1IG0A

Crystal structure of yeast thiamin pyrophosphokinase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
317
structure length
317
Chain Sequence
EECIENPERIKIGTDLINIRNKMNLKELIHPNEDENSTLLILNQKIDIPRPLFYKIWKLHDLKVCADGAANRLYDYLDDDETLRIKYLPNYIIGDLDSLSEKVYKYYRKNKVTIIKQTTQYSTDFTKCVNLISLHFNSPEFRSLISNKDNLQSNHGIELEKGIHTLYNTMTESLVFSKVTPISLLALGGIGGRFDQTVHSITQLYTLSENASYFKLCYMTPTDLIFLIKKNGTLIEYDPQFRNTCIGNCGLLPIGEATLVKETRGLKWDVKNWPTSVVTGRVSSSNRFVGDNCCFIDTKDDIILNVEIFVDKLIDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of yeast thiamin pyrophosphokinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Thiamin pyrophosphokinase
total genus 106
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature ec 2.7.6.2: Thiamine diphosphokinase.
pdb deposition date 2001-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04263 TPK_catalytic Thiamin pyrophosphokinase, catalytic domain
A PF04265 TPK_B1_binding Thiamin pyrophosphokinase, vitamin B1 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.320 Mainly Beta Sandwich Jelly Rolls Thiamin pyrophosphokinase, thiamin-binding domain 1ig0A02
3.40.50.10240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Thiamin pyrophosphokinase, catalytic domain 1ig0A01
2OMKA 2HH9A 3IHKA 3CQ9A 1IG3A 1IG0A 2F17A 3S4YA 3MELA 3LM8A 3L8MA 3K94A 2G9ZA
chains in the Genus database with same CATH superfamily
4UNIA 3K8YA 4NOKA 3A1UA 3O7OA 1H6CA 3RHZA 1SPXA 3ONFA 4YI3A 1RUE2 4DUPA 4XCBA 3ORJA 4TUYB 1P4SA 4IOMA 3R5TA 3CLSC 3GYDA 5JADA 4PS0A 2YBKA 1CZTA 1KQOA 3GEDA 3MIHA 1H6DA 2PS0A 1ZJ6A 1PTKA 3W77A 1JHQA 3CINA 5I0DA 4OJTA 1RM0A 5A9TA 2P9JA 5KJ1A 5FUIA 1IRIA 5CX4A 1DGRA 1UU5A 2XQFA 1E1CA 2Q5OA 4M00A 2ZM5A 1S0IA 3RWBA 3NIWA 1G59A 4FBLA 2A75A 3K9HA 3T2TA 4N1AA 2HUNA 5A6SB 5FOJB 2YHSA 1GP4A 4EHIA 3EAQA 1N77A 3LUAA 1CR6A 5E38A 2IYEA 2HCJB 3KJXA 5D21A 2K7FA 1Q1AA 5FADA 3ZFGB 4JLBA 2XQGA 5FZOB 3TPFA 1TA0A 4CDNA 1J70A 4B3IA 1UY0A 4CTJA 5LYJA 3E3AA 1KDPA 2GD6A 4QFDA 1PL0A 3DTVB 4UAJA 4TYMA 3GAFA 4YMGA 3TZEA 4Q12A 2C2ZA 4O4JF 1VSTA 1YZYA 1W8FA 1DRWA 1HPLA 5B6JA 4X71A 3HEAA 2DY0A 3O0VA 2W47A 3DBLB 1V45E 2OBYA 4FFNA 1BEEA 3BN6A 3D64A 3OZCA 1G55A 4HDQB 3KR2A 5LLSA 4GKKB 5EXTA 5BT9A 3GIWA 2O1SA 3JVIA 3AVYA 3IT3A 2I71A 3L8CA 4AY2A 4WECA 4E4ZA 1BVUA 5DMHA 4KNWA 1L7RA 4BVLA 2ZJCA 4HH1A 2IDKA 3ETQA 3AX6A 4N54A 5A4FS 2WZ8A 2IFRA 1HXHA 4URFA 1PR0A 4XX1A 1H6YA 2I2BA 3ILNA 5FYMA 4M1EA 5T3UA 5DYIA 4HNVA 4L0DA 3ZWYA 4J9UE 1CUJA 1L3BA 3MD0A 2O8BA 2Z08A 3B20A 4BIFA 1GJRA 1HNZB 3BJZA 3ZTWA 3UGKA 1BJTA 1B76A 1NOVA 4WA7A 1GN8A 2AN4A 2ODEA 4DJFC 1YOVA 3KUKA 4XR4A 4KXLA 1GYQA 2AWNA 2VH9A 5ALUA 3UC9A 1GYKA 1Z5OA 2FW9A 4DPKA 1PGNA 3T7EA 3CS3A 2G19A 2I78A 3RZKA 1Z0JA 2OVFA 2ZZMA 1VPVA 3THXA 2REQA 1VPLA 2FMYA 4RGVA 2OHIA 1NJ5A 3LVBA 4ZO7A 4LF9B 1R6TA 4ILEA 2BTVC 2WNUA 4IIFA 3HJCA 3RWKX 1ZOIA 4B71A 3FOCA 5LBTA 3ROPA 2ECKA 1NN1A 2GZRA 4GC5A 5C52B 2G17A 1QV7A 4XRRA 4L11A 3IQXA 1YHYA 5KXBA 4RHCA 3EIUA 2NUBA 4Q15A 4LMRA 2X3UA 4XVCA 1FXWA 1EI9A 3IP7A 3P9CA 3OPTA 5KSYA 1CZSA 4BFLA 1O5LA 4RJJA 3LDHA 1IAQA 5FNVB 4MUFA 2AZ5A 1FK8A 3RDPA 3CH6A 1W1WA 2QUIA 2HWF2 1RHQA 5L9BA 4QIHA 1YS1X 3PDWA 1CVNA 2W93A 5SZHB 1Z7WA 1Y63A 3KXLA 4YROA 2RMU3 3MBWA 3THDA 3CW8X 3D7RA 2CSXA 2Q2WA 1I2MA 3RFXA 3IQHX 2XBUA 3OQVA 2BHLA 2OQ6A 3VR4D 1CT9A 4M7OA 2A0WA 1D4FA 2PJRA 1MS0A 1I3HA 1XEXB 4YH1A 3D0JA 3PJEA 2FU5C 4V03A 1G19A 5CUQA 3CF4A 5JAIA 3TKYA 3DL7A 4NPLA 3WHKA 1DQRA 4F6LA 3HO8A 4EECA 1SACA 1E2GA 2FV8A 2HHAA 2CLIB 4C2TA 2QZSA 1XIVA 3H0CA 5KSWB 1FY2A 4ER5A 1QXPA 4I66A 4I4TB 3ZDZB 1CUYA 1M6VA 3AXTA 2IUWA 3RS5A 3DVAA 3W9SA 2H7CA 4OYHA 3K2QA 3G8YA 1OFHA 5EHIA 1ARZA 2JJ6A 1RZRD 3TOXA 4Y1RA 4RHV3 4ETNA 5JOQA 4J1TC 1KJIA 2H9IA 5J4VA 2JGEA 3DKQA 4TL6A 4N39A 3WBFA 4ZAFA 3LPDA 1II8A 4ALMA 4JT9A 5FZOA 1FNYA 3CXRA 2QQJA 1NZJA 5DTRA 2ZU0C 1L6RA 1QJZA 4CMHA 3ZOZA 1ODJA 1HLCA 3L04A 2HY7A 5J4HA 3CVOA 5FYSA 5A2GA 4UFKA 3Q3EA 1EK6A 2DPMA 1ZBE3 1J8QA 5HDQA 2CHVA 2Y4NA 3NWEA 4KHZA 3WHLA 5AHXA 2NPIA 1Q43A 1PX2A 1CF2O 4YBZA 2OQ2A 3NHFA 2IVIB 1SKYB 4LXQA 4CDUC 2IIBA 3LRPA 2ZGUA 5BMVB 1EUDA 3EA5A 4Y0NA 1IHPA 3AERA 1AR61 2H7YA 3IV7A 3N35A 1NA1C 3VKFA 1ZQ9A 4FE7A 3TQSA 4CEYC 1UWCA 3BKZA 1JTVA 3A4TA 3G59A 2QNKA 1AQIA 2IWRA 2YHUA 5FLKA 3AYAA 2X19A 2FB9A 1GANA 5CW1A 3C6QA 3G02A 2CXTA 2FSVC 5JQWA 3MUOA 1U8YA 4I36A 1D7OA 3JB4C 2NUPA 1JUHA 1D7AA 4BKRA 3R5HA 4EABA 4GVPA 4CN9A 1UAAA 4BNLA 3GF6A 3STVA 4Z49A 1EP1B 4GHWA 2MSNA 3EZ2A 5DHFA 1PV1A 1XZNA 5CBPA 1Q0ZA 3IUJA 1OWOA 1QTQA 4D3DA 4ENQA 3I8SA 3W5AA 4UW6A 4Y22A 3AHIA 2Z5GA 1KO1A 3U4AA 4OU4A 1GPKA 1Q7BA 1Y3IA 3Q4GA 1P1HA 1GV9A 2AW5A 4MG2A 3G8BA 4D41A 1DVRA 2CYAA 3LPFA 3C6KA 5ELXA 4IWXA 1MVEA 2EIGA 1U0EA 3D4OA 5K0FA 3OP4A 5DE3A 5DUUA 1NVUQ 1C1LA 3X1XA 1LLQA 3TE6A 4JCKA 3LG2A 1YJ5A 2WIBA 3RUAA 2RBKA 5D3MB 4EA8A 2L19A 4MUBA 4NV0A 2GYUA 1IEVA 2R6ZA 1WE2A 4BUZA 2B1JA 5AHWA 4HH0A 4QX0A 4MWSA 3KOOA 5L6LB 4RIHA 1CPMA 1P1BA 1O6BA 1KI7A 4DA8A 5HF8A 4DHWA 5DZGA 1VYHA 2Q1XA 1RUI1 2X1HA 3PHIA 1JZQA 2RGAA 1DQZA 2E9QA 4J7UA 4MS3A 4Q1DA 1PKEA 5IH3A 1OT5A 2E32A 5CFDB 1G20E 2XJTA 4Q4W1 2AFVA 1OLMA 1XDDA 4NBRA 5D1HA 3I6YA 2J07A 2PAKA 1XZLA 3MS4A 2ZIXA 5ABPA 2RS53 3FPAA 2CL0X 3TL6A 4N3GA 2ZM6B 1PJCA 4LQCA 1DV1A 2JB9A 1C29B 4Y6PA 1VB3A 5TS3A 2CLSA 2QZ3A 2OD9A 2UZ4A 4IDHA 1MZFA 1O3RA 3T4XA 4GX0A 3ECCA 3ECQA 2J41A 2UXBB 2PLV3 4EP1A 4MUNA 4YTEA 4EMSA 4GWGA 1NLUA 2PTHA 4S2EA 4BFSA 4DMUB 3P2EA 3QU2A 1XO1A 2V4MA 4C4SA 3F95A 1KPHA 5BR8B 1YCFA 2V5DA 1RACA 3H3FA 2J1AA 1MX1A 2BV3A 5TVKA 4CQMB 2NXJA 5LW9A 1SU4A 3VBSC 4XGNA 5EEHA 1D4ZA 1BFDA 4Q6BA 1TTQB 5FCDA 1ENOA 4DT1A 2GZ1A 3RG2A 2D5FA 2AD1A 4BMCA 5G02A 4XZ3A 4S1TA 1DOAA 1U63A 4ZO8A 3I2JA 1SVNA 1FXWF 1PO23 2WIKA 3ICQB 2Z83A 2HWXA 1XYGA 1EU1A 1T8PA 4ZI7F 1BX3A 1JSZA 3MRTA 3WJ1A 1DQ4A 2E48A 1RLOA 3RC9A 2C5GA 4ME6A 1VBFA 4LA4A 4MUMA 2IOHA 3L2OB 4DLSA 2HJSA 3GJSA 4CM7A 1R64A 1U6KA 3PDIA 3TR0A 2QLLA 1Q22A 1IBCA 5JZGA 2P9EA 2NU7A 2J33A 4NNPA 1XEWX 5LA6F 1IKPA 4F2WA 3F7OA 1CRZA 1WOMA 4OQXA 4JVLA 1JQEA 2GZWA 1KR5A 4G0NA 1NDQA 3FNBA 1UT6A 1PFKA 5DK6A 4KPFC 1MD9A 4YRNA 5FZ6A 2F62A 1JYFA 1IK4A 4HOYA 4JR2A 5DHAA 1F06A 3ND8A 1E5TA 4LTDA 3SNKA 1Z0FA 3BE5A 3TN91 4UTNA 3NHZA 1VGVA 1BWQA 2XG3A 2CV2A 3ISJA 2BRUC 1RINA 5AJVB 5AM4A 3TW8A 5IWCA 1L7OA 1HSOA 3B00A 4RHV2 1JZ6A 3MJEA 2JVJA 5I7FA 1R1A2 5LYJF 1N5OX 2R16A 2LDBA 4FLFA 4JENA 2I34A 1K4MA 1N47A 4HBZA 4OFXA 3DCYA 3PHLA 3SKJE 1W8DA 4X61A 4FQ8A 5JO9A 4EJ2A 1ESMA 3V5NA 3GCGA 1QKKA 4C89A 1X50A 2DUWA 2WNIA 3CZ5A 1JBEA 2IHZA 3DDWA 1GTMA 2J3QA 5KOJA 4G4SP 2CZGA 4CP9A 3O4IA 3SKXA 1HE1C 4UE3S 1AJEA 3THOA 1XMPA 4BLRA 4B7CA 4R4ZA 1OLUA 4O63O 2R8XA 4J29A 5DOZA 4XDYA 3VSDA 2YGMA 3D8TA 2UYQA 1G8JA 1C3HA 4EI8A 3ZNPA 8MHTA 1A3CA 2UZAA 3NUZA 2CDCA 2H0BA 1FMLA 1M67A 2G5CA 4V3BA 4YJ2F 2QBXA 1BXHA 2AG0A 3QFHA 3DVAB 3IOBA 2JAXA 4ZIRB 5K8UA 5LBFA 3PPVA 3AI3A 2FCVA 5DXDA 1ZIYA 4M7WA 4QXKA 5BY2A 1OQ1A 1BMFD 1N5DA 2GA8A 3GEIA 3GW8A 4CCEA 5A2QA 3VKMA 4FSJA 1YA8A 2JFQA 3Q40A 1PQPA 1X1DA 2CWWA 1OPOA 4Y6GB 1E3WB 1OH7A 2HQ1A 4AYTA 2ZCWA 4HH4A 1AURA 3ECAA 4GMGA 4XWAA 2CUKA 3QH7A 4KQFA 4C2AA 3UKVA 4FP9A 4YT2A 4BYMA 1YFWA 1LK7A 2XBO3 5KVSA 4L4XA 3AKCA 4Z4IA 3TUJC 3ETJA 1FX5A 2XVKA 4RMHA 3SE7A 3ORRA 5TIIA 5KCZA 1IOWA 2XA2A 1H2WA 4AW9A 4W1RA 2WNVC 3K51A 4K87A 3G2LA 2HM7A 1NZDA 1H8EA 2PSSA 5IABA 3EGXB 2DWPA 1KYZA 3LFIA 1KMQA 5TE9A 1SHTX 5DDJ1 1V6NA 2WN3A 4AGVA 1PR2A 2VJKA 2BJWA 3TX6A 2A33A 3EXFA 5J37A 4HRXA 5HR5A 2QQMA 1RI5A 1OOEA 2YV4A 3QMVA 5IHPA 3A21A 2HWE1 2CNWA 2DPGA 2Y3IA 4MQ6A 4BCBA 1KWKA 1LWNA 1DAKA 2GU9A 4DQUA 2PPLA 3OU2A 4PYQA 4XCAA 4IEEA 4F85A 1WB9A 3ZS9A 2PBRA 3QOFA 2F3PA 1PYDA 3HDGA 5TQ2B 1X77A 4Q5OA 5B58C 2GHRA 3HEIA 3FZYA 3C7OA 2CFRA 2NU8A 5KNBD 2R6QA 4BQIA 3FWZA 7MHTA 4RA9A 4BNNA 3CQOA 2D1YA 3EZNA 2BEJA 2WWYA 4ITCA 5IBQA 5JBNA 3KQPA 3I0MA 4J1SA 4CV3A 2XAUA 1U5ZA 4Y1YA 3VBRC 2X1MA 1P9LA 3PB3A 5L6MB 1VE0A 5FP8A 3M6AA 4YONB 3RR2A 4YAUA 4B1LA 3BL8A 3LUBA 3GUUA 4XOUA 2GILA 4ER3A 4P80A 4DR1B 1JXQA 3WLKX 2D5HA 3QG1A 4XFAA 1KI9A 2DTEA 1R8JA 4L8FA 4IXLA 1E58A 3P8ZA 4WUVA 3GOQA 4UU0A 1N3OA 2BN4A 4JU9A 5A03A 3FVQA 3A6PC 2RIPA 3FDXA 1ZMXA 3MQ4A 4XW3A 4WY5A 5AVRA 5MDHA 2E4AA 2FSVA 4RDIA 3ZV4A 4JLAA 2HK7A 4BZZA 5MHTA 2PH7A 1BKSB 3FDJA 2XNSA 2XMCA 3SHRA 2X5IA 2YROA 4DR3B 3CVJA 3T5GA 1OTYA 1U2DA 5DT9A 3NC4A 4ML3A 3HK2A 2QUOA 1AS0A 5FPLA 1JGTA 4IEXA 4OFWA 3UUWA 2XJUA 1DF0A 3QXSA 5C5UA 2XT0A 1A6CA 2G1PA 1T0BA 1Q84A 1VE1A 5JRDS 3AH8A 2J85A 1QG6A 4M8SA 3H5RA 2PSFA 1Z68A 1BMFA 4UEWA 2OM2A 1A4UA 2ADEA 3ROQA 5A7WA 3NYWA 4R05A 3VR6H 5JAOA 5KNCA 5HE9A 3V48A 1P74A 2VMIA 2JDKA 2HYKA 4N5IX 3GNLA 2CC2A 1M83A 1XI2A 2CFTA 1MJNA 2O8CB 3W3AA 5C8YA 4GPZA 3P0IA 1G5IA 2HL6A 1O7JA 3QYJA 2VECA 1OSNA 2ZJ8A 2B9UA 4QGLA 3P20A 4N8EA 2FFBA 1VJTA 2BFDB 2VZ9A 4RDCA 4WLFA 1U99A 1WVGA 5HNKA 1DAEA 4E6PA 4OFBA 2H18A 5IT4A 3PQFA 4Z2YA 2VDVE 3TX2A 4RESA 2F7SA 1R5BA 2QF7A 5E0OA 1LDGA 3RV4A 5HFJA 4JLKA 1PFVA 4QKDA 4GE3A 3BMOB 1NSFA 3UK1A 4YBRA 4FFSA 5EIYB 1XHFA 3MINA 2QX9A 3WB2A 4NARA 2AE2A 4U3JA 4KN5A 1OFTA 2BOVA 4RL7A 1X92A 2ZB2A 5AW9A 2PA3A 1QRRA 1T25A 2IU6A 1QHSA 1GSIA 1X38A 5F7XA 1C8VB 4NQZA 4MSVA 2DUPA 4GMXA 3WDVA 4JXKA 3OFKA 1YE8A 1CNMA 1R7RA 1WCWA 3C48A 2WWFA 4D0LB 2HPVA 1W6QB 3JZIA 3GDOA 4BGEA 2GXAA 1KOGA 2GRAA 2ORED 1Y7BA 2JDAA 1PCXA 2EJUA 1Q7RA 2N1BA 1H1LA 3REGA 3Q41A 1PGOA 1LBQA 4DUVA 4BUCA 5IH7A 1GMMA 2JGJA 4YJGA 3MQ2A 4FPOB 3K5HA 1PIV2 3BYWA 1L5SA 3HYNA 5EP4A 3LQYA 2XJ9A 3AKEA 3WQQA 2RS33 4OKNA 5E8AA 1E2KA 4Q21A 1MS3A 2CLEB 3WK6A 5AVQA 2FRXA 2LPMA 3GHHA 2ZHLA 4ITRC 1UXKA 3M6LA 3OOEA 1T8TA 2FYTA 1K27A 2QTAA 3N5CA 1QNLA 3CXUA 5FF9A 2CEKA 3M1HA 4CCCA 4XARA 5DYYA 1RHJA 5JMTA 4LK3A 2IGBA 5CA6A 3D2BA 3B9BA 4MUEA 3B3GA 2ZPTX 2GN4A 3VVBA 1P17A 1WD5A 1V6AA 4XMAA 3GVPA 4KZKA 2DLCX 3IR6A 1PHMA 5FV4A 3EOAI 3H1MA 5FUMA 2J3LA 4M1SA 4W6WA 3NNLA 5ILOA 5CITA 3RFVA 1RRMA 3N6VA 4RZ3A 4EY3A 5IEJA 3K96A 1NBWB 5LQRA 2G83A 4TUYA 4BE3A 1HR0B 1AH2A 3IAQA 2ONZA 2WTXA 1F51E 3D6JA 4J3NA 4YRIA 3H4TA 1CIPA 1CJTC 4QJIA 4BNDB 1YFUA 2RHTA 3WVJA 4NQRA 3HM2A 3MCVA 4MV7A 2HIMA 3BGIA 4WBNF 3UGQA 1EE2A 5FZDA 2W11A 5HILA 2JIQA 4CI9A 1UKAA 2WSBA 2NTNA 1D09A 3FGOA 4DLVA 1K7EB 2W4QA 4OLAA 4TTJA 1NDHA 1JDBB 2ZTVA 4RAOA 1XLTC 5COQA 3ZHOA 2FSUA 1WSWA 2B9EA 2DQZA 2IYLD 3QNWA 3AKRA 3B94A 2JLXA 1HB2A 2ZFUA 3ANLA 2P65A 3AR7A 4D98A 3L9XA 4MPPA 5MGBA 1VMDA 1MEC1 1W6OB 2WTBA 3HHPA 1W3XA 4U2KA 2OE2A 3AEQA 1JWBB 2VRCD 4LI3X 5F39A 3A3OA 2UVDA 5JUVA 4KPEC 2FFAA 3L7IA 1VI5A 2G63A 3AILA 2O8EB 3AJ9A 1JU4A 2IXDA 1M34B 1D07A 3NKGA 4OHOA 2JJYA 3BXGA 5JS1A 4JN6B 3HVJA 1FSGA 1QLJA 1XTVA 2CXQA 4JTOA 1VMIA 3JVUA 1Y6ZA 4PFSA 4W1QA 2OCXA 2CGNA 2OHGA 3AI7A 3AU8A 2NW6A 3MHPA 3GH1A 1R50A 3HSSA 2WF5A 2CFSA 2Y67A 4Z0PA 5IKXA 1YQUA 2ZR0A 3I8OA 3X1DA 4Z2AA 5JDCA 2ZMLA 1SUDA 4ZREA 3IAUA 1D0GA 1D2GA 1W3VA 2QTGA 4JJFA 4IDEA 3GJ4A 4HATA 1VLHA 4LE3A 1LTHR 4Z7OB 4WDRA 2QQGA 1XA4A 3V80A 4BQXA 4CM5A 5B37A 5EESA 5FNVF 4UF0B 1VKHA 3WOHA 5LA1A 2CJFA 4S2HA 4QQKA 3WB1A 1V6SA 1OKOA 1W2GA 4EGSA 4UFOA 2J09A 1QFYA 1KTVA 3FCCA 2X42A 3KE8A 2BTQB 2DUJA 4PVCA 5CLQA 3ANTA 4X7MA 2ECFA 3TB4A 3WG2A 2P7HA 1RHKA 4U3JB 3AUTA 4KWTA 2R071 3IILA 2EJTA 4FFVA 1E2UA 5CA1A 5HQ3B 1D4AA 4KIWA 2AN3A 2R1BA 1Z82A 5AKHA 2ZYVX 6YASA 2J1TA 1G5FA 3IVCA 3A4VA 3UO8B 2REQB 2PNFA 1I24A 4ES9A 3D59A 3EGOA 3VD7A 4KACA 1ZWLA 3W2GA 3HBMA 2CB0A 3GAAA 3M1AA 3BRWD 1SQ4A 4CPBA 1QIDA 5HCHA 3DQZA 3KP1A 1HDZA 2SCUA 3VBSA 2WP8J 2CN1A 2XMGA 4JS0A 2C2KA 4AJLA 4MWDA 2WTAA 4HMPA 1DSSG 4MARA 2P40A 3QELA 3CNHA 1GU3A 2P4HX 4UEOA 4ZPXA 1ZC3A 2EX1A 2RHJA 3E5NA 1VKRA 3KLNA 3VHOA 3N76A 3ZKYA 3DOFA 4RVDA 1CZRA 3T41A 4H3SA 1WD7A 2RB5A 4YFVA 1KF0A 2ZZQA 5EXOA 2AEJA 2OV1A 3DLTA 1T5SA 4X62B 2CWDA 1X2BA 1ZNQO 5AO9A 4PHTA 1Y4DE 4ZVLA 3LCRA 2J3MA 3DVSX 4NFYA 1AQUA 3T1LA 4RMJA 4C7OB 3TJMA 1E3SA 3VZKA 2ANBA 2H1SA 4GNRA 1J9ZA 1WLCA 3T9BA 2JKVA 3ROGA 5E1OA 3RPEA 5LU9A 3FYUC 4EY5A 3RS9A 1DFQA 4PX2A 2VK8A 1S2LA 5KKCA 1CPNA 2HOQA 2OS2A 2P6RA 3GVXA 4BKUA 1SHUX 3O26A 2OCGA 4U2CA 5SYNA 4R5MA 3ZIAA 2NM1A 5HIIA 4PANA 2VJNA 6Q21A 2X9NA 3EE6A 2WHEA 3PQCA 3MV01 5EIFA 2GTPA 5I8WA 1YZUA 2OUHA 5CB6A 1L5NA 1KI2A 4XWGA 2EFDB 5E1BA 5J5CA 1E98A 5LB6A 1SG3A 1JHVA 4FPFA 3T1YB 3WLPA 4EBFA 3NDJA 3LHKA 4HLQB 4DWWA 1AUYA 1CLEA 1NFQA 5F9TA 3ICVA 1UOQA 2HLEA 2BGMA 3L1JA 4J7CA 4ZDWA 3WP1B 4Y1ZA 2GNMA 3SYNA 1AKQA 5E16A 1V0AA 4DMRA 1NBMD 4DM3A 3H99A 3QA9A 5BNOB 3SEQA 5JZGC 3BGWA 1E6WA 5L3QA 2PZ8A 3U75A 1MRSA 4HLUA 2HA6A 3ATGA 1CJPA 5ULLA 3OPYA 3HYTA 5ESWA 2QNRA 4ALNA 4KU7A 5FXMA 1BYIA 2VYND 4RFLA 2HF9A 4YFWA 3NPMA 1G17A 2JGLA 3M7AA 2R66A 5FYDA 4IIHA 1ITZA 1ZVVA 4UQOA 4L4SA 4YCBA 6NULA 4I14A 3LCUA 4FLEA 4KIUA 3AF6A 4ALLA 1C1YA 2ATEA 5JCOA 4IKPA 3F9RA 1LRJA 3AVXA 1SG9A 3IURA 4XF1A 3UMVA 3ZCXA 1R9MA 4TXNA 2ZX4A 2GP5A 5K3FA 2IUUA 4J25A 3LSTA 4J0DA 3IT2A 2X2EA 4I1OA 1FLAA 2PSJA 2WYHA 2B4QA 4YW2A 4Q27A 4AQ2A 5B53A 2FNAA 3AC0A 1NBHA 2EAAA 4XLTA 5CADA 2FJUA 1WS6A 3KT0A 1UBEA 2BONA 3OZDA 1H1AA 4HKTA 5IAOA 4LNVA 5K8VA 2WHQA 4XABA 3AVUA 3FDZA 5J3UA 1R00A 2WTNA 1SCUB 1UQTA 4RA0A 5ECGC 4HUQA 4CLDA 2JG9A 1P2SA 1N1DA 3D0SA 4MKHA 1CNEA 3TYXA 2OWDA 3IQEA 5LQNA 4AY3A 3U3XA 3GY0A 3M5WA 3TB6A 1Z2PX 5AIAA 2HKIA 1J90A 3R0RA 4GZ6A 2A7AA 3AY3A 3ZV5A 4I19A 2Q8QA 1OFSA 1FDRA 3REFA 3UGGA 4BNGA 4EG4A 1ZW1A 3THWB 1CESA 2D6NA 1SLAA 1R9GA 5DI3B 3B8EA 3SYRA 3AVTA 1QO9A 3PPWA 3CEPB 5ALVA 4B4WA 4AURA 2LE0A 1O8CA 2A9VA 2GPAA 3K32A 1L4BA 4YJHA 5D3MA 1RJGA 3LK6A 4YW7A 1CQPA 2I54A 2WC2A 2BC9A 3W2EA 3RHTA 2FW8A 1JZ7A 4KH1A 3ZYBA 1Q3EA 1G9XA 3ZIAD 2P41A 1VIYA 4BMSA 4JGYA 2Q6LA 3JU3A 4DIEA 5DGXA 2P5SA 3ZJTA 1B2RA 1U0OC 1JXOA 3OJWA 2CV0A 2EXKA 1Q1BA 4LZLA 4O4IB 2XODA 3KHBA 3CE6A 3GFSA 4K9SA 5J40A 2F8TA 5LLTA 4YRCA 3VKNA 2II6A 4M0UA 3RUEA 1UKEA 3VYVA 2W1UA 2FMXA 3JQ8B 3BH0A 3WLAA 2DCUA 5EAIA 1ONOA 1NVFA 4L73A 4LRQA 3JQAB 5DHTA 5LQKA 4FPLA 1THMA 5KO2A 3R41A 3L40A 2YCBA 1R6UA 3BZBA 5LUBA 1V8DA 1U7OA 4RUKA 2G5GX 4LXLA 3ZYCA 1UJ5A 3RAFC 4RS5C 3AM5A 5DULA 4I81A 3VDBA 1LKZA 4GX2A 2YS7A 4JEUA 1R1DA 3U4CA 1E32A 2JICA 1OBCA 2PLV2 1XGKA 5JYCA 3U9LA 3LE8A 4RXTA 3S6PA 2ZAIA 1VMAA 3PIDA 5DJ5A 1P1RA 4X45A 5FZ7A 5EYYA 4KPYA 4NIGA 1G5RA 3IVGA 4RQBA 3UUEA 2GEDA 4FT8A 2Z3VA 5FYYA 1DIHA 2FA9A 2I1VB 1S4QA 1Z33A 2ANCA 3GFQA 3P1JA 5FV3A 3RSCA 1MEC3 2XMSA 1TOAA 5T41A 1QIIA 3P9SA 2R25B 1BXRA 4G8JA 1SVMA 3ZVMA 1UZZA 1YFZA 3DE7X 1GPH1 3OPYI 4JV5B 1WA5A 4RQPC 3LXMA 2BZSA 4LO8A 1YR6A 1KSGA 5ALHA 1NW4A 4XF0A 4QU9A 3WQSB 4S1NA 3E7WA 1QUFA 2HA0A 3BWCA 3F97A 3HXPA 3BIEA 5LA0A 2W00A 4QULA 1IPFA 5J2UF 4E2XA 3GLQA 4IDGA 2G9GA 3RVSA 5CFDC 2J1VA 2KSQA 1PL6A 3UGFA 4NMMA 2QJFA 4RK1A 5GLUA 3AUXA 4MX8A 2VPIA 2WBLC 3DAPA 1VBC3 1YU6A 1X7ZA 2YWJA 3I83A 2PXCA 2QA5A 3RIXA 3ZXDA 4ZAYA 3RC1A 5HBAA 2WU3A 5BQXA 2DR0A 1PKXA 2ZIWB 2B39A 4DC1A 3RYKA 3HKEB 4ZKDA 1G60A 2UXDB 4TVBA 3P9YA 1WCYA 4LS3A 2JI8A 3IQDB 5FIXA 4NJEA 3GFGA 1Q95A 3OJEA 4OVEA 1JE1A 3QVWA 4HZIA 1IG0A 1ULGA 2BFEB 1U0GA 4C08A 4SBVA 5IS2A 2HJWA 4DS0A 2OK7A 4CM3A 1EAH1 4YAIA 1FNBA 5D5PA 2YQ5A 1UW8A 1U12A 3D54D 1RTKA 1TUGA 1M72A 5ALIA 4WX2B 3WZMA 2QLJA 3A06A 4QNRA 4Q1FA 3QVGA 3RZLA 5AHOA 2B4YA 2C4MA 3DZGA 1FLDA 1QJU1 3OX4A 3CUEF 2ZYSA 1JN0A 1LDNA 5FPQA 2UWCA 4IDBA 3JWJA 3HZOA 3R3JA 2G6TA 5KU7A 3PXGA 1D4M3 3I37X 1SNYA 3OTOB 1Z5WA 3T54A 3IVXA 2F6BA 3FHLA 1LJ7A 1IOAA 2NSLA 2HMTA 4OHKA 4DRXB 5TQ2A 3HBJA 2AACA 1MDBA 3ZOKA 1O7FA 2P7IA 4JI3B 4YCSA 3M1IA 3EGIA 5IC6A 4PZDA 4HCJA 4O8ZA 3TEFA 3LPNA 4MQBA 1R3DA 4QKNA 1PGL1 2OY0A 4F6RA 4P08A 2YH2A 4YCMA 1WBBA 4IJQA 5IC5A 3QVMA 5E9JA 3FX2A 3TZQA 2JCSA 1IMOA 2TYSB 1UPCA 3S27A 3B3JA 4BU0A 4CIXA 1P1KA 2V5VA 1ZUHA 4IHJB 1RP7A 1YO8A 1IOZA 3NIGB 3M5CA 5ISMA 2NQYA 3P0RA 4G4FA 3CR3C 4ZAXA 2Q30A 4HG2A 1AJOA 3W2FA 4BFVA 1ZINA 4J7XA 1QONA 2BGLA 3BAFA 1ENXA 3I4CA 2R063 4YRGA 3ZQUA 3KIPA 4JL5A 5LQUA 3L77A 1EP9A 4BJ6A 4E2FA 5E3HA 6AT1A 1ZH2A 1Z07A 4IEUA 4AFCA 2C57A 5G2OA 4S1OA 3B69A 5CM8B 2JH9A 3R3WA 2WS92 1AB6A 2KD7A 1CIJA 4HQKA 1XBTA 5E7QA 3APBA 3KJFA 1GWMA 1H2HA 1W0NA 2VS1A 3IFSA 1IS6A 2LROA 2VYQA 3WWYA 1NPDA 2FW0A 3CG4A 2B4AA 1F0PA 3DEFA 3RIGA 4WXHA 3U14A 3M6UA 2BHRA 5FTKA 1S4MA 3G5LA 3R5SA 3D3JA 4L08A 3NKLA 2CUZA 1XTKA 3A9RA 3IRVA 1O8BA 4DUZB 1CAWA 2NT4A 4XYBA 4DQKA 3ER8A 2ZYAA 5CLGA 4LKDA 1R6AA 2AC4A 1JLLA 4QKQA 1NVVQ 1F2NA 4LDPA 3EC1A 3KHTA 1CAXB 4M8KA 1RUNA 3D8CA 1SBEA 3EUFA 1OXMA 3MCZA 5F2NA 2H1RA 3LRTA 1F5JA 1MB9A 4H6VA 2H11A 3GP3A 5KBFA 2ZMNA 3QV2A 4RQTA 1XG5A 2VZEA 2A5JA 3L2YA 1GP6A 1VBNA 3LF7A 4IIGA 4OGGA 5J48A 3IMKA 2B9VA 4MKFA 1CP2A 1CE8B 1UM9B 4WW0A 2E7ZA 5CTAA 1EVEA 1MCZA 2HWWA 1HDRA 1U81A 3WY6A 1EB8A 4UHBA 3R6DA 3W3ZB 2OQ7A 4AEMA 1GTG1 1EK1A 2C3YA 1GAJA 1U8TA 3BOPA 3KXKA 3D3WA 1A96A 1SH7A 1OBFO 3QJYA 1ZM1A 4D94A 4P9IA 1FNZA 4WBBA 4E12A 1O57A 3ZYZA 1RWXA 2H3HA 5BMVA 2BGNA 4ZVKA 1V6OA 1W6UA 1K89A 4QUAA 4FBGA 2C84A 4XJZA 1CEXA 3W8DA 3A6LA 3Q2OA 4O5OA 1I3OA 1K75A 4OD0A 3OUTA 1RXSA 4NH0A 4LJ4A 3VZLA 1E0DA 1YRAA 4FKMA 3OD5A 2AXNA 4ETMA 4GQ7A 5GAJA 1KXZA 4BJ5A 1IJKA 2PHUA 2JBAB 4EQ6A 3JWIA 1IQDC 1VIDA 4QRDA 2V1UA 1LPAB 3L4KA 1V6IA 4GQIA 4HRVA 4RVSA 1G86A 4BMBA 1NOIA 1MENA 5ALOA 3IOYA 4R84A 5A7PA 1EK2A 3ZFEC 1E66A 1GZ4A 3GI1A 3EXIB 1APNA 3CRNA 2DXIA 3DOUA 3HFRA 3LA6A 3KF5A 3TJRA 3O3NB 3TSWA 3ADBA 3THYA 4D0SA 4V0SA 1T3HA 2IOFK 2ATVA 1OPRA 5E6RA 3GB9A 3QIAA 4AWAA 1AA6A 2KLBA 3ME5A 2AD5A 4G2NA 2LTAA 1Z0UA 2VNHA 4H7KA 4LECA 4UTOA 4H3HB 1C9YA 3GZJA 3NV1A 5EYPA 3IT0A 1XZAA 4IJ6A 2XY4A 1GLGA 1QCDA 4DV5B 5K45A 3PUJA 3BHNA 2X9GA 5FTLA 3GT4A 4X24A 2XCSB 1V9U2 5CXSA 3NJYA 4JKMA 4QHYA 5GVSA 2OK8A 3ZFEB 4BHPA 2WVJA 4JLOA 3GPCA 4S12A 4QAWA 2OGZA 4KR7A 1IS5A 4FT4A 4EA6A 2EQAA 1DRJA 2CL7X 4DC9A 5BV7A 4ACAA 1VAVA 1RC6A 1OD6A 5AFBA 2QSYA 1ODLA 4RZIA 4DEQA 4ZU3A 3WTCA 2HWD3 4ZYLA 4V24A 5CFDA 1U3FA 2B8NA 3GAMA 2EWMA 3F6RA 1UXGA 3H0OA 3VHXA 5FZFA 2XNCA 1EFRA 1C50A 5CDHA 2BKVA 1NUQA 3BXOA 2ZIXB 5T6BA 4QEKA 4KL8S 2GMMA 1OILA 2CLDX 2VF8A 4B40A 1N8KA 2P9ZA 3PKZA 2QDRA 1UODA 5K3AA 1P1CA 4YVSB 2QDKA 1VXOA 1PDWA 4UTXA 4XDHA 2JLUA 3RRFA 2C77A 5EKUA 5MGNA 4WCVA 1CX4A 3K5WA 2PZBA 4CKWB 5EXXA 4K6HA 2PZLA 3LFUA 5LY1A 4A6EA 3BK7A 4ZHQA 4MV3A 4R1NA 3PUXA 3SNHA 4CQMA 2AQKA 4D0RA 2BTQA 2PTGA 1FYWA 3WTBA 5D84A 3OPXA 4AFMA 4M9UA 5KU1A 4X1YA 3MFQA 2QI9F 2A3NA 3TN7A 4MOWA 1H94A 2J08A 1J23A 3ZZNA 4QPWA 5E6UA 4DCJA 4FE3A 7GPBA 1GOFA 3NP7A 2BFUS 3VN4A 2XBLA 5HXAA 3PX7A 1LW6E 1AQJA 4M3CE 1Y3CE 4N3CA 1AX1A 3WIUA 3VZMA 5A0FA 1GGFA 2BH2A 1RPZA 1OIWA 3G0BA 5F2EA 3I3QA 4TZKA 4RTKA 3ZKWB 4PNHA 4JKIA 3EXHB 4W6ZA 5JH7B 3JYPA 4Y3UA 2E37A 3OIYA 4OUDB 4DWVA 1D5WA 2IGTA 5GZ3A 1KVSA 4FKZA 2H5EA 4CUAA 2I87A 5AKJA 1UJCA 2R8RA 1QB8A 4PQ9A 2W5UA 2PUCA 4HDOB 2VSXA 5DLEA 2BFWA 3D0KA 1NKTA 1V6KA 3GRFA 5KYXA 4MCJA 2ZSUA 5LMCA 4QBHA 1C4RA 4Y2XA 6PFKA 1LLUA 1PO21 3UJCA 1N5IA 1UWLA 3H18A 4LHLA 3I04A 1PSZA 1ZGHA 3B2NA 2FCUA 1GXSB 4U7JA 1NYTA 4AHXA 4YRSA 5A7QA 2BGOA 4UXIA 4TVKA 1WMDA 1IWOA 4LLOA 3PIJA 3G2QA 3HCCA 2IPXA 4CMIB 3X2EA 5KOJB 5BSRA 4RW0A 2R6HA 2WYVA 2W6ID 1C7EA 4AVYA 1ADCA 1P2VA 3AL5A 4IM7A 4O2AB 3JQ7A 3PWZA 2HBQA 4AM8A 2H48A 4URXR 5AHRA 4MUVA 3UB4A 2F8LA 2JIJA 3THYB 4NCNA 1JE0A 1R2QA 2BGTA 3HXOA 4HFRA 3E1GA 1DRKA 4LNHA 3WA7A 2QZZA 1N4AA 1IN6A 1X8JA 3OGGA 1WLYA 2HWF3 5I7SA 4CLRB 1OLXA 2ZEZA 3OBBA 4UASA 5DM1A 3LP6A 2WZEA 1TM3E 1YS6A 3SEFA 4MRNA 5DWQA 4NIAA 2VUIB 2OFOA 4M53A 1TC2A 1J1ZA 1M1UA 1DC7A 3V0BA 4FFOA 2J1RA 4TMVA 3H9CA 1BHO1 2Q3BA 1CYEA 3ZDEA 3P3NA 5AW4A 3NM5A 3CL1A 2UZ1A 4HDSA 4Y98A 4UPEA 4UBKA 4BEVA 1WO8A 5CB8A 1YRYE 5F7OA 3GF4A 2M6LA 4HUJA 5DG1A 2ABWA 3AR2A 4L9RA 3HJGA 4RMNA 4WAUA 3UKOA 5CA1F 2ZYRA 1H6AA 2ZUBA 1TCUA 1MLDA 2Y6JA 3R3VA 2MOKA 3SEZA 3H0KA 1FUKA 4YALA 1Q16A 5LU8A 3IAHA 3SM3A 2Z2SB 1POV1 3QPUA 1DJLA 1HFJA 3TZHA 1MC8A 1JFFA 1SCKA 5K9ZA 5KZMB 4Q8LA 1P7ZA 1L1QA 1MZEA 4D81A 4PHGA 2WMDA 2REXB 2ERFA 3MWJA 2RHGB 4J3FA 4WOJA 3LP5A 5EWLB 3TK1A 2GF2A 1ZK4A 4CDRA 1JLSA 4RV5A 1KXJA 3KLMX 1XZ8A 4M98A 1CJVC 2A0KA 4DGQA 4Y6LA 4UUMA 4M55A 3CEJA 3RRDA 3SX0A 4TYQA 4EELA 1WL8A 3AP2A 3VH4A 3KTDA 3IVRA 1QZZA 1RMU3 4OCTA 5BWMA 4H4CA 3RVDA 4HXYA 4AT1A 1KAEA 3NOOA 2DBIA 5EVJA 2SKCA 1TD9A 3BM5A 3PDUA 1RUD2 1P8AA 5EJ5A 2ZYTX 1SOVA 3MWFA 3F1LA 3WMFA 2RG1A 1EFCA 3EIFA 2BHNA 4Q4DA 1KMCA 1ZCFA 4CCJA 2R6FA 3KB2A 1QPGA 4YZ1A 2BW8A 3GELA 3LW8A 2AC7A 2VAVA 1RUE3 3GLRA 3EJWA 3C97A 2HU5A 4PGHA 2Z1MA 1XT6A 2R6CA 2OILA 1O6GA 1MABA 4D92A 4W5QA 5DDJ3 4OSPA 4JHLA 3K09A 2F8SA 1DFGA 2E31A 1ILWA 3FL7A 3PXXA 3EZ7A 3QP9A 3SFVA 3U1TA 1K6XA 1T9DA 3SSMA 5CFCB 3SBOA 2FPWA 3IPAA 3TLYA 1E96A 1TUBA 3B9PA 5DX0A 1X36A 4KW7A 5D51S 5AK4A 3HQUA 2ZTMA 3U3KA 1ZHFA 2DOKA 1MPXA 5DAPA 3MB8A 4X65B 3W3AH 2A9RA 2HDNB 4HH3C 2Q3MA 3SSOA 2C0CA 1G1MA 3TOVA 3RVLA 3KQUA 3N9PA 1VALA 4MROA 3H5WA 3AMMA 4W5JA 2Q4DA 4RZQA 1I1NA 5AM3A 1XZQA 1GSOA 3TKAA 1I2ZA 1Z37A 1LX6A 2IYTA 4J75A 4KU8A 2J1LA 2KM1A 3MEQA 5IAJA 4M4RA 1M6EX 3F5MA 3MV11 1KIMA 2V7BA 4N8MA 3GFPA 4NIDA 5TEWA 4FYIA 4HX2A 2GYWA 4KYIB 2ZJYA 1GXSA 1W6MA 4UEJA 2VWQA 1KGSA 1DWUA 3NS7A 2NACA 2FLKA 4ZCIA 3CLTD 1VXRA 2GCOA 3ETNA 2PV0A 5IU6A 2A1IA 1XPUA 1TGYA 3CLKA 1BD4A 5IUKC 4D8VA 2CNLA 3QVKA 5FZHA 1HLDA 2EQ5A 1C8BA 2RGNC 1ZUD1 1JNYA 1TEZA 4Q4HB 1OHHA 3E5UA 4A2QA 5KWJA 4F3YA 3WLRA 4DHEA 3R0QA 2C7RA 4ZV9A 1WSAA 4QLOA 1BVP1 3F4KA 1EAYA 4DR2B 1WDTA 3ST7A 3WYBA 3X29B 3CN7A 2I2SA 2DT8A 3TI7A 2HTFA 4FMDF 5H9SA 1N8SA 4MGEA 1AO3A 4NZMA 1LOEA 3HR7A 2R87A 4DRRA 3NXSA 3C70A 1TKRA 2VC2B 3UAWA 1ILEA 4C91A 2RGCA 3AF1A 3UYKA 1Y9EA 2E63A 1X8EA 4YRQA 4DCUA 4MV2A 3PHJA 2PHWA 4J7AA 1II8B 3O0WA 5IK2D 3GLGB 2UZ1B 2XWBF 5KSPA 3WWZA 4LF4B 1EVIA 4FPKA 4PLMA 3K1YA 5ERYA 5A4AA 1JYXA 4WM7C 3TQFA 4G36A 3DDZX 3GRAA 4QJBA 4DA6A 2VCYA 3JYNA 3PEYA 3GJ0A 2QQKA 1NBEA 4N3AA 5FHQA 1RGSA 1T2CA 3QXHA 2WRZA 3JQ8A 4XJUA 2HMWA 3SQWA 1DXHA 4BIMA 3OD4A 4CF5A 1RUF1 3WKAA 3O1MA 2FPKA 3ND9A 1ZKDA 2IP4A 5IJ0B 2VF2A 2OYSA 2VQ3A 4JP8A 1KO4A 5IJWA 3R3XA 3ABZA 2HV8A 2B7YA 2H1IA 1Z2AA 2QB5A 2OG2A 1MU0A 4DV1B 2QTWB 4TMKA 1DEHA 4AGGA 1TCBA 1LHNA 5TQ0B 1TEHA 3U5TA 3N8IA 4BO1A 2IF2A 3C5EA 4IGEA 1F9AA 4PIXA 3NT2A 1G5QA 2YHBA 2K2QB 2Q1YA 4XQGA 4G5GA 2Q27A 1M7BA 1S3GA 4IF6A 1HXS2 1WXQA 2QQFA 4HGPA 4TXWA 2CL6X 4CCYB 2AL7A 5JDIC 3ZD6A 5FR1A 4LZAA 3FX3A 4MI1A 3W4JA 5JS8A 3FJSA 3SZOA 3IXLA 1SBCA 3AFHA 3D4KA 2R041 2XVAA 1MQ9A 2ISCA 5DP2A 2WN2A 3NWJA 4Q3BA 1FQWA 2WYIA 5IT5A 3V97A 3FGPA 4DUXA 1IJFA 5BR7A 3G49A 3AYEA 5M5BA 4KE7A 1V5WA 3O90A 1CUCA 4C21A 2ZJ4A 3C7TA 1HQYE 3DGFC 1C9MA 3MF9A 2UYYA 4KRYA 3PVBB 3ACHA 3WNBA 3F7TA 1SKUA 2YXDA 5E7MA 1AIPA 2ZJBA 1YB7A 2QSJA 3COSA 4C1BA 4KJZA 2EHDA 1SVSA 4DKJA 1NF2A 4TYSA 3G1WA 1EINA 3MVEA 4ZPJA 3ZHUA 1HT0A 3SAJA 5FY1A 1JEYA 1QCCA 5AW5A 5H8WA 3A9SA 3KZKA 3FCXA 5J2TB 1PUXA 4ZI2A 1C3XA 3HWJA 3ONVA 1HNWB 4AJNA 3N39C 1XD9A 2OFXA 2VHUA 3BE4A 2AV6A 4TLBA 2VZ3A 3X1MA 4CDXC 4H27A 1UWWA 1HRV2 2GB4A 3AUSA 4R8MA 3RF7A 1WMEA 3PVZA 2W2LA 2IVFA 1KDOA 1O9GA 1U1DA 4CVNA 4B80A 4M0EA 5BVGB 5LIPA 4XWTA 4GEKA 3LYUA 4MYEA 3WX5A 2X6TA 5JSKA 3RSJA 2F3TA 2OVBA 1NCRB 2BCEA 3Q3CA 4XCXA 1XQYA 2RJLA 4M0PA 5BV6A 4A03A 3Q12A 2X4IA 1H23A 3WK4A 5DGTA 2ADDA 1SAYA 1SOAA 3X1YA 1Z5PA 4NMIA 4D9BA 2DHRA 3KUCA 4E14A 2YYOA 5B30A 5AVVA 3F90A 5SICE 2Y66A 2VP9A 4ASKA 1JG1A 2A9FA 1NURA 3KPJA 3CTPA 2Y0CA 4LOJA 1DBWA 4JSRA 3ICWA 4JI8B 5DM4A 1EGMB 3UCXA 1TTHA 4OQ9A 2IEYA 1L5RA 4QHBA 2EFCB 3EF0A 1Y9GA 4HBNA 2ZBGA 5FBWB 1DZTA 4P36A 2WHPB 1ZX5A 4EG8A 1WNTA 3U13A 1W73A 4BFZA 4ZZ2A 2JKYA 3DBRB 3QLVC 2FGJA 3S1AA 3ZY3A 4BKPA 3AF2A 5A4JA 2C82A 4WUTA 1TAQA 1THZA 3RASA 2QUHA 2J31A 2AR7A 4NWVA 1ZU4A 4YGDA 4B9AA 1E0JA 2P9CA 1LAJA 5AT1A 5LPNA 4KX3A 1RBYA 3I6MA 3QI2A 2G1KA 3F4BA 3ZVNA 2VOVA 2W1WA 5J1TB 2DWOA 2GN0A 3DBOB 3KKNA 3BQMB 4LSMA 2YWBA 4EKIA 4YRJA 2P77A 1C1XB 3MOSA 1EIZA 3IO5A 4QAQA 5C1PA 3A0RB 4AJEA 3CLHA 4G1MB 2B7BA 5EQDA 4RKWA 3R3HA 5EVCA 3DEIA 1SC1A 2D54A 4XUDA 3HLYA 3WISA 4QXPA 3I5XA 5JZ9A 2CW5A 3FYSA 1J1UA 2HHLA 4EPWA 1AV7A 4AVCA 1YIFA 5JWHA 2Z8YM 4RABA 1XYNA 7MDHA 1YZNA 2HHCA 3EA0A 2HWB1 1US8A 1SHWB 2J3JA 2DBVO 1Y43B 3T1OA 4Q4W2 5E8JA 3ZN4A 1Q14A 2OORC 1JI0A 3JZVA 4YR7A 3U80A 4N53C 1SKYE 1ID1A 4WE3A 4CNBA 3ED1A 3DAOA 2GNOA 3LMKA 3INGA 3UKDA 4C7BA 4IESA 4D9FA 1OU0A 1LK0A 4R7ZA 1RUE1 1P5JA 5JSUA 1TTTA 4D4MA 3IUSA 1GAXA 4HZUA 1JF8A 1QR2A 1D9ZA 4EF5A 3USES 4UFMA 2G0AA 4MTLA 3GMSA 3FDFA 3NWBA 4DBLC 2NV6A 4JHZA 4YPJA 1OFUX 5AK6A 2WD7B 1P0PA 3HU5A 4L9WA 5DGHA 4DIMA 2Q1UA 2CD9A 4YUZA 1AZWA 3E7PA 1NW8A 2I66A 5HZMA 1IHXA 1UOFA 2J1SA 4AI9A 1YZ3A 3RRZA 1ZZCA 4E2QA 2QAGB 4D9MA 1ZN9A 2Z4SA 1N0IA 3ROXA 2VXJA 3V7UA 4BV2A 3HGQA 2O3QA 2ZT7A 3DN7A 4MICA 1L1FA 4UHCA 5BNWA 1ABFA 1Y7LA 4XUEA 3LH5A 5CURA 1JHMA 3ROTA 3VJKA 4JT8A 1WW2A 3TSOA 4BAGA 5AVTA 3HKBA 3OCUA 4FDAA 2R1TA 3AYZB 5LZ4A 2JJ2D 3WAKA 2H0AA 5BNPB 4K9KA 3BTZA 1KVRA 4EMTA 1MH1A 3PEFA 4OM7A 5K4HA 3OLYA 5EYPB 2WZBA 4CCLA 1DBPA 1S2BA 2ZS7A 1F6BA 2ZGKA 5BNOA 1GGHA 5D5QA 5C7IO 2EKZA 3CUTA 3VYWA 3LLVA 5E4TA 5C3RA 3VISA 1N3QA 2VTXA 4ZHNA 2IXKA 1QQ7A 5LRRA 1UMBB 2YVAA 2JBWA 2ZE7A 2X8BA 4ZOAA 3A28A 2BMFA 3UG6A 3NRUA 4YVWA 4IW3A 1WNFA 1R37A 3PFIA 4MVJG 3R9XB 1CS4C 2WUGA 2FUG6 3BKWA 3PENA 3IE1A 4E3WA 3AEXA 5JD4A 2FZVA 2XPCA 4CLHA 2XL9A 1PDVA 3SWWA 3MHZA 2PVCA 2OORA 3HY3A 2JDHA 5A5FA 4Y18A 3PDCA 1RWWA 4C01A 4LJSA 3ZXJA 1YCHA 1KETA 2RHOA 3CEMA 5FHRA 4JXZA 2HV9A 2JJMA 4FDLA 1E2MA 3MF6A 4EN9B 2ZGMA 1W49A 3RTEA 3ZLVA 2VYFA 4GH4B 3HG7A 3VR6A 3OZAA 1C30B 2C3MA 5HK8A 4H0CA 2P5YA 1L7EA 1YC61 2NVWA 4E6EA 5EN4A 4F8JA 3EASA 5FQOA 5DSTA 3T0BA 3VD9A 3S57A 4NHMA 2Y6LA 4ZI7B 3J26N 5IK2A 2FVYA 4B3BA 2RS12 3PNPA 3A0NA 4M22A 4AVSA 1K5JA 3VKLA 3WYEA 4V0LA 3NCHA 1O0SA 3KQNA 1QEXA 3UV9A 4JC4A 4ARAA 2E33A 4FGZA 2DU0A 2AMFA 1CF4A 3SF0A 2GEFA 4BNUA 3M3CA 3AT1A 1QIJA 1GG5A 1ZGCA 3NBKA 2CLKB 2PG3A 1Q77A 3B89A 4FHCA 3WNQA 1LV8A 1JALA 4EHLA 5GZDA 1TTPB 1GUIA 3CR8A 1S1MA 3KQQA 4DLZA 3W5SA 2PUDA 4DXSA 4EKDA 3N07A 2O8FB 2XD4A 3W21A 4FHFA 2C2YA 4PYRA 1Y6JA 4MX3A 3ICPA 4JGYB 3FPCA 1F48A 4KBFA 4XEZA 4P3YA 1F12A 1R0WA 4KFRA 4R0MA 2ILMA 4MVJI 2Q5FA 3SDBA 3BHJA 3UUGA 5LLDA 4CU8A 3K0BA 2NAPA 2VOWA 1YR2A 2VTBB 2ES3A 2IYUA 1B0UA 3T7TA 2F1RA 2Z98A 4ZAVA 2EEZA 5EG5A 3LO5A 3VKHA 1S1AA 2JJ8A 2DYKA 5FNVA 1AT1A 4M86A 4AG6A 2FWNA 3MC1A 3NDPA 3SH4A 1NXMA 1Q0HA 3L6RA 4B6GA 3NHPA 3ZQJA 3HCOA 2Z79A 4NK4A 1JYEA 3VBOC 4RPGA 3Q9OA 4TT8A 1NU8A 5C0OE 2VVTA 4FOPA 4DR6B 1HDKA 4N5DA 2COUA 3S1LA 3UA4A 5BV1A 4WVMA 2Y60A 3W1VA 2O8CA 2BEVA 3FY4A 4X1OA 4CU2A 5HZKA 3ZCSA 3CLTC 1QQAA 3EQ2A 4DZTA 2X40A 4LF8B 3FROA 1EJBA 4C3UA 3NU1A 4JQCA 3JD2A 2WMNB 1GY8A 4XQ9A 1RVV1 2BZGA 5EIEA 1Q92A 4WCDA 5C9AC 4MW1A 3BGSA 1RI3A 2HRRA 2WUHA 1PU2A 1W85B 1LLFA 2W8BB 3DV2A 4RMIA 1ZITA 4QUGA 1H9AA 3H5NA 2V6GA 5IVDA 3STWA 1G3QA 3M1LA 4WN9A 1N34B 3M9WA 821PA 2Q2OA 3VOBA 3EVEA 3HY6A 2RC6A 3OJFA 2YWRA 3NJ4A 2QTLA 3RI9A 3H1TA 3IV9A 1L7AA 1PD1A 2XGJA 1ADFA 4Q0UA 3Q8BA 1ZSVA 3RSOA 3W58A 3DXYA 4HDAA 3NYIA 3A3YA 3L8HA 2YOHA 4HO1X 2VJMB 4V2UA 2X8JA 4AQ6A 4XIFA 3QQ5A 1ZVKA 1DO8A 3IVAA 3TW6A 4I50A 1E7WA 5G0UA 2PJUA 4KZPA 1DBSA 4B6JA 2NADA 5AW0A 1P31A 3RJ2X 1Q3TA 4C7JA 3N7UA 4CM6A 2PGOA 1D0IA 4DNPA 3NHKA 2ISQA 5J59A 5B3JC 1YR3A 2PWBA 1NW7A 3LP8A 3QWFA 3P0HA 3IKJA 4I4IA 3R76A 5CZKA 3PS9A 3WYNA 2FUKA 1IZ7A 2W2QA 1EUCA 4A4AA 1GNYA 1MJGA 3LY7A 3CT4A 1P1IA 4OU5A 5IT0A 1KRXA 4L5BA 2QM7A 4FXGB 4D9NA 3D6HA 1EE1A 1RZRA 4TROA 4DLNA 2DWRA 2JLQA 3SX2A 4JVAA 4LBWA 2Z95A 3OQ6A 3LPGA 2HSEA 3VGJA 5G0WA 4KNVA 5T50A 3PBKA 1U9IC 3DOCA 2FDKA 5ALFA 4MGSA 3P0EA 3B5IA 3I58A 3JATB 3E5XA 2OPWA 4F9TA 1CDZA 4Y3OA 4LKEA 3A3KA 2V4VA 1YDEA 3M7IA 3EIOA 4LV8B 3G2IA 3R5KA 4FEGA 3U62A 3OAAD 2DGDA 1SBFA 3Q7IA 2O2JA 3L0BA 3TG2A 1BW9A 4A1FA 5FXXA 3ILVA 3ZE9A 2R8EA 5REQB 1YZQA 1Q8QA 1X8MA 1IRXA 4LQDA 3G2JA 3HKDA 1DKPA 2YJNA 1W34A 3FWKA 3LZCA 3DTYA 4DMGA 1LDEA 4HWSA 3IULA 5M7EA 1BDBA 1XNRB 1GNRA 1V8FA 3CY6A 1TEXA 2FMHA 1ND5A 4JP3A 1RDFA 1BZYA 3B6IA 1USIA 4C0LA 2B69A 5EIBD 1CUSA 3VSBA 2QUAA 5LB2A 5IPFA 4HFJA 5K4LA 2QUKA 3OFJA 2A6WA 2NPOA 4D8TA 4NOMA 2FPMA 3E2MA 4M7RA 3TTUA 4R2LA 1GD1O 2O54A 3O31A 1QQP2 1XMOB 3PUVA 4KX5A 1ZZBA 1KVUA 4DR7B 4H7MA 3SQLA 2XJRA 5H9VA 1CS0B 2D0PB 1A9PA 2YJ4A 4GLJA 3KR9A 2Z69A 4CHGA 3F8WA 1A72A 3BX1A 2R68A 2J6CA 2L82A 3USCS 3GMTA 3KDSE 4I1SA 4JUIA 3SHOA 5K8JB 4G97A 4P3XA 1WZNA 1M34A 4ZN6A 5GALA 3F1KA 3WUCA 3SC6A 5TARA 3M4NA 5AVPA 1RVF1 3BDIA 2QZ2A 1KJWA 5DOVA 4XI9A 3PLAE 4HRAA 5DISB 4YYEA 1KDYA 1UMKA 3VDRA 1FSZA 4NO4A 4B3DA 3HYLA 1XKLA 1H30A 1XTTA 1ZXXA 2C99A 2F1OA 2AS0A 2XWPA 3K70C 1C5HA 3I54A 3A9TA 4B4PA 3TQQA 1CAUA 3LL7A 5EJ6A 2Q29A 5LA9A 3POIA 1WUHS 1QIHA 1TB4A 1NATA 3ND7A 3HU2A 1K9VF 4PZCA 5KREA 2QZJA 1QHGA 4META 5H9PA 4YDQA 3BJRA 3KKPA 3CJIA 1F5NA 3AY0A 3E22B 3WXMA 4ZOLB 4PFQA 5FORA 1G3IA 1H6BA 1GUBA 3VM6A 3M3DA 1ETUA 1SFNA 1DAIA 4RIEA 2O57A 1U7TA 3RH0A 1L5MA 3VDNB 3C43A 3PE6A 1YMVA 4B8YA 1X1EA 2PH1A 4AKGA 2ZIGA 2D8MA 2AFHE 1MABB 1RNLA 3PHBE 1DAOA 3UXHA 5IAAA 3FHQA 1ZLYA 1LH0A 5JMOA 2CGPA 2VXBA 1K45A 3IOEA 1GCUA 4H18A 1Q1EA 4OHYA 1T0PA 4LXGA 5FPKA 1NLMA 3H1WA 5FWNA 2V03A 4YVSC 2EIHA 3WDKA 4CXMA 4PPGA 2WYWA 2ZIVB 5JIBA 3IIMA 1GILA 1T36A 2X13A 4XX0A 1T15A 1SO8A 3LZDA 2J42A 3SC3A 3AR8A 3EIQA 4JIGA 1W8ZA 3I3SR 3ZHBA 5I7VA 5C5IA 3HDJA 1O3QA 3R5JA 1DQ6A 4KV7A 1K3UB 3K6JA 4IGFA 1E7MA 4N5NA 2RGXA 4FNMA 2XQVA 2WWRA 4YM1A 4DMKA 1PZNA 4Q4X2 4EJ0A 4LGCA 1G7RA 1S9DA 4NHEA 4Z0TA 3GRRA 2R7AA 1HMYA 5TQ0A 3T1NA 1FX0B 5JZOA 1ZMRA 4MKRA 2ZE6A 4TSFA 4FAHA 4ZZ5A 1OXBB 4NJOA 4WZZA 5JANA 4LJLA 1KMMA 5FWEA 5JHGB 5LBUA 1X33A 3GHMA 2YXLA 1W6MB 5DRYA 4PT6A 1QH6A 4FR2A 3CVVA 4P82A 1GKLA 4W8OA 3W9AA 1KJQA 2I33A 1AN0A 3FFAA 2GCOB 3DP9A 2C95A 1GU1A 4JI4B 3CISA 4MIKA 4PIPA 1LS1A 3TUIC 3DLCA 2OESA 3MNFA 4G23A 1RMQA 1VB2A 1UK7A 2YZMA 4C2BA 4JGBA 4LRSB 5DNEA 4CM1A 1ECFA 2VNKA 2QQUA 2F6RA 5EGSA 2R6R1 1L7VC 4F4FA 2VQAA 4JU8A 2FK8A 3PGKA 3FNEA 3ZWNA 1HDEA 3N7AA 4UM7A 3T9AA 3E81A 1M73E 4JKKA 5LMNB 1IULA 5I0TA 1C7FA 3JAWB 2C83A 4EUHA 1P80A 3IC5A 3EEOA 1FVOA 4Q9AA 4YCCA 1NMEA 3GM8A 5J98B 1T6NA 2FW1A 4E0BA 4FUQA 2M6SA 3K1JA 5C4WA 3SOPA 3LQ2A 1NG9A 2NQ8A 3IAS1 1JS9A 4DYHA 3LUCA 2QMEA 2ZULA 1E9EA 1O4YA 1R0CA 4V3CA 2Q49A 1XR3A 5FPYA 2BGWA 3N6XA 2ID7A 1EA7A 1Q8SA 1RFGE 2ILVA 3V1UA 1HUQA 5U4XA 3OPYB 2DY1A 2HLDA 2P3QA 1M33A 3ZN5A 3VDAA 1NCQA 4PHHA 2YICA 2YFHA 3K31A 3A3NA 5A7NA 4SLIA 4P4GA 2AW3A 3GVCA 2IZOA 1U3DA 1NUTA 5FI1B 1QZUA 3H3UA 4TXLA 2CJYA 1IN1A 1F4VA 1N36B 3U5ZB 4HLNA 2WDPA 1BOFA 3K71B 1AZSC 1J56A 4ZHSA 5EHGA 4AF9A 1N57A 1UK6A 1GTJ1 5JEDA 4JUFA 3LOBA 2MYNA 4NS1A 1Y6QA 1V9LA 5BVGA 2GK6A 4RR3A 3E4CA 3K20A 3UJOA 1WCSA 3VHXB 4OHBA 3UH0A 1K3IA 3BMQA 1R6DA 1Z22A 3A10A 1RHUA 4I3GA 2PMEA 2C8VA 2X09A 3WKCA 1JHNA 3IBGA 2O6HA 4UOEA 3CIOA 4W5RA 1SOWA 2JIPA 4U7TB 3KR1A 5EMNA 3T5TA 3LHSA 1A4IA 5FULA 5BN1A 3WC4A 1CQ9A 4RXMA 3UKTA 4H6XA 3FOBA 4YQYA 4ANFA 5HCBA 3KOWA 1U5XA 4HS9A 1W7AA 4JGGA 3P1IA 3UJBA 3LQFA 1V5FA 3M8KA 1QH8B 3FAZA 2PMKA 3CB4A 1ECBA 3DA8A 4EYSA 1MO3A 5CLHA 1PBTA 1RD4A 3BGDA 2QDXA 3I6BA 5BW6B 1RI2A 2C58A 1B2LA 1T3LA 2PM8A 1KEKA 1TU0A 1R091 4DJ5X 3PQ4A 4HWTA 3BF8A 4KO4S 2XBO1 2DUMA 4QXOA 4RHUA 2BM8A 3I49A 1TADA 1X7XB 3LVFO 1IVSA 5FEUA 2Y33A 1DEKA 3SBXA 3THWA 3H42B 4DANA 2WT8A 2H16A 3GD7A 1HQCA 3EG9A 4E4HA 5KYKA 3RC7A 4PJYA 1FLNA 4UM8B 3MILA 3T7DA 3D3KA 2OKGA 1RAFA 5ALLA 3DMPA 3INRA 1U0NA 4OX9Y 3OMLA 3WOVA 2HWC1 1EMDA 4R01A 5EXPA 1GTSA 3S8MA 1LQTA 3RS2A 5KYWB 2W68A 5CLJA 5GM1A 1QHEA 1QLWA 4IFIA 1FFAA 4CQJA 2W6JA 3OOJA 1FTSA 4UHFA 4MVCA 3E9NA 4M88A 4ZVOA 1YHZA 2D5CA 3ZKWA 1IHDA 3WSVA 2D2EA 4L15A 3EXHA 2PYDA 2D1TA 4A15A 1CS0A 3NGMA 2ZRFA 3ROEA 3RW9A 1L5ZA 2B46X 1MEJA 3PLRA 2PFWA 2QNIA 4KQ6A 4A23A 1XSEA 4C22A 3OURA 1G9FA 5AVZA 3KM5A 3IBMA 3CURA 3HB0A 2FWRA 4ZT2A 3AYDA 1FI2A 4XBNA 3DXFA 4KJXA 1AUXA 2ZAMA 3Q3VA 4EJFA 3IERA 1U6JA 2Z58A 1O87A 4BATA 2WUVA 3HLKA 3N9NA 2P6OA 4AY4A 3DXXA 5JO0A 1I5EA 4LBQA 1UXXX 3E8SA 3PV0A 4N3NA 5K0UB 3BILA 1X19A 4DJAA 4A91A 1I6WA 4RSUA 2QQNA 4GM4A 4QVKA 1OI6A 3J7LA 1LX7A 3KT4A 4HONA 3UKNA 1NUPA 3A1SA 4KDEA 3A9UA 4A2PA 3MELA 3C4JA 2X3YA 1FDOA 1EWYA 1I01A 3CZQA 1CQWA 3UW3A 1PJ8A 3U4MA 4NAOA 2FVXA 4I9GA 3RFUA 4EPYA 4B84A 4A0QA 2D3RA 4I8XA 2OR3A 1ZBQA 1NAHA 5CTJA 2QGFA 3L0ZA 4LCEA 2J30A 3UKJA 3CJIB 1CUAA 5M34A 4QOHA 1YWKA 4RF4A 5KR7A 2Q4EA 3GLHA 3ENKA 2HJHA 3KCCA 3EDOA 2F4NA 1E3IA 4I99A 2J1EA 5CLLA 2VLIA 1L5YA 1UXJA 2PBFA 1CG6A 2BBAA 2V0NA 2V73A 4W1SA 4UU7A 3V0BB 3SDZA 3DW1X 2QYSA 4D42A 2OX0A 3HS3A 2CV6A 1MW9X 3VBRA 1C8M3 3WRYA 2HJGA 3R7SA 4OMCA 3NP9A 3NJXA 4P5HA 4QGSA 4YVWB 2QTNA 1ZM9A 2YIVX 2CXXA 2VRWA 3RUFA 3KSRA 4QX7A 4Z7JA 3M82A 3WK9A 2Y6VA 3LBIA 1Y8QB 4FTEA 4UMVA 5DMXA 2PTMA 2RK3A 3RIMA 1NCQC 4V0RA 1YJKA 1MJGM 4G8DA 5E2AA 3BA1A 4WNAA 2FXIA 3ABRB 1G291 4UXJA 4DIBA 1IN7A 4A5OA 2QWXA 3EA4A 4G8BA 3TOZA 5IAVA 3OBZA 4REQA 4FMCB 3S29A 4LFCB 2DVFA 4FUTA 4FFIA 3R9KA 4Z9BA 3TWOA 3P2MA 3ZJ4A 1PS0A 5DGCA 1LGBA 4YDRA 3A05A 2X10A 4F91B 5F5IA 1US2A 1AXRA 4RYDA 1M8JA 3G2MA 4IFTA 2NVUB 3D6UA 1EVJA 4HN9A 3HT1A 1M54A 4IEFB 2DV9A 5BSFA 2GK3A 4BS9A 2IS2A 4I5EA 2R2GA 4LPSA 2ZKIA 1LWOA 4L97A 4KPGA 3CNEA 3SLRA 1LFAA 1IBMB 1R4AA 3WYCA 3BTUA 3JSXA 1G0NA 2IHTA 2EKDA 1B6SA 5CU1A 3ULKA 2YMLA 1W9SA 3DG9A 3F46A 4L78A 2GAOA 5H83A 3AM1A 4K28A 4WCFB 4MPJA 1IC6A 2VZSA 5KYWA 3HFJA 4CM4B 3RUCA 3H8SA 1QOOA 1WZEA 4FW8A 3V4PB 2P11A 1SPBS 221PA 3ETLA 1Q5PA 4N48A 1WB6A 3D3QA 2YQZA 3L9JT 4XAEA 3L9WA 4DZRA 1AKVA 5CGZA 2H31A 1DT5A 1KRWA 2JGRA 4DRYA 1NQVA 3NEPX 2OG1A 1LZKA 1YNAA 4ZRNA 2R96A 1Z63A 3DDHA 3D3EA 4G56A 1O95C 1GKIA 3Q5DA 3QV1A 3SXPA 1BWSA 4CETA 2Y0PA 1XTQA 1UYYA 1FFWA 4X6LA 2YMQA 1C3OA 5L36A 2G9NA 2CCGA 4IXTA 4UZSA 4N3BA 4J49A 3T7JA 4EVSA 2QZPA 1V41E 4YC7A 4HD8A 1MEC2 1LSJA 1Z28A 4KO3S 1W0PA 3D5TA 3WDMA 3LOUA 3MTIA 4F96A 3MK31 2RJOA 2OO7A 3RQ0A 3T9DA 1Z12A 1RJ8A 2F9LA 2OCAA 4WVMB 1OX4A 1FMD1 4K26A 2GH8A 3REOA 4OJMX 1AGNA 1Q0RA 4GKJB 1ISPA 1I51A 4PNZA 1SRRA 3M8LA 3WYGA 1J5PA 3LLUA 5I51A 2ZPUA 5ELMA 2WAMA 2XMRA 3GEGA 1ODIA 1WF3A 4N41A 2XRZA 4X6UA 2BOJA 3JRXA 2C9AA 3VO9A 4D8MA 2JJ1D 1S1CA 3D8SA 4IEPA 1D04A 1Y3BE 1W581 1C8LA 1VKZA 1Q1QA 2PL3A 4JC8A 4GI3A 2R8BA 1OT3A 3DOJA 2BP7A 2RAVA 5FI0B 3WW3A 1E5RA 4BBPA 2RH5A 1JPJA 1JH9A 4KAAA 1L0BA 1E8NA 4L4ZA 2C5AA 4MGIR 2OCYC 4IEWA 4LBOA 1MHTA 5ACA3 4U2AA 2BFFB 1LQ2A 3BL6A 1XTSA 4QU1A 1FBNA 2PAEA 4KXXA 5DXAA 3NSTA 2WQZC 2E82A 3SEPA 4A6DA 4MGKR 5I7OA 1UEJA 1WCQA 4ZT3A 1BN7A 4F97A 3H6KA 5LNK6 3KJZA 5A62A 1KFCB 5C71A 2AGSA 1RYDA 5BNFA 1YR7A 2JC3A 4EB8A 4F2HA 1W2WB 3H2YA 3RCBA 1S8NA 1BKZA 2Z56A 4J90A 2VHWA 3EH2A 3GLIE 1ZPDA 5AI6A 5D87A 4IIDA 4FJ1A 1KU0A 1S0GA 1SLIA 4N7MA 1OREA 3AJYA 1FCJA 3T0IA 2BYVE 4ND6A 2PRIA 1XDWA 3U7HB 3SIPA 2A14A 1CJUC 2PH3A 4AK3A 2FMUA 2OHXA 1J4AA 4YXFA 2VH2A 1A8IA 3RVRA 1CUBA 4DXDA 2OMKA 1BKYA 1Y81A 3OG2A 2GWRA 5BVHA 3JD4A 3NAGA 4YHHB 1G66A 2WF8A 2C00A 4GOLD 2OAP1 2ZAYA 1CF9A 1FVHA 3ER6A 1CWPA 1EUZA 4JQZA 5E3IA 4GWIA 3WNCA 2Z2KA 3NEJA 2GEKA 4JWKA 2GZ2A 1REEA 2PLRA 2GGSA 3U6BA 4JI5B 2PUHA 4DDVA 1Y9JA 3VPGA 2FUEA 4XIOA 1M06G 2WEKA 1COV2 3BWBA 4UFJA 4H14A 4Y20A 4E5MA 2C3UA 2VF5X 3R09A 3HUFA 1TK2A 3NT5A 4KQHA 2AX3A 4FKBA 2PV7A 3LT5A 3ZBPA 2XEXA 2CU5A 4JB8A 4DLWA 3KU4A 4QYTA 1LEMA 3VPFA 1NQJA 1HBJA 1J20A 5D86A 3WGVA 4L2NA 1HJGA 1VPWA 2IYYA 2HWD2 3E3NA 1GKKA 4NX2A 4G26A 2V0GA 1FSPA 4IDDA 4IH9A 1QMJA 3CMGA 2C2OA 3WJAA 2C8KA 4LWPA 1XPRA 2QP9X 2PRYA 3AFGA 2JLRA 2NTEA 5FK7A 1M75A 1OIXA 5ITZA 5BT8A 1MC1A 3RVQA 3FE2A 2PT9A 3KSDO 1KFXL 1IN4A 4AYWA 1A2KC 4D6YA 3VAZA 2LKCA 2SECE 4OI0A 1JJ7A 4QPGC 3CNLA 3OPNA 3UK0A 4AKEA 1JJFA 3O84A 4INPA 2JAQA 1GLVA 5LQDA 1FS6A 3B7PA 3MN1A 3OFND 4CXYA 4B3FX 1FOD3 4A8JA 3VO2A 4YAJA 3SZ3A 1QHHA 3F98A 3WWDA 4B2PA 3K9WA 3HWSA 3RREA 3UCFA 2OHJA 3PVOA 5JMPA 1M1ZA 3IS3A 1TZJA 4BECA 2GBFA 1OI7A 1MOQA 5C8XA 4EHAA 3BWVA 3EHDA 3R75A 3K35A 3LAGA 1UINA 3HKCA 3H4VA 1X7HA 3TTSA 1FFBA 4XHXA 3OBRA 3CSDA 1K8ZB 4K9OA 4NK5A 2QAJA 1LULA 4V1PA 1A7JA 2W42A 1SEVA 1DV2A 3A14A 2RBEA 2JS7A 2QBYA 4YG6A 2CXUA 3RPQA 2GD2A 5KXEA 4OEHA 3AHJA 4ZZIA 4YDSA 1TLLA 5HRCA 1G3UA 4ZJUA 4G3XA 1M2HA 2R751 3CRVA 5BSWA 4B81A 3TGWA 2WHPA 1SXHA 3U7RA 3B12A 2V9PA 3AO0B 2LNDA 1HB4A 2J5BA 3ZK8A 3A1VA 1MG5A 3FPKA 5AOCA 4O4LF 2X0NA 2XJVA 4L0QA 3ZHTA 2N0SA 2LXNA 1DCSA 2VZPA 5BNPC 1RIRA 2VOXA 4XVRA 2VAMA 2WWHA 3UB3A 4EHKA 1UIKA 4AF8A 3V65A 3U7FB 4FGSA 2AOTA 4M1MA 5DI3A 3ZE2B 1ADYA 1B43A 4B35A 3CJRA 4P5PA 1UKGA 4NV3A 2OECA 1F31A 4NSNA 1L6IA 2HT1A 4RPHA 1WM1A 3W5VA 4CIDA 4QB2A 3GEHA 3VSEA 3GLHE 2R6JA 4QQPA 1GPAA 4OO3A 1JDUA 3DR3A 4UDXX 3ZKAA 2O7RA 2YWEA 2EDAA 3PRHA 3I28A 2D1RA 2IKSA 1U0LA 5HBRA 5F5CA 2EIBA 2AUMA 5EMHA 1TL7C 2PYTA 1JYWA 1ZBA2 3PDJA 3HBZA 4LITA 3V4RA 1N2ZA 1EB9A 3RS7A 3ES4A 3MIEA 4B76A 3WDYA 3GJ3A 3FLAA 4D5GA 4X95A 3RBAA 1VBKA 5PNTA 4EZBA 2VQUA 3IZOA 4KPUA 5ETJA 2MSLA 2XZLA 4IDQA 1G7YA 3OT1B 2Z5VA 3H84A 5AXAA 1MJ5A 4ES6A 5JR7B 3O2JA 2WY2D 1AB5A 1EY2A 1TCAA 3OUUA 1QC5B 3HVDA 2WYUA 3ZPOA 1LNZA 4WBNA 3WGLA 3FLEA 1YHFA 4EUKA 4V0MA 1CXZA 5K20A 1Z0ZA 1N92A 5A6ZA 4B3HA 3KUXA 3WJ2A 1K68A 3B7WA 3MTBA 1HFWA 1QAOA 2WNHA 4F2GA 3L1HA 2Q3HA 4MGYE 3THPA 3MW4A 3FUOA 1R66A 4E09A 1YBMA 2GZSA 4FEEA 5JAPA 4CCWA 3AEUA 2OV2A 4P54A 5A6YA 1V7PC 1E57A 2X7HA 1YZVA 3D7LA 1J42A 3V4ZA 4ZU5A 3EXG2 4KMSA 2IYPA 4ZEVA 5FDBA 4E4RA 4JZRA 3EXEB 3AMNA 3VH1A 3PXUA 1CHNA 3WK7A 2HW8A 4YCJA 4RXUA 5DDIP 3OJ0A 3LKJA 4O3FA 4KHPB 1YJBA 2HCFA 2Q9UA 4WASA 1RUH2 2WWGA 3DP7A 1H66A 4K6MA 3GCZA 4YJGB 1NAIA 1DEAA 1RIIA 2GEBA 4RJLA 3BTVA 1VOTA 5KHIA 3EVNA 5EHXA 4EKNB 4ZU6X 5JQGB 2A6PA 1GSAA 3RKRA 1DIGA 3ILFA 4Y2PA 4KE8A 1SEFA 5DTIA 2X0FA 1GZSA 2INGX 1P0QA 4CKXA 5EZ5A 4U7FA 4V0ME 4DSAA 3ELWA 2JDID 4LRXA 1E4EB 1KDZA 4JKLA 4QOFA 1IXRC 2FRDC 4XTRA 1T5HX 4JB3A 3EQ8A 4S1VA 1IWBB 1ICEA 3AESA 3OP1A 2A73B 1N25A 4DB5A 1E1QD 2X4GA 3R9XA 1W88B 4QU8A 4OL0A 1WXGA 2VQDA 1HY3A 2NUAB 1FL9A 1D1QA 1Y9MA 4TUYF 1TO6A 4EY7A 2JJ1A 4LDZA 5CBPB 3G68A 1PK6A 5AK0A 3RYPA 5FY5A 5HGJA 4KWLA 4H3VA 3DUIA 3SICE 5FL3A 5BORA 1I30A 1T2VA 3O1UA 4GVXA 1DGRN 4GL4A 1JSCA 2BJSA 3EPJA 5DM0A 3EXUA 1R6VA 3DPRC 3EQ9A 3F6EX 1Y3FE 2WOOA 2G40A 3CQ9A 2BZ1A 1PGW1 2XUMA 2PD3A 4MVJE 1PD0A 3PZBA 2C24A 5LZ7A 3KX2A 1Y42X 2XLAA 1H8TC 2AG8A 4OQ8A 1YNSA 2VY0A 2AFHB 2ASVA 1T1IA 4MGHA 3FDIA 4QSMA 5HX7A 2PGIA 3OGRA 2GUGA 4ZJYA 4YS6A 1O95D 4F6CA 2EP8A 4UJ5A 4I1VA 2GDJA 1T1RA 3FLBA 1YCDA 1F9KA 1INLA 4M87A 3N7KA 1EWQA 4WVLA 4YMIA 5C2JB 4BNDA 1F5FA 3QBDA 4O4HB 2HF2A 4AWBA 3C5WP 4WKGA 1EAH3 5B7QA 5JHHB 4RULA 3LOQA 1L4HA 1REFA 4XOGA 3MJRA 3TXYA 4JSTA 2HNKA 5FJIA 2XUJA 4EA9A 1K7CA 2DVAA 5ALRA 2ZCJA 5IRCD 4CR6A 4QA9A 2ZSDA 1V1MB 4DCSA 1ZNXA 1XU2A 2Z8XA 2DZDA 5I4BA 2ESRA 5F35A 3VDXA 2B0JA 2IIQA 2MYPA 5T5QA 1PLKA 3DAGA 5SYAA 2DMRA 2Q4TA 3M1YA 1FT9A 5JY1A 5CYYA 2BNOA 1QS0B 3R0XA 4FYVA 3OGSA 2AFIB 1J59A 1L5QA 2H1FA 2ZXEA 1HRI1 3C5CA 4NENA 2IPNA 3WAJA 4RJTA 3ONNA 4FS3A 2YWDA 2GOYA 4CEHA 2DE0X 1WF6A 1K6JA 2Y0DA 1BJRE 4ZRMA 2IZ5A 2XB8A 4NFLA 3KKOA 1WCV1 2N3ZA 5K6AC 4KH0A 4F7ZA 5DGIA 1DG9A 3JBG3 1J2UA 1K98A 3MIIA 3LZ6A 3BMQB 1C41A 2OOSA 3ZUPA 3U4HA 2PS3A 3I8TA 2VBGA 5AC92 5LP1A 1DLJA 1PDOA 2JE7A 1FYEA 4ZVRA 5IM4F 2VO5A 3R4DB 3I3DA 2VDOB 4BCDA 3JD1A 2R6AA 1YO6A 4L95C 1XMXA 4C7VA 4GJZA 3HT2A 3JVEA 5A4IS 4FOYA 1IAVA 4MW7A 1J8VA 2VF7A 1XRUA 4Q4CA 1EFUA 1W2UA 4Z82A 3L7MA 2YFKA 1MQTA 2C96A 5EJ8A 1SPPA 2I07B 1LJUA 3OY7A 3KEGA 4KQ1A 1THTA 1XL1A 5JFGA 4HC4A 1HQWA 4YQZA 4WN9B 1URXA 3C8XA 2O0JA 1OIVA 4R9RA 2JI9A 3OLVA 4TKUB 4UU8A 1DUVG 4WGGA 4A0RA 4RN5A 2ZWOA 2WU8A 2JFVA 1G7TA 3K70D 4GS5A 1UUFA 1Z08A 3WZLA 5I9SA 3C3YA 5JVDB 5FWDA 3GYGA 2I4IA 3ETHA 3ZFFA 3ZVKA 3EZ6A 2POQX 2HFJA 4P7FA 2FEMA 3CVYA 4WJLA 3FUTA 4NMWA 1NLQA 1FRZA 2A7XA 2PZGA 4YRMA 3RGBA 2SCUB 1OBOA 4DCMA 5DF1A 3UENA 1SIWA 2QLNA 5A1JA 2H5IA 2NV2B 3MHTA 3T09A 5JDBA 4LJKA 4W1PA 4W7IA 1SCJA 2ZANA 2G7MC 2JENA 4LMBA 1DLLA 3ME2A 3OX1A 3D3WB 5B64A 4JBIA 1ZCZA 2QVYX 2J4DA 3WNXA 1TYCA 4XILA 1LU1A 1Z9BA 3GH3A 2BI4A 3FB4A 4YW5A 4ZOLF 5JMCA 4DRVA 3ANYB 3M2MA 1DTWB 4CM9A 1Z5ZA 3JZAA 4H4EA 1W03A 2BWCA 1CX1A 2HWYA 5FZMA 2VL7A 3EFEA 4CGYA 4F0JA 2ZJ5A 3BPZA 3ORYA 1F8VA 3N1UA 1WV1A 2PAAA 3PC4A 1VJ1A 2FR0A 3I01A 1ZVJA 3IUMA 3JATA 5FLEX 5JWPA 3AI2A 3KQVA 1YKGA 1PV2A 4URZR 4EROA 4MZXA 3OESA 4QG7A 4WFIA 2JVKA 4YRTA 4G24A 3CBNA 2JX9A 4X6XA 2K2SA 3GLFB 1GL7A 1B6RA 3KKQA 5EV7A 3VB9A 2B98A 1J0XO 1QJY2 1B3BA 1ZH4A 3PL0A 1X7WA 5APAA 3I1YA 2WQ6A 3T3EA 5FKBA 1KI6B 1NU6A 1T6BY 2XYQA 4QL3A 2OV3A 4NNJA 1G98A 4CE6A 4E5DA 3B1KA 4GDMA 2G1AA 2BFUL 3AI1A 1HW5A 3H1YA 1PQUA 2MSWA 3AKDA 3VHLB 1P7WA 1S2KA 2RGDA 2V6JA 1SXPA 4O2RA 1RPTA 5LYJB 3IDZA 3C7KA 1UH5A 4OHZA 2WKQA 5AW6A 5BWBA 4U6NA 3BREA 1WOYA 3NHAA 1ISIA 3DMYA 4B4VA 3CZ9A 5H1YA 2ZBDA 4BWOA 3KV1A 4QUEA 1J1TA 1W9TA 4YZ3A 3ZTTA 1V70A 2VP2A 1NPTO 2HWUA 1L7QA 1OC1A 5B2GB 2B94A 4Y9UA 1R5OA 3LXXA 3L41A 4FGWA 1G8PA 2ZWAA 1L7BA 1U28A 2X29A 4A41A 2CMHA 1YR8A 1DQ5A 3N4MA 3ETEA 4NC9A 3KWMA 2D1SA 2I62A 3N74A 4YP6A 3ZTYA 3VV1A 4PLWA 1XVTA 2QLBA 3FAKA 3BJIC 3VNBA 2ZJOA 2H0VA 4MUAA 1MJHA 2XUPA 5ALXA 4BE7B 4LXIA 1GRNA 2DPHA 2LVBA 4BP8A 4EB3A 2QTMA 4MMYB 4QPGA 5HCUA 4GPEA 1DCTA 1MFZA 1M8GA 5LOVF 4MUJA 4A0FA 5C51B 5FREA 3L01A 4DQAA 4PPNA 1RWQA 1P2DA 1FTWA 4J0QA 2D6KA 2A30A 4M9CA 2QI9C 2XCRB 3FTFA 4JJEA 1UPXA 3WG1A 2RMU2 3NVKI 2IHUA 4IKEA 3EHKA 3DE4X 4CP1A 1F3LA 4EGFA 1RRPA 3R0JA 1DEXA 3PD0A 3QA3E 2V45A 3S68A 5EY5B 5AUPB 1HSZA 3RAJA 3ROZA 3BVCA 4BUJA 2A5FA 3PNKA 4PC7A 2YPDA 2EKBA 4CZSA 2MWMA 5CG2A 1UC4B 3WBJA 5CB0A 4FMBB 4FYHA 1BK0A 3AHCA 3V8PA 1BHJA 2V9CA 2W2LD 4CDXA 2Q2NA 3OZGA 1RUOA 4RV9A 1A3KA 1VE7A 1OF1A 4QQ2A 1BQ4A 4UVGA 1A7KA 2K6GA 3LY9A 2A5LA 2DCTA 4PFJA 3HXKA 1AS3A 1I7LA 5FYIA 5AI8A 2XNDD 2IC1A 2ZSIA 3TLAA 4N12A 3LA2A 5DHRA 1QVWA 3B9QA 1YRZA 3X1WA 1EPWA 3EGDA 4F3KA 4TLGA 2QD3A 1NVXQ 2I2AA 3N9OA 4XX0B 5JH7A 2AUNA 2YS6A 3OCYA 1LPSA 5I8SA 4LHKA 2ZZKA 1CUGA 2WJAA 1AX0A 3U19A 2ZUWA 4JGYC 1QDCA 5FUWA 3M49A 3S2SA 2VK2A 1PP4A