLEKITFESKLLSGPDGGSIGKIKVKFHTKGDVLSDAVREEAKARGTGLFKAVEGYVLANPNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of two homologous pathogenesis-related proteins from yellow lupine.
pubmed doi rcsb
source organism Lupinus luteus
molecule tags Allergen
molecule keywords PROTEIN LLR18B
total genus 38
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 1ifvA00
3K3KA 1LN3A 4A8VA 2LUZA 4JDLA 4BK7A 2EJXA 2MOUA 3KB3A 1ICXA 2M89A 3R6PA 4IGXA 2R55A 3P0LA 2E3RA 3NEGA 4GY9A 3E85A 4LGAA 2KF2A 4XRTA 3OTLA 4MAPA 4A83A 2NN5A 4IGWA 3Q6AA 4DSBA 1B6FA 4A8UA 3KAYA 4BK6A 1T17A 3NJOA 4RYVA 5C9YA 4MA6A 3PU2A 3NMPA 5JO1A 2RESA 1XN5A 1TXCA 1H2OA 4M9WA 4N0GC 4JDAA 3NR4A 3P51A 4JHHA 3ZVUA 3PUTA 1BTVA 4JHGA 2N4BA 3NS2A 2KEWA 3H3TA 3Q64A 4REHA 3W9RA 1FM4A 1LN2A 4A85A 3H3RA 2LIOA 3NMVA 3OJIA 3RT2A 4DSCA 4OICA 1E09A 1EM2A 3KDIA 2I9YA 3H3SA 1X53A 3NJ0A 4A87A 3OH8A 3UIDA 2E3SA 1XUVA 4DS8A 2E3PA 1UW5A 4PSBA 2PCSA 2PSOA 4FPWA 2E3MA 2LEQA 3NMHA 4REJA 3CNWA 2LCGA 3RD6A 4A81A 3UQHA 3KLXA 1XN6A 3C0VA 1TW0A 2E3OA 4BKDA 3TFZA 4BKCA 4R7KA 1XDFA 1JSSA 4QIPA 2LF2A 5E4BA 4BTZA 1ZXFA 2IL5A 2Q3QA 4IGYA 2NS9A 3KB0A 2LAKA 2RERA 3P9VA 1LN1A 5E46A 2M47A 2K5GA 3TVQA 2VQ5A 3IE5A 1FSKA 3NI8A 4C9IA 2K7HA 1XFSA 2LGHA 4A84A 2Z9YA 5E4DA 4MNSA 4N3EA 4B9RA 3JRSA 4C94A 2FFSA 3NJ1A 2FLHA 3K90A 4REIA 4A86A 3Q63A 4WVOA 1IFVA 3KAZA 4C9CA 5JO2A 3JRQB 2L8OA 2A1LA 4LG5A 1QMRA 3ELIA 2D4RA 5JNNA 5BRLA 2N4AA 2WQLA 2E3QA 4A80A 4M9BA 3QSZA 2REZA 3KDHA 4IH0A 5I8FA 3TVRA 3UJLA 2GKDA 4IHRA 5I9JA 3F08A 2QIMA 2QPVA 3W9KA 3IJTA 2KCZA 3NEFA 4Q0KA 4Y31A 2KTEA 3WG8A 2E3NA 4A8GA 3KDJA 4LGBA 2Z9ZA 3OQUA 3FO5A 2VNEA 3KL1A 5AMWA 2LPXA 4XRWA 4JHIA 1T27A 2BK0A 3TL1A 4IGVA 3H3QA 2LDKA 3NMNA 2L9PA 3QN1A 1Z94A 3GGNA 4Z3LA 1BV1A 1KCMA 5E4MA 3NMTA 1VJHA 4IH2A 2L65A 3RT0C 1LLTA 4A88A 2LE1A 4LA7A
chains in the Genus database with same CATH superfamily
3K3KA 4JHYA 1LN3A 4A8VA 4QDDA 2LUZA 4JDLA 4BK7A 2EJXA 2MOUA 3KB3A 3HVRA 1ICXA 2M89A 3R6PA 4IGXA 3DLHA 2R55A 3P0LA 2E3RA 3NEGA 4GY9A 3E85A 4LGAA 2KF2A 4XRTA 3OTLA 4MAPA 4A83A 2NN5A 4IGWA 2LAFA 3GTEA 3Q6AA 4DSBA 1B6FA 4A8UA 3KAYA 3GOBA 4BK6A 1T17A 3GL2A 3NJOA 4RYVA 3HM9A 5C9YA 4MA6A 3PU2A 3NMPA 5JO1A 2RESA 1XN5A 3HXMA 1TXCA 1H2OA 4M9WA 4N0GC 4JDAA 3NR4A 3P51A 4JHHA 3ZVUA 3PUTA 4NCBA 4JHGA 1BTVA 2N4BA 3NS2A 2KEWA 3H3TA 3Q64A 4REHA 3W9RA 4N41A 1FM4A 1LN2A 4A85A 3H3RA 2LIOA 3NMVA 3OJIA 3RT2A 4DSCA 4OICA 1E09A 1EM2A 3KDIA 2I9YA 3HO1A 3H3SA 1X53A 3NJ0A 4A87A 4NCAA 3OH8A 3UIDA 2E3SA 1XUVA 4DS8A 2E3PA 1UW5A 4PSBA 2PCSA 2PSOA 4FPWA 2E3MA 2LEQA 3NMHA 4REJA 3CNWA 2LCGA 3RD6A 4A81A 3UQHA 3KLXA 1XN6A 3C0VA 1TW0A 2E3OA 4BKDA 3TFZA 4BKCA 4R7KA 1XDFA 1JSSA 4QIPA 2LF2A 5E4BA 4BTZA 1ZXFA 2IL5A 2Q3QA 4IGYA 4QDFB 3F73A 3HJFA 2NS9A 3KB0A 2LAKA 2RERA 3P9VA 3GB4A 1LN1A 5E46A 2M47A 2K5GA 3TVQA 2VQ5A 3IE5A 1FSKA 3DLBA 3GTSA 3NI8A 4C9IA 2ZYLA 2K7HA 1XFSA 2LGHA 4A84A 4QCKA 2Z9YA 5E4DA 4MNSA 5EKQC 4N3EA 4B9RA 3JRSA 4C94A 4QDFA 2FFSA 3NJ1A 2FLHA 3K90A 4REIA 4A86A 3Q63A 3GKEA 4WVOA 3HK2A 1IFVA 3KAZA 4C9CA 5JO2A 3JRQB 2L8OA 2A1LA 4LG5A 1QMRA 2D4RA 3ELIA 5JNNA 4QDCA 2N4AA 2WQLA 2E3QA 5BRLA 4A80A 4M9BA 3QSZA 2REZA 3KDHA 4IH0A 5I8FA 3TVRA 3UJLA 2GKDA 4IHRA 5I9JA 3F08A 2QIMA 4N76A 2QPVA 3W9KA 3IJTA 2KCZA 3NEFA 4Q0KA 4Y31A 2KTEA 3WG8A 2E3NA 3TGOC 4A8GA 3KDJA 4LGBA 2Z9ZA 3OQUA 3FO5A 2VNEA 3KL1A 5AMWA 2LPXA 3NQNA 4XRWA 4JHIA 4E6FA 1T27A 2BK0A 3TL1A 4IGVA 3H3QA 4KPYA 2LDKA 3NMNA 2L9PA 3GL0A 3QN1A 4N47A 1Z94A 3GGNA 4Z3LA 1BV1A 1KCMA 5E4MA 3NMTA 1VJHA 4IH2A 2L65A 3RT0C 2YH6A 1LLTA 4A88A 2LE1A 4LA7A
chains in the Genus database with same CATH topology
3K3KA 4JHYA 1LN3A 4A8VA 4QDDA 2LUZA 4JDLA 4BK7A 2EJXA 2MOUA 3KB3A 3HVRA 1ICXA 2M89A 3R6PA 4IGXA 3DLHA 2R55A 3P0LA 2E3RA 3NEGA 4GY9A 3E85A 4LGAA 2KF2A 4XRTA 3OTLA 4MAPA 4A83A 2NN5A 4IGWA 2LAFA 3GTEA 3Q6AA 4DSBA 1B6FA 4A8UA 3KAYA 3GOBA 4BK6A 1T17A 3GL2A 3NJOA 4RYVA 3HM9A 5C9YA 4MA6A 3PU2A 3NMPA 5JO1A 2RESA 1XN5A 3HXMA 1TXCA 1H2OA 4M9WA 4N0GC 4JDAA 3NR4A 3P51A 4JHHA 3ZVUA 3PUTA 4NCBA 4JHGA 1BTVA 2N4BA 3NS2A 2KEWA 3H3TA 3Q64A 4REHA 3W9RA 4N41A 1FM4A 1LN2A 4A85A 3H3RA 2LIOA 3NMVA 3OJIA 3RT2A 4DSCA 4OICA 1E09A 1EM2A 3KDIA 2I9YA 3HO1A 3H3SA 1X53A 3NJ0A 4A87A 4NCAA 3OH8A 3UIDA 2E3SA 1XUVA 4DS8A 2E3PA 1UW5A 4PSBA 2PCSA 2PSOA 4FPWA 2E3MA 2LEQA 3NMHA 4REJA 3CNWA 2LCGA 3RD6A 4A81A 3UQHA 3KLXA 1XN6A 3C0VA 1TW0A 2E3OA 4BKDA 3TFZA 4BKCA 4R7KA 1XDFA 1JSSA 4QIPA 2LF2A 5E4BA 4BTZA 1ZXFA 2IL5A 2Q3QA 4IGYA 4QDFB 3F73A 3HJFA 2NS9A 3KB0A 2LAKA 2RERA 3P9VA 3GB4A 1LN1A 5E46A 2M47A 2K5GA 3TVQA 2VQ5A 3IE5A 1FSKA 3DLBA 3GTSA 3NI8A 4C9IA 2ZYLA 2K7HA 1XFSA 2LGHA 4A84A 4QCKA 2Z9YA 5E4DA 4MNSA 5EKQC 4N3EA 4B9RA 3JRSA 4C94A 4QDFA 2FFSA 3NJ1A 2FLHA 3K90A 4REIA 4A86A 3Q63A 3GKEA 4WVOA 3HK2A 1IFVA 3KAZA 4C9CA 5JO2A 3JRQB 2L8OA 2A1LA 4LG5A 1QMRA 2D4RA 3ELIA 5JNNA 4QDCA 2N4AA 2WQLA 2E3QA 5BRLA 4A80A 4M9BA 3QSZA 2REZA 3KDHA 4IH0A 5I8FA 3TVRA 3UJLA 2GKDA 4IHRA 5I9JA 3F08A 2QIMA 4N76A 2QPVA 3W9KA 3IJTA 2KCZA 3NEFA 4Q0KA 4Y31A 2KTEA 3WG8A 2E3NA 3TGOC 4A8GA 3KDJA 4LGBA 2Z9ZA 3OQUA 3FO5A 2VNEA 3KL1A 5AMWA 2LPXA 3NQNA 4XRWA 4JHIA 4E6FA 1T27A 2BK0A 3TL1A 4IGVA 3H3QA 4KPYA 2LDKA 3NMNA 2L9PA 3GL0A 3QN1A 4N47A 1Z94A 3GGNA 4Z3LA 1BV1A 1KCMA 5E4MA 3NMTA 1VJHA 4IH2A 2L65A 3RT0C 2YH6A 1LLTA 4A88A 2LE1A 4LA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K3K A;  1LN3 A;  4A8V A;  2LUZ A;  4JDL A;  4BK7 A;  2EJX A;  2MOU A;  3KB3 A;  1ICX A;  2M89 A;  3R6P A;  4IGX A;  2R55 A;  3P0L A;  2E3R A;  3NEG A;  4GY9 A;  3E85 A;  4LGA A;  2KF2 A;  4XRT A;  3OTL A;  4MAP A;  4A83 A;  2NN5 A;  4IGW A;  3Q6A A;  4DSB A;  1B6F A;  4A8U A;  3KAY A;  4BK6 A;  1T17 A;  3NJO A;  4RYV A;  5C9Y A;  4MA6 A;  3PU2 A;  3NMP A;  5JO1 A;  2RES A;  1XN5 A;  1TXC A;  1H2O A;  4M9W A;  4N0G C;  4JDA A;  3NR4 A;  3P51 A;  4JHH A;  3ZVU A;  3PUT A;  1BTV A;  4JHG A;  2N4B A;  3NS2 A;  2KEW A;  3H3T A;  3Q64 A;  4REH A;  3W9R A;  1FM4 A;  1LN2 A;  4A85 A;  3H3R A;  2LIO A;  3NMV A;  3OJI A;  3RT2 A;  4DSC A;  4OIC A;  1E09 A;  1EM2 A;  3KDI A;  2I9Y A;  3H3S A;  1X53 A;  3NJ0 A;  4A87 A;  3OH8 A;  3UID A;  2E3S A;  1XUV A;  4DS8 A;  2E3P A;  1UW5 A;  4PSB A;  2PCS A;  2PSO A;  4FPW A;  2E3M A;  2LEQ A;  3NMH A;  4REJ A;  3CNW A;  2LCG A;  3RD6 A;  4A81 A;  3UQH A;  3KLX A;  1XN6 A;  3C0V A;  1TW0 A;  2E3O A;  4BKD A;  3TFZ A;  4BKC A;  4R7K A;  1XDF A;  1JSS A;  4QIP A;  2LF2 A;  5E4B A;  4BTZ A;  1ZXF A;  2IL5 A;  2Q3Q A;  4IGY A;  2NS9 A;  3KB0 A;  2LAK A;  2RER A;  3P9V A;  1LN1 A;  5E46 A;  2M47 A;  2K5G A;  3TVQ A;  2VQ5 A;  3IE5 A;  1FSK A;  3NI8 A;  4C9I A;  2K7H A;  1XFS A;  2LGH A;  4A84 A;  2Z9Y A;  5E4D A;  4MNS A;  4N3E A;  4B9R A;  3JRS A;  4C94 A;  2FFS A;  3NJ1 A;  2FLH A;  3K90 A;  4REI A;  4A86 A;  3Q63 A;  4WVO A;  1IFV A;  3KAZ A;  4C9C A;  5JO2 A;  3JRQ B;  2L8O A;  2A1L A;  4LG5 A;  1QMR A;  3ELI A;  2D4R A;  5JNN A;  5BRL A;  2N4A A;  2WQL A;  2E3Q A;  4A80 A;  4M9B A;  3QSZ A;  2REZ A;  3KDH A;  4IH0 A;  5I8F A;  3TVR A;  3UJL A;  2GKD A;  4IHR A;  5I9J A;  3F08 A;  2QIM A;  2QPV A;  3W9K A;  3IJT A;  2KCZ A;  3NEF A;  4Q0K A;  4Y31 A;  2KTE A;  3WG8 A;  2E3N A;  4A8G A;  3KDJ A;  4LGB A;  2Z9Z A;  3OQU A;  3FO5 A;  2VNE A;  3KL1 A;  5AMW A;  2LPX A;  4XRW A;  4JHI A;  1T27 A;  2BK0 A;  3TL1 A;  4IGV A;  3H3Q A;  2LDK A;  3NMN A;  2L9P A;  3QN1 A;  1Z94 A;  3GGN A;  4Z3L A;  1BV1 A;  1KCM A;  5E4M A;  3NMT A;  1VJH A;  4IH2 A;  2L65 A;  3RT0 C;  1LLT A;  4A88 A;  2LE1 A;  4LA7 A; 
#chains in the Genus database with same CATH topology
 3K3K A;  4JHY A;  1LN3 A;  4A8V A;  4QDD A;  2LUZ A;  4JDL A;  4BK7 A;  2EJX A;  2MOU A;  3KB3 A;  3HVR A;  1ICX A;  2M89 A;  3R6P A;  4IGX A;  3DLH A;  2R55 A;  3P0L A;  2E3R A;  3NEG A;  4GY9 A;  3E85 A;  4LGA A;  2KF2 A;  4XRT A;  3OTL A;  4MAP A;  4A83 A;  2NN5 A;  4IGW A;  2LAF A;  3GTE A;  3Q6A A;  4DSB A;  1B6F A;  4A8U A;  3KAY A;  3GOB A;  4BK6 A;  1T17 A;  3GL2 A;  3NJO A;  4RYV A;  3HM9 A;  5C9Y A;  4MA6 A;  3PU2 A;  3NMP A;  5JO1 A;  2RES A;  1XN5 A;  3HXM A;  1TXC A;  1H2O A;  4M9W A;  4N0G C;  4JDA A;  3NR4 A;  3P51 A;  4JHH A;  3ZVU A;  3PUT A;  4NCB A;  4JHG A;  1BTV A;  2N4B A;  3NS2 A;  2KEW A;  3H3T A;  3Q64 A;  4REH A;  3W9R A;  4N41 A;  1FM4 A;  1LN2 A;  4A85 A;  3H3R A;  2LIO A;  3NMV A;  3OJI A;  3RT2 A;  4DSC A;  4OIC A;  1E09 A;  1EM2 A;  3KDI A;  2I9Y A;  3HO1 A;  3H3S A;  1X53 A;  3NJ0 A;  4A87 A;  4NCA A;  3OH8 A;  3UID A;  2E3S A;  1XUV A;  4DS8 A;  2E3P A;  1UW5 A;  4PSB A;  2PCS A;  2PSO A;  4FPW A;  2E3M A;  2LEQ A;  3NMH A;  4REJ A;  3CNW A;  2LCG A;  3RD6 A;  4A81 A;  3UQH A;  3KLX A;  1XN6 A;  3C0V A;  1TW0 A;  2E3O A;  4BKD A;  3TFZ A;  4BKC A;  4R7K A;  1XDF A;  1JSS A;  4QIP A;  2LF2 A;  5E4B A;  4BTZ A;  1ZXF A;  2IL5 A;  2Q3Q A;  4IGY A;  4QDF B;  3F73 A;  3HJF A;  2NS9 A;  3KB0 A;  2LAK A;  2RER A;  3P9V A;  3GB4 A;  1LN1 A;  5E46 A;  2M47 A;  2K5G A;  3TVQ A;  2VQ5 A;  3IE5 A;  1FSK A;  3DLB A;  3GTS A;  3NI8 A;  4C9I A;  2ZYL A;  2K7H A;  1XFS A;  2LGH A;  4A84 A;  4QCK A;  2Z9Y A;  5E4D A;  4MNS A;  5EKQ C;  4N3E A;  4B9R A;  3JRS A;  4C94 A;  4QDF A;  2FFS A;  3NJ1 A;  2FLH A;  3K90 A;  4REI A;  4A86 A;  3Q63 A;  3GKE A;  4WVO A;  3HK2 A;  1IFV A;  3KAZ A;  4C9C A;  5JO2 A;  3JRQ B;  2L8O A;  2A1L A;  4LG5 A;  1QMR A;  2D4R A;  3ELI A;  5JNN A;  4QDC A;  2N4A A;  2WQL A;  2E3Q A;  5BRL A;  4A80 A;  4M9B A;  3QSZ A;  2REZ A;  3KDH A;  4IH0 A;  5I8F A;  3TVR A;  3UJL A;  2GKD A;  4IHR A;  5I9J A;  3F08 A;  2QIM A;  4N76 A;  2QPV A;  3W9K A;  3IJT A;  2KCZ A;  3NEF A;  4Q0K A;  4Y31 A;  2KTE A;  3WG8 A;  2E3N A;  3TGO C;  4A8G A;  3KDJ A;  4LGB A;  2Z9Z A;  3OQU A;  3FO5 A;  2VNE A;  3KL1 A;  5AMW A;  2LPX A;  3NQN A;  4XRW A;  4JHI A;  4E6F A;  1T27 A;  2BK0 A;  3TL1 A;  4IGV A;  3H3Q A;  4KPY A;  2LDK A;  3NMN A;  2L9P A;  3GL0 A;  3QN1 A;  4N47 A;  1Z94 A;  3GGN A;  4Z3L A;  1BV1 A;  1KCM A;  5E4M A;  3NMT A;  1VJH A;  4IH2 A;  2L65 A;  3RT0 C;  2YH6 A;  1LLT A;  4A88 A;  2LE1 A;  4LA7 A; 
#chains in the Genus database with same CATH homology
 3K3K A;  4JHY A;  1LN3 A;  4A8V A;  4QDD A;  2LUZ A;  4JDL A;  4BK7 A;  2EJX A;  2MOU A;  3KB3 A;  3HVR A;  1ICX A;  2M89 A;  3R6P A;  4IGX A;  3DLH A;  2R55 A;  3P0L A;  2E3R A;  3NEG A;  4GY9 A;  3E85 A;  4LGA A;  2KF2 A;  4XRT A;  3OTL A;  4MAP A;  4A83 A;  2NN5 A;  4IGW A;  2LAF A;  3GTE A;  3Q6A A;  4DSB A;  1B6F A;  4A8U A;  3KAY A;  3GOB A;  4BK6 A;  1T17 A;  3GL2 A;  3NJO A;  4RYV A;  3HM9 A;  5C9Y A;  4MA6 A;  3PU2 A;  3NMP A;  5JO1 A;  2RES A;  1XN5 A;  3HXM A;  1TXC A;  1H2O A;  4M9W A;  4N0G C;  4JDA A;  3NR4 A;  3P51 A;  4JHH A;  3ZVU A;  3PUT A;  4NCB A;  4JHG A;  1BTV A;  2N4B A;  3NS2 A;  2KEW A;  3H3T A;  3Q64 A;  4REH A;  3W9R A;  4N41 A;  1FM4 A;  1LN2 A;  4A85 A;  3H3R A;  2LIO A;  3NMV A;  3OJI A;  3RT2 A;  4DSC A;  4OIC A;  1E09 A;  1EM2 A;  3KDI A;  2I9Y A;  3HO1 A;  3H3S A;  1X53 A;  3NJ0 A;  4A87 A;  4NCA A;  3OH8 A;  3UID A;  2E3S A;  1XUV A;  4DS8 A;  2E3P A;  1UW5 A;  4PSB A;  2PCS A;  2PSO A;  4FPW A;  2E3M A;  2LEQ A;  3NMH A;  4REJ A;  3CNW A;  2LCG A;  3RD6 A;  4A81 A;  3UQH A;  3KLX A;  1XN6 A;  3C0V A;  1TW0 A;  2E3O A;  4BKD A;  3TFZ A;  4BKC A;  4R7K A;  1XDF A;  1JSS A;  4QIP A;  2LF2 A;  5E4B A;  4BTZ A;  1ZXF A;  2IL5 A;  2Q3Q A;  4IGY A;  4QDF B;  3F73 A;  3HJF A;  2NS9 A;  3KB0 A;  2LAK A;  2RER A;  3P9V A;  3GB4 A;  1LN1 A;  5E46 A;  2M47 A;  2K5G A;  3TVQ A;  2VQ5 A;  3IE5 A;  1FSK A;  3DLB A;  3GTS A;  3NI8 A;  4C9I A;  2ZYL A;  2K7H A;  1XFS A;  2LGH A;  4A84 A;  4QCK A;  2Z9Y A;  5E4D A;  4MNS A;  5EKQ C;  4N3E A;  4B9R A;  3JRS A;  4C94 A;  4QDF A;  2FFS A;  3NJ1 A;  2FLH A;  3K90 A;  4REI A;  4A86 A;  3Q63 A;  3GKE A;  4WVO A;  3HK2 A;  1IFV A;  3KAZ A;  4C9C A;  5JO2 A;  3JRQ B;  2L8O A;  2A1L A;  4LG5 A;  1QMR A;  2D4R A;  3ELI A;  5JNN A;  4QDC A;  2N4A A;  2WQL A;  2E3Q A;  5BRL A;  4A80 A;  4M9B A;  3QSZ A;  2REZ A;  3KDH A;  4IH0 A;  5I8F A;  3TVR A;  3UJL A;  2GKD A;  4IHR A;  5I9J A;  3F08 A;  2QIM A;  4N76 A;  2QPV A;  3W9K A;  3IJT A;  2KCZ A;  3NEF A;  4Q0K A;  4Y31 A;  2KTE A;  3WG8 A;  2E3N A;  3TGO C;  4A8G A;  3KDJ A;  4LGB A;  2Z9Z A;  3OQU A;  3FO5 A;  2VNE A;  3KL1 A;  5AMW A;  2LPX A;  3NQN A;  4XRW A;  4JHI A;  4E6F A;  1T27 A;  2BK0 A;  3TL1 A;  4IGV A;  3H3Q A;  4KPY A;  2LDK A;  3NMN A;  2L9P A;  3GL0 A;  3QN1 A;  4N47 A;  1Z94 A;  3GGN A;  4Z3L A;  1BV1 A;  1KCM A;  5E4M A;  3NMT A;  1VJH A;  4IH2 A;  2L65 A;  3RT0 C;  2YH6 A;  1LLT A;  4A88 A;  2LE1 A;  4LA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...