1IGCH

Igg1 fab fragment (mopc21) complex with domain iii of protein g from streptococcus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
222
structure length
222
Chain Sequence
DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTLHYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTGMYYCARWGNYPYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The third IgG-binding domain from streptococcal protein G. An analysis by X-ray crystallography of the structure alone and in a complex with Fab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (antibody/binding protein)
molecule keywords IGG1-KAPPA MOPC21 FAB (LIGHT CHAIN)
total genus 38
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1994-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igcH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igcH01
2KUTA 5AWNH 2UVFA 5GRWA 4MSWB 1B6UA 3N1PC 1K2DB 4WGVB 1VSCA 3L7FA 4I77L 5I0ZA 1G7HB 4YPGB 3QXAA 1WBZB 1P69B 3STZA 5E2TL 1N8ZB 4OTXL 1J11A 2HN7A 1FZOB 5IVXA 5AZ2H 4O9HH 4OD1L 4PJ9C 3KYKL 4X7FC 3W39B 3SGKA 5TDNB 2X42A 4EXPX 1BD2D 4JKWA 2EYRB 5EBMB 5L0QB 2OZ4H 3CXDL 5CKAA 4P5MA 2V5YA 5HPMA 2JELH 2H8PB 4U6VH 3MGOA 2OYPA 1J8KA 1BFOB 1S7QA 5ICYA 1H3GA 4EVNA 1EHNA 5JXEA 2EE9A 4M6NH 1MRDH 5E70A 3TYGL 1I1AB 1FZKB 3MCG1 1TTFA 3UTTD 1BM3L 3TO4C 3EYOB 4MB3A 1WZ1H 2YEZB 5DMKB 1OAZL 3D1MC 3PWNA 3LQAH 4Z7WA 3P0VL 4R26H 1OAKL 4XPFL 3LB6D 1AHWC 1CXEA 3CDGA 2EYSA 4J3WA 3MREA 2P5WA 3AMKA 1FFNB 4R9HA 4LMQI 1N64L 4UTAL 3LKPB 3S5LB 3DMMA 1RSFA 3PWJB 4FQLL 2BK8A 3ILPB 2BOCA 4X7SH 3CDCA 3I6LE 3DROB 3OXSB 4HLJA 1E28B 4PREB 3HRZA 1CE6B 1ES0A 1PZ5A 1QA9A 1S8DB 4WO4D 4EDWL 5L7XH 3ILQC 3D85A 3OAZH 4P23A 2VAJA 2KL6A 4Y4HA 1EVUA 2WANA 4K3HA 2F19L 1ZEAL 3FQRA 3CZFA 3PP3K 3MLTB 3X3GL 1U91B 4OCSL 4DUXA 4YX2L 4U6VL 3MLZH 4RBPK 1VPOH 4O02H 1DBMH 1FZJA 2UYLA 3S6CA 5ANME 2VITA 2ERJB 5FV2A 4JHAL 2BOBA 2DQGL 4BZ1H 4JFPB 4HF5L 3C6SA 4NO2B 4PJEE 1IM9B 1A64A 3CLFH 1E6JH 3DVFA 3QUZB 1B3JA 4WV1C 2O61A 5HVGB 4N8PA 3NCBB 2YD4A 5DK2A 2QSQA 4LPWA 4F58H 2A9MH 1MHEB 5IJKC 3ULVL 1WBXA 1G9ML 4Z0XA 5T1KA 4S1DD 4QXTA 4JFYB 1G0DA 2FSEB 1S9YB 4KTEL 4DKFL 1CVSC 4FQIL 1U95A 1YEGH 3CFKA 1MIEL 5DDHB 5FXCH 1L7TL 4R96A 3MV8A 2VLRA 1YEGL 3ZMRA 4XP4L 5F9OH 3PV6A 5DZLA 5FOBA 4H5SB 3EJYC 2MPAL 3RWJA 5JR1L 3T1WA 2YPLB 2GCYB 3FO0L 5EC1A 5IB4B 1BWWA 4L9LC 2VR9A 4K3DH 3M45A 4HIIA 4I0PA 2GTZB 5E5UB 4PGDA 4ODUB 5C08D 3C5JA 1NMCC 4LSQH 3B4NA 3U2SA 4XAWH 4WU7B 3GMMA 2AXGA 4X98A 5E5RB 1LO0H 3RY6C 2F74A 2R0WH 4QCIB 3QA3A 3VFPA 3P9LA 5GGRB 1NFDB 3KPPA 1NUFA 4GRWE 3CVHH 1GGIL 5K9KA 1F3JB 4H0GA 1T83A 2DQUL 5MI0C 1A9EB 3HC4H 4I4WB 3UYRL 3VXPB 5GSRB 4AEEA 4I5BB 4R97C 2X9YA 3HI5H 1MF2H 2Z91B 1W0WB 4CGTA 4Z5RB 3F7YA 1LE5B 4I3RL 5A2FA 4QF1B 1QSEE 3IDJB 2HTKD 1C1EH 5T3XD 5IK3B 2BSTB 3RTQA 1ZT1B 3TNNB 5DI8A 1QLRB 2FRGP 2IBBA 1VADB 2ORBL 3GBMH 4HKJA 4QHUA 1UACH 3GHBL 1HWHB 4JHWH 5T5FH 4C55A 4KZEL 1CFSB 3ESUF 1DLFL 4M9OA 3MRMA 5I71C 4MJ2A 2OLDA 3LQZA 3O41A 5HHQB 4OB5H 3GHEH 5I1GH 4UDUA 2J8HA 3MUGB 2R0KH 3QRFM 4KUCD 1KLFA 4LCCA 4YGAB 3L3DB 1GC1H 4FTVE 4G8EA 4BM7A 5KAQF 3G9AB 4N0YL 5D7KD 5ETUB 1ADQA 3L3IB 1TTGA 5DUBB 1IAIL 4YC2B 4W4OA 5ESAA 1G7QB 5HGDA 1QFPA 3REVA 5ISZA 4I18A 5DJ8B 4DFHA 4CU7A 5GS2H 3PABA 5KSBF 4IRJD 5LWYH 3OKDB 5MEQA 1WFTA 5J12C 5BV7H 2SEBB 1G7LB 1P84J 2AV7A 3SCMB 3QUXD 4IOFC 4NCDA 4JAMA 2JCCA 5E4EB 3VXNB 9CGTA 4LLWA 2X70B 2I5YH 4HC1H 3ARDD 1BBJA 3IXTA 1KJ2B 2CDFA 3BIKB 3LCYA 2VDQH 2X4UA 2A9ML 5FYJU 2FJGA 4UINH 3C8KB 1JI1A 4X6FA 1C08A 1QQDA 3QEQE 5HGAA 3F7PC 3WFCH 3MLSH 2YKLL 4QRQB 1CE1H 3C6LC 3GSOB 3TC9A 43CAA 1DEDA 5ID0A 1X3DA 3QHZH 1M6OA 4U3XA 1U8PB 1DBML 5FF6A 2ESVD 5KSVA 5EFIA 1C7SA 3P0YH 3GM0A 2I9TB 3V4VL 5L88L 4OFYD 3WS3B 3R1GL 1UKSA 4OZHB 1RZJH 2EIEA 3OKLA 4EDWH 4WI4A 4HK3J 3O6ML 2IQAA 2LV4A 3O4LA 1CQYA 3G5YB 1OTUD 5I1EH 2MHAA 1H3XA 1WC7A 1UM5L 4AQ1B 4JRYE 1K3ZA 3UBXI 3HE7A 2Q8BH 4BJLA 4HDIB 2X4RA 5SWSE 1RUKL 4FMFA 4LSUL 4ODSL 5IB3B 5ESVB 2ADIA 4OI8A 5DFVD 2VKWA 4XP4H 4PJFF 1N3NB 2CJUL 1LEGA 3O2VL 3CJJA 1VKXA 4QXUH 1GH7A 3RWFB 3KS0H 4PRNA 3AXLA 2DBJA 2Q3AA 4PJBB 3T0EE 4E41E 3WFDL 1T2QH 1X4XA 4NN7C 3EYVB 4WTXA 4JJ5B 3D25A 3QUZD 4YDKH 3HLAA 4ZODA 1GGTA 5C0DB 4XMLH 1EDQA 1IGJA 2NY5H 1QFWI 3SDCA 2KZ1B 4I18C 1Q8MA 1CT8B 4JG0H 2XNAB 4EUPA 3OKMB 1A3LL 3GSQB 4PJ8A 2NY4C 3K0WA 2DTSA 3H3PH 3MV9E 4IHOA 2X1QA 5INDB 3DBXA 3GB7A 3STBA 3T77B 5CWSA 2BY1A 5HYIA 3IDNB 3FB7A 4PJXA 1IQWL 5F1IB 4GKOA 3TN0D 4HS6A 4ONGH 1G9NH 4OLUL 1RUAL 3A0OA 4HW6A 3K7UA 2XV6B 3T65A 2CMRL 2FGWH 3BEVB 1P5VA 1D5BA 3TBSA 2R1XA 4YXKL 4GAYB 4JFFA 3MR9B 4C56D 5DF0A 4K7PL 2J8UA 1AXIB 4R7DB 1QBLL 4JFQB 1U3JA 4JM2D 1SYVA 3MV7D 4WO4C 1WZ1L 5T1MA 2EDBA 4G3YL 2C1PA 3QI9C 1I8KB 4M62H 4HLZG 1KB9K 4Z77A 1MHHB 2NMSA 4GW4B 3CVHA 4FMKA 1OLLA 1I1YA 1I3RB 4NKDA 1FLTX 1A7BA 1QVOB 2HLAA 5CEZE 4LCUA 1BD2B 3DV6A 1QR1B 3O9WA 2X9XA 5FO7B 5F9JB 3MZTA 4JPIB 1JUFA 3JUZA 5I19L 2WW8A 4HZLA 12E8L 1NUDA 3LEXB 5ADPL 2JB5H 2ICWB 4GRWF 4XC1H 5I30L 2X4QA 3INUL 2OTPA 4FOMA 4EOWH 3EFFA 4DKFH 3KYNA 4Y5VC 4TULH 5CJQL 5DO2C 1F4HA 3S35H 1FO0A 4L4TB 4JZJB 1MCHA 5EU6D 1ZA3A 4Q7DA 4YHPB 5GRVL 3VXTA 4FFZL 5IVOA 4HEPG 4WUUB 3BYTA 1OL0A 3W0WB 1M4KA 3MLWL 3WIIL 5ITBH 5C09E 1QFWL 1WFUA 4KY1L 4LVEA 5JTWA 5KS9F 2VWEE 1B0GB 4XC3L 1NCTA 1ZSDB 1HQRA 3T3ME 3MNWA 3RL1A 4Q9RL 1F3DH 1TPXB 4XWOD 4XPHH 4QHLB 4A6YL 5M95B 3ULVD 1A7NH 1EEZB 1IC5H 4ZPTB 1XIWA 3RWIB 1OGAD 2G75B 5EBWB 4DTGH 1VERA 4XVUD 4GRWB 3P0GB 1I1AA 4U2ZA 2BX5A 5D7LE 4PLOB 1MVFA 2XWBA 4HAGA 1MUJB 4E42B 2D4DA 4JO3H 1AIFB 4MD5A 4MA8L 4QY8B 2CIKB 5DMKA 1CFBA 3J7HA 1N2RB 1H5BB 1GOHA 5C0IA 1NC4D 2QKIB 5AWNL 5JOPD 1YMHB 1ACZA 4FQXB 4PRIA 5AD0B 1DUYA 1JTPA 4NRXB 4MX7A 2A6IB 1P1ZA 4D9QE 5DQ9B 2XRAH 1R5VB 5I1DB 2E6QA 3KJ4B 5JHLH 3KHQA 1ZMYA 4ONHA 2DLEA 1A9BA 4WWKA 5FO9A 1M7IA 1T0MB 5HDBF 5EO0A 3RIFF 3WE6A 1IKFL 2HTLC 2CRYA 4OGXL 4PJDF 1KIRB 5A2JH 1XGUA 4YQXH 1FL6B 3D0VA 4BSVB 2EDJA 3WUZA 1NGQH 3RHWK 4M62L 1JYWA 4QRRE 1LP9E 2QSCH 3MA9H 3ZKMC 3HZVB 1ZLUK 3TPUB 4IRJA 5HYQA 2OTWA 3FB8A 1T22B 1NPUA 1KYOJ 1LE9B 4NNPL 5FO8B 3OKOA 5T1LB 5IG7B 5CZVH 4KK5D 1B4RA 5ANMB 4JFYA 4EI5C 1RFDL 5EC2A 3GJFH 3CFKB 4H1LA 4Z7VF 1MCEA 1FFPB 1BOYA 3B6SA 5D1XD 4H5SA 5CFHA 5D7JD 5DMIH 2Z0BA 2GCYA 5GZNC 1I3VA 1T04B 1FGNL 4RZCB 3K2UL 4JVPA 2FDBP 4NZTL 5L2JB 1H5BC 1GZQA 1KLUA 2LU3A 4OZGE 1CDYA 4RRPG 4PJGB 2VR5A 4C56B 2XZCL 3GNMH 1KN2L 4HD9A 1A14H 3ZYOA 1GIGH 3VDAA 2VLLA 3BW9A 1CK0H 1PEWA 4LGRB 1FPTH 3BP5B 5LGHL 1G6RL 4FFZH 3MGAA 3SE9L 3BDYL 3P9LB 4UILL 3IAGC 1UEYA 2DRUA 3BKCH 4JDVA 4RRPA 5DJ0B 3K2UH 4QHKI 4Y16A 1K85A 4KRLB 5EA0L 2EYTA 4ZXBD 1WZKA 5E24E 2H26B 1ZE3C 4HX1A 4I5BA 5B4MC 4K9EC 4FZEL 1E4WL 5D7IF 2G2RB 1EBPA 4CRPA 3DJ9A 5ALBL 1BECA 4ETYA 1TJHH 4W4NA 2NNAB 1ZT1A 1T1ZA 2V2XA 3VGDA 1RZJL 1I9RH 1QBML 4NWUL 4NQEA 4HK0A 3BPNB 3QDGE 4G9FB 4JCMA 4P49A 2FYYA 4N0UA 1Z6JT 2JK5B 2HKHH 5CLTA 4YHIB 5F6HJ 1QRKA 1XH3B 3WN5B 5CS7A 3KPOB 4Q0XH 1TQBB 1FZOA 4ODHL 1HYRC 4PJ5A 5FUOL 3P77B 5GRYA 4XNMB 5GZOD 5ACZA 1YY9D 3EOYG 1YZZA 3TIDB 5CJXA 1ZKAA 3GGWA 2EXWC 1ND0A 4FFYH 5GJSH 1E4JA 1HNFA 4NO0A 4ZDHA 1OGAE 5JORA 5KZCD 4LLVA 4LLUA 1HHIB 4MGXA 3ROOB 4ZS6D 1BFVL 4WGWB 1I9JH 4AEHL 3VWKD 2DLHA 2QLVB 4Z7NF 1CR9H 1HH9A 1JFQH 4APQA 1TZGL 4GBXD 4LPXA 4ZFOL 1J12A 4J3VA 3UTPD 3LKQB 2WLYA 3VW3H 5E4EC 4JFDA 4OZFG 1F4AA 3BI9X 2MTPA 3IDXH 4HUWA 4JRXE 4WO4A 2J8OA 2JJUA 1J8HE 4DZBB 4O58L 2ZUUA 3QNXA 5DVMA 5FYJL 1BVKA 1KPRB 2BOCB 1JZ5A 4NJ9L 1QSFA 4P4RB 1PZ5B 3W5MA 1MJJB 1D5MA 5DYOB 4ZTPH 5ICZB 3CZFB 1A6PA 1ZWIA 4JLRB 3RUGE 4WHCA 1M05B 1ZTXL 3MJ7B 3TJEH 4F33B 4ZOCA 2NY2C 3RVWD 2P44B 4XXCA 1ZANH 1UKQA 2HWZH 4RDQF 5EO1B 4IRSA 4MDIB 3EJYD 5FGRA 1ED3B 1T66D 3OBAA 2NXYB 4U1NB 2NY3B 4NDMA 4ORZC 4WFFD 2VTFA 3SDDA 2LABA 3TH4T 2FJHA 2G9HA 3VH8B 1BAFL 1VKXB 4OLWH 3UTSD 3QI9A 4FQ2L 4NQSB 1CGSH 3F6IA 4JM2A 4OKVA 4IDJL 5HI4D 5MEND 4P3DB 4WEBH 5GZOC 4GKNA 2MQCA 3CU1A 3DMMC 3T2PA 1K8IB 2YKLH 3IJHA 1BVZA 1SMOA 4A6YA 3QAZB 3BH8B 2EDYA 3VGBA 1BBDL 1R3IL 5F9WB 3SQOL 2H6PB 4Y4KA 2F15A 1CLYL 2UWEF 2OP4L 5F6IB 3GMLB 3GZKA 2J5LC 3IJYA 2F5BH 3UZQA 5D7LB 4PP1C 2FL5A 2V7HB 4G9DB 1J0JA 2AK4A 4MXVF 5BJTA 3D3VA 1T66C 1YEDA 4GG6F 1BF8A 2J3SA 5FYKU 2ICEB 4EOWL 3I75A 4KJWC 1T21A 2AI0L 1I7ZB 4LU5L 5T33H 1YYLL 4FTVB 3MRRB 2AJUL 4O2FA 1OPGL 4IRJC 3ALWA 5FYJE 3GK8H 4V2BA 2L7JA 2VDML 2OL3B 2V2TB 3EO1A 1VA9A 1YQVH 3VFMA 2VZVA 2FATH 4GG6E 2EIZB 4F9PC 1SJHA 4GS7B 4R4ND 6FABL 1CGTA 4PJCF 1UWXH 2DQEH 3QIUA 3TLRA 2J6EL 4PRBA 3QG6A 4EUPG 1DZBA 3ARSA 2DM2A 3D87B 3DO7A 2DLIA 3T0VA 2VSCA 2A0LD 5T1DH 3BX7C 3OAUL 1TXKA 1MHCB 3CH1A 4ELMA 4HWUA 3KXFB 5KS9A 4LSVH 1AR1C 1FYTE 4PGCA 1RUPH 3BO8B 5I74C 1HNGA 4L4VA 2VQ1A 3GI9L 4KVCH 3SEPA 2V17L 4RQQA 3CMOL 1PYWB 4KK8C 4Y2OA 2FIKB 5TQ0L 1NDGB 2W38A 2BCKA 3Q3GB 1WBYA 1T6WA 5C0JB 5F7UA 1RZKC 4Z95L 3KPRD 4EBQL 5FHAL 3BZEB 4CMHB 2EO1A 3X12A 3CFIC 1AQDB 1P5UA 5GGVL 4Y4KC 5ID1B 2E8ZA 3QWRA 1JPST 4G6JH 3W2DL 1YNKL 1MFCH 4MD4A 4XVJL 1BBJB 2VAAA 5C3LD 3OX8B 3V5KA 4Q9BA 3PGFL 2VDOH 2HT2C 3BEWB 5FCSH 1FN4A 3TPKA 4GW1A 2CLRB 3ECBB 4QRQA 5DD1L 3S97C 3P73B 4TTDC 3GJFA 2X09A 5F7HA 3C09C 3QP3A 2C3XA 3BP6A 4F7TB 3WMSA 4KPHH 2P47B 4PGZA 4JFEA 5FGBA 2XZQH 2NCMA 3EAKA 5DD0H 4POYA 1MFBH 2K1MA 5I30H 3ZHKA 2XKNA 3OKEB 1EO8H 4FQXA 4PRIB 3BKJL 5AD0A 2V2WA 1D5ZB 1A1MA 1IL1A 3CXHK 2IADA 3BYYA 3ZTNL 4UBDC 1B0RB 2BY0A 2EXYD 2R0ZL 5CGTA 4EN3C 2COQA 2DWEB 1T5XB 4IDJH 4NGHH 2VNCA 4Z7OE 5FFLA 3H3KA 3RTQD 2VABA 1WIPA 3E2HB 3QDMB 3MLUL 5DJXB 3MRKA 5ICXA 1YEFL 1I8IB 3KYMB 3GSRB 4O02L 4F37K 2DQDH 2Z4QB 4PG9B 4XB7A 1PG7L 4KZDH 3EDEA 1MAML 4HG4J 4Y5YB 4U4BA 4HH9B 4F9LC 2BY3A 8FABB 2G5BB 5TE7L 4IJ3B 1R3LA 4OIAA 1NJ9A 3WFEL 1OGAB 2YBRA 3MREB 2XG5A 1S7SB 3PV7A 4ZMAT 3PGDA 2VXQH 3U6RB 4G5ZL 4NYLB 1WWWX 4R0LC 5C7XL 1KCUL 3V7AG 3LKPA 3S5LA 3O4LE 5D7LD 2ZWLT 1ZLSH 3ILPA 1OSPL 5JA9A 4ORGA 1E28A 2IBZX 1EEYB 5E5MA 1PEZA 1INEL 4LQFH 4R26L 4PG2A 1C16B 4F2MB 2D31A 4KAQL 3RPIA 5E7BA 3W9EB 4Y4HB 2F54E 2XFXA 1A3LH 3CVHL 3JSSA 2VDMH 4QTIL 1F8TH 2W0LA 4WTZA 5M7QA 1J8HB 4NQCD 1NUGA 2DIAA 4N5EC 2BDNL 2RCSH 1SQ2N 2AJYH 3MUZ1 3DUHA 3L6FA 1H0DA 4P5TA 4AIZA 4OFKA 5ABDE 5F7NC 4PJHE 4XGZB 4KKLD 3S36H 4CNIA 4X8JA 3RI5F 4JHWL 3F65A 3H9ZA 2B2XH 4WRLA 2W65B 1OVZA 2E27L 3CNKA 1FG2B 3CC5A 1GGCH 5IBLC 3KPLA 5E8DH 2PXYC 4QXTB 4XTRD 3UPAA 5CLWA 3RX7A 3EOTL 4DGYH 2X5PA 3HKFA 4R3SA 5LAXA 3P11H 3S98A 4Y5YC 3UYRH 1F4WL 3D39E 3PV6B 3V7AE 2GY5A 1FC2D 3ULSA 1KIPA 1JUFB 3BISA 4GXVH 3TBWB 1AXTL 2A9NL 3MYJB 3KLAB 3LEXA 4X6BA 1GSMA 2Q3ZA 4L8DB 5DQJB 2VZ3A 2C3VB 3VFOA 5DK0A 1JF6A 1S9WA 2B4CL 3LSOB 4ZS7L 1T1ZB 1OTUC 2BJMH 3PG2A 2ZSVB 4EIGB 1HXYA 2LTQB 3IETB 2CLVA 5EOCH 1HILB 4Z0BL 3MOAL 5IM7B 1UB5B 3PXJA 4KJPC 1MQKH 2ZKHH 2P5EE 4QRPA 1OP3H 4OCSH 1KB9J 3BVNA 3EYFA 2H45A 1E4WH 2CDEB 5HPOA 4LHQB 3O3AA 5D7IB 1OAYL 3VA6A 1FV1B 1Q9LB 4OV5A 4ZPVA 4X5XA 1SVZA 3CCHA 1KXQE 4NC0B 2WZPD 3FCTB 2VXVH 2JF1A 4P5TD 3HE6D 5E95B 1XIWB 2FLBT 1MEXL 2BVTA 3L5XH 3VRIB 5JXEC 1BX2B 4X9FA 4ZFZB 3ZTJH 3L3JA 4OLEA 1J18A 1NGXA 2UUDK 1AE6H 1N5YH 1NBZB 4S0SD 5ENWB 5B8CA 1MCPH 4K2UL 3G5VA 3AVEA 5I76B 2AERT 1Z2KA 3AMLA 3HE6A 4ZS7H 4NC2B 1OT1A 1MCOL 3IDIA 2GIYA 4LCCC 4HF5H 4PR5A 3MNZB 1DQLL 2DQFB 3BXNB 2GJ6D 4FNLH 3NZHL 5IROA 5AAWA 3VRJB 3TWCL 2NXZC 3SO3C 3PDGA 1L6ZA 2R2EA 3K8KA 4HJ0C 2K9UA 1ZS8A 4K7PY 4HIJA 5GSRA 5J0BA 3UPRB 1CI5A 4ODXB 3AY4C 3BQUC 3I02A 2EDTA 4ODVL 2EDOA 3P4NA 2BC4A 4KK6D 2VH5H 3JTTB 3IAQA 3O3DA 3PJSB 4W70A 5D96B 5IK3A 4ZYKB 3TIEB 4MZ3A 4OBRA 2UZIL 2B1AH 5GIRB 4OFDA 25C8H 3JWDH 1A7PL 3LEYH 1FL6A 3D0VB 1G7LA 4MJ4A 1MJ8L 4ZO7A 4OGAC 3TBVB 5DUPL 1PY9A 4ODVH 4H0HB 1AO7E 2A73A 4L4JA 1ZHLA 1NH6A 3CMGA 1NCAL 3LHPL 1NGWB 3ZT7A 3V4UH 1IGFL 5DRNB 4YXHL 4GLRI 4OCNC 3BJLA 3BRGC 4YFDB 3FOLA 4YNYA 2AP2A 1H3PH 2HFFA 3GSWA 2R9HD 1MRCH 1T1YA 5L9DL 3BE1H 4X6DF 3REVB 1FHGA 1RK0A 2AK1L 4WW2B 4GKNB 3LS5H 4AM0A 3RNKB 4NKOB 3JWOC 3RDTB 1D6EB 4OAWA 3SGJA 5FM4A 2BNQA 1NLBL 4N8CL 3TA3D 2XPGA 2O5ZH 3FZUD 4HFUL 2JCCB 1E27B 3K1DA 1DQMH 5GHWH 2E7HA 1A6TB 4KK8D 5GSVA 4GMTL 3PHSA 4NZUL 2HTKC 3VI3E 3FTGA 4HMCA 2VOTA 2IH3A 2AJVL 4MQXD 3UJIL 1ZHKB 1CGVA 4PY7A 1XAUA 1ZVHA 1F4XH 2QJDA 3Q5TA 3PQYE 4M7ZB 4LPVA 1NLBH 4N8CH 5IEHA 4UB0H 3QWRD 4M6AA 3WYRA 2HFTA 3QIWC 5DJ6B 4PRHE 4Z0XB 5I9QC 1NCDH 3G5XB 4YWGH 4HGWA 4PJBF 5EFIB 7FABL 1A14L 4HWZA 3TBYA 1FPTL 1F2XK 2XICA 4XPHL 3C87A 3HLAB 3U4BH 3ZTNH 2RJMA 3O3BB 5KVFH 1MNUH 5C6WH 5IIEA 5F7DB 3N85L 2IPUG 3QR2A 4X6CA 4UOJA 3R0NA 1U6AL 5CMAB 1F4WH 3QQ9C 3WIIH 1R24A 5JQHC 4M7ZC 5F89A 4L9LA 3MRGA 2JJTC 4CVXA 4OF0A 5DUPH 1R3KA 3A67H 3EZJB 3GMMB 4LPYA 5F7YC 1AKJD 2I25N 3EYSH 4R2GB 4J3XA 4R4BA 3V6FA 5J12B 3QIWA 1EAPA 1MRFH 2D0HA 2B39A 2ZOLA 4HIXL 5DK3A 2JB5L 3DX7A 2YHGA 1AKJB 1I85A 4NQDB 5C0BE 1TLKA 4X83A 4HBQA 2X9WA 3IGAB 5DJAB 1I3GL 1EJOL 5FKAA 4Z78B 2Z92B 1R5IB 2BDNH 5E2JA 4OQTL 4Q0XL 1BEYH 1UA6L 1TVBB 2MNUA 4DOHE 5DTFB 1AD9B 2ATPB 3LH2H 3V6OA 5EZOL 3TCXA 4Y4FB 1A7RH 3FZUC 4J3UA 1I9RL 1QBMH 3TT1H 4PJXB 2OXHA 4RX4D 4U7SA 3S3SA 1VFAB 1GHFH 4D3CL 2AK4D 3SDXF 3BIBX 3CFDB 3HRPA 4MD4B 1ZOXA 4OQTH 3SDCC 2R0LH 4K7PH 3OX8A 3GI9H 1CFSA 4RWHA 4K3GA 3ZT5A 3ARPA 4J4PD 3C8DA 5ESQA 2I07A 2ITCA 3MV7E 2P46B 4PJDA 2JLLA 3TFKD 1QYGH 3OGOE 4J3SA 1CDHA 2Z31D 4HK3N 5IT2L 4HIXH 3AC0A 3LEYL 4Y5XA 5JPNA 1ZGLA 3HB3C 3LY6A 3OPZH 3VU2A 1T7ZA 1HOCA 1D9KC 5MI0B 3VXMD 4UMGA 4CL7A 5D6CA 3HI6L 1EAJA 1MCJA 4LCWA 4WTWA 5I1LA 5I1JL 4UQ3A 2PYEB 4F33A 2FR4B 4MWFA 1DN0A 2XZCH 3FB5B 4ZSOA 3BFOA 3QH3B 3SDDD 4DGVH 4KJWD 1A02N 5JO5A 2IAMD 3V5DB 2AJZA 3F7VA 4GRMA 5DUML 3PWUA 4ETQA 4K3JH 3MNVB 4JPVH 1BQHG 1T0NB 3WFDH 4WFGE 3ZKQD 4DKEH 4XCFH 3DYMA 1OD7A 2Q86A 1B0WA 3L3OA 4M9PA 4EQ3A 5DJXA 4JN2B 3RWIA 1CF8H 4Q2ZB 3H7LA 4ENED 1DVFB 4F7PB 4PG9A 2X1OA 4LAQL 1G9EA 3H2WA 4EQ2A 2APBA 5FA4A 4LQ1A 1YEEH 5IFAH 1EHLL 3WD5H 2WWMC 1N59B 2D9CA 1FG9C 1F3DJ 1Q9WB 12E8H 4P3CH 3U0PA 1QNZL 5K9OA 3VXSE 4WV1B 5D8JL 2O5ZL 2YD2A 1IAII 2GQHA 1MAKA 3OZ9H 1MQKL 4HDIA 4O2CB 3IFNH 4HEME 1ZA6B 4JN1H 4APQD 3OB0K 3ARFD 1CGSL 3OF6A 3WFBL 4U1SA 1A9BB 1JCKA 1P4BL 5FO9B 5I1HH 1JWSB 2DJ4A 1BFOA 4FFWC 4RIRB 5E6ID 5D2NC 3NPZB 1CDGA 4UINL 3GIZH 1UADC 2AQ2A 3HR5A 1YMHA 2ERJC 2WIIA 5IHBA 4Z7OF 3RA7H 1HYSD 2CR6A 4YXLH 5J6HA 1D5XB 3OJMB 2WSKA 5T1DL 1KCRL 3BP7A 3DBXB 4DK3A 4Q9CA 4ERSL 1MHPL 5I8KH 3QG7L 1TNNA 3C60D 3AGVA 1CXLA 2EDHA 3VJ6A 3BWAA 4PTUA 1B6DA 4DTGL 4WY7L 5EUKB 3TEUA 1L7IH 1QHPA 3FONA 2HVJA 1S8DA 3MLUH 1PZUB 5D6DA 4CUCA 4ZFGH 3RVXC 4I9WD 3MLTA 1FBIH 2VUYA 4NNYB 3BMVA 2WBJB 5C8JB 3VWKC 5EUOE 3QG7H 2VXTL 5E6YA 5KSAC 3AB0B 4W6XB 4YHZH 3Q3GA 1I7TB 1HILA 2DLFH 1SBSL 4R0LB 4Y1AB 2R2HB 2IBGA 2OQJA 3PWPE 1H3WM 4YFLF 3SKOA 2OSLB 5L8LB 2JCCE 3BVNB 3EYFB 3IDYB 3O4OB 3V52H 3RVTC 1IC4L 3W81A 4NRZA 3I50L 2IG2H 4XXCC 2XG4A 5EZJB 2CRIA 2AJSL 1MF2L 1VB9A 4X5XB 4G7VH 1BQLL 2NTFA 4MAUH 4N8VG 5I18H 5F70A 3OV6A 5A2IH 1UH3A 2Y4SA 2J88H 1TVHA 2OX5A 3QQNA 4JPIA 4PJ9B 5I1HL 2JB6A 2PXYA 43C9A 3WLWC 1JZ4A 1MIMH 4Z8FL 4TSCL 3QUKA 4W81A 5FHBL 3S5LG 3BP6B 1J0HA 4TQEH 4GSDL 4NFDA 5F1KC 1ORSB 2YD9A 2W91A 1LO0L 1RMFL 3RI5K 3ULVF 3VFSA 1IGTA 4TUOB 5ERWB 5JQ6L 3BGMA 1NQBA 4ZO8A 1E4XI 2QQKL 4X7TA 3AS1A 1A4JB 5INCB 4NO0D 1EUTA 4EBQH 1MCFA 2VO5A 1WVZA 1TJHL 1Z5LA 5DSCA 2H2PD 1JK8B 1Q94A 2KQNA 2QQLH 1BWMA 4BQ9A 1YJDH 3FO9B 5KVDH 1JNNH 1L4IA 2JJWA 4FQ1L 4MQTB 2YWZA 4GRLA 2BC4B 3GSUB 4LPUA 3JTTA 3O3DB 5BV7L 2WP3T 3D5OF 4KTEH 3WD5L 1U8JB 3EGSB 5E6IB 5GIRA 3VE0B 4AQOA 1Q9OA 2DTML 5C71A 2JJSA 5EU5A 3V6ZB 4ELKA 5D1ZD 3VFVA 5IESL 3VXOA 4L3ED 5DI8B 8FABA 1ZVYA 2EECA 4FQQA 5D6DC 4ZNCD 5B21A 3QISA 4XZUA 1T20A 3JZ7A 4MCZB 3E1F1 1QFOA 3MLZL 3RZCD 1HDMB 5FCUL 4K71B 3NACL 4OUUB 2QKIA 5EBGA 4WO4B 1RI8A 4BKLA 3GSNL 4RGOH 3KPQA 4DQOH 1QKZL 4K8RC 1J1OH 1OPGH 1U8HB 1NCWH 5I8KL 2NX5E 2RR3A 4M7JH 4YK4C 3VD5A 2V5RA 3BN3B 1X5GA 1MCDA 4Q6YA 5AG9A 4NP4L 4NKOA 1YYML 3MJ8A 3HAEG 4BQ6A 1U8MB 4AZ8A 1XF4A 5C08B 5D2NA 1U2HA 1NUNB 5EDXA 4LCYB 4QOKD 1GZPB 3BSZL 1VADA 5FEBA 4UNVA 1LO2L 4OZGB 1QYGL 5GSVB 3HI5L 4PJGE 4CU6A 3BT2L 3VG9B 4H1LG 2FHBA 1U8NB 3OAUH 4OZIF 1WWBX 4XP9L 4HGMA 1FFNA 5CJBA 3RY4A 4KZDL 1R5WB 1QSFB 2HKHL 2VLJE 3LVEA 4PJIA 3PXHA 2HJFB 3O6FD 2IALA 1EFQA 4OM1L 4XBPB 2IAMB 2V5TA 5EOQL 1NL0H 4PRPB 3JWOL 4XNUH 1OM3H 4XAWL 4J7RA 1YNLH 5TDOA 1QHOA 2BHUA 4L8BB 3MLYL 3MBXL 1SEQL 3JVGA 4Y1AE 1P9MA 4X6BB 4G8IA 5CSZA 2R4SL 1YEEL 5AZ2L 3OKLB 2YUVA 4TNWK 3VXMB 5JOEA 1ORQA 2L0DA 3IXTB 4M4RA 1MOEA 3Q2CA 1IC7L 5HHNB 5HYSA 4NUJB 1G7IA 1YEHH 2CDFB 3BIKA 3ULUF 4U33A 2X4TA 1D6VL 2XN9E 4WU5A 1Q1JL 4P46A 1YPZF 1F58H 1MCBA 3T0EC 5JW4Q 2C4FU 3IU3B 2P5EA 5I15H 3HZYA 2E3VA 4RISL 2IANB 5FDYA 3QNZB 1T1XB 4G6JL 3LV3A 4U1KB 5F9AC 2CLZB 4N0YH 2RIKA 7CGTA 5J6GB 1MQ8A 3QWOB 4OD3L 5FYJH 3EYVA 3QEQA 2GY7B 2AABL 3HG1E 1NC2B 4OFPA 2YK1H 1XR8B 4Y4FD 3QHFL 3ZKSD 2F19H 3LAFA 2J7LA 1N0LA 5JMRA 4B0MM 1UJ3B 2BRRL 1HH6A 4YX2H 2MKLC 3SY0B 3T1FB 4Q58C 1AY1H 2AJVH 4WHTA 1LK3H 3G6JA 3SKJL 5L7XL 3KYOB 5C92A 4KHXH 4Y2DD 1CLCA 2A1WH 2PTTB 5GHWL 5GS0D 4U6HA 4PR5B 1WFNA 1B88A 1XF5A 1QD0A 1NGZA 3G9VA 1MWAH 3KXFA 5KS9B 4MDJA 3WXWH 3L5WA 1C5BL 2H1PL 1N64H 3BZDA 4D9LL 1UT9A 2DM7A 1S7RA 5CINL 3K80A 1ZGLB 4OZIE 4WUKL 3PGCA 3DRQA 3GIVA 2OL3A 2D7TL 3SDCB 5BV7B 4P3WA 5FUOH 4AH2A 4YHML 3ALXA 4DVBB 1QLEH 1ND0B 1J0KA 4LLVB 1K8DA 2Y7QB 2YUZA 4RCAA 2IGFL 1U93B 3MRBB 4HJ0D 3IDJA 3RUGB 5B38A 1F6FB 1G9MC 3GJFK 4MJIA 3DO7B 4OZIA 4M43H 5D71L 2EIBA 4D9RE 4JQVA 3KPMB 1I1YB 1I3RA 1XGYH 4F9LA 1MREH 2ARJQ 1MVUA 3GKWL 3C8HA 3IKCB 4R8WH 1MRFL 3FO0H 1QLFB 3SBWC 5EBMA 2FX9L 5FO7A 4OD2A 5IEKB 1N4XH 2HT4C 5DURB 3BD3A 1UH4A 1MI5B 2R1XB 3EFDH 3P4OB 4IM8A 2NXYD 4XCNA 1T1YB 2H9GA 2NY4D 3SJVE 1AGBB 1IAMA 5DMYA 2ZUTA 4F7EA 1K5NA 4R7DA 1R3IH 1D6EA 4LCWD 4XBEL 5DJZA 4FFVC 1MCRA 1ZWIB 3QDJE 3ALPA 3VXUA 2JIXB 4JG1H 1FC1A 2R9HC 3MLVL 4JRYA 1QPXA 3S4SG 3CPLA 35C8L 3DX8B 4Z7VE 3VGGA 4KMTH 4OIIH 4MA3A 2XWTB 5FA3A 3L1OL 2FECL 3LIZH 1ED3A 4YDKL 4PJFA 5JQ6H 3MQIA 4KHTL 4RNRA 3HNVL 2XN9A 5DEZA 1F00I 2AW2A 4WFFE 3NCJL 5DD3H 3VH8A 5IWLC 3H0TB 3D9AL 1NLDH 5IGXH 1I8MA 3P9MB 1T03H 4ZPTA 4NNXB 1KTLA 3S34H 5C9KA 1DQQB 3O2DH 3KYMA 1FIGL 2G75A 5EBWA 3CVIL 5C0BB 2J88L 1KIUA 5ISZD 1FDLL 5GS2D 2BSSA 3RWGA 4YHOH 1DUZA 4XAKD 3ULVE 3V52L 1NGPL 5DHVH 5I74B 4LKCA 4NZUH 4G6AD 1NFKA 2JJVA 2ZUQC 1NFIA 1MLBB 3STZB 2WUCL 3MRNB 1E0OB 3TYGH 3HE7B 3R06B 2VABB 3QDMA 4DKEL 5ICXB 1GGYA 1X4ZA 1EFXD 5E08L 1EK3A 4G8GD 4P2OD 3HE7D 3MLSL 3NA4A 4O2EB 1KN2H 1LD9A 3QWQB 5E9DD 4ZXBC 1U8OB 4FTVA 3ARGD 2HKFH 1RY7B 3BPCA 4P4KB 2NX5B 1EH9A 1YDPB 2OTUB 3EOTH 1ITCA 1UQSA 3BUYA 2YA1A 3LB6C 3LRGA 4BA8A 3HMXL 4OCXH 2W59A 5JIHA 1KFAL 4JVUA 2BFVH 4RGND 3TH3T 5FDWA 2F8VA 2EYSB 3HNTL 4MX7B 2W1NA 3LMJH 3L95A 5CEZD 3QA3B 4LSTH 1IILE 1X5AA 4JZNB 5CZXC 1MY7A 3H9SE 5HDQL 5HI3D 1A4KB 4H25A 5IOPA 3MUHL 3BQUB 3HE6C 2E27H 1U9KA 1T0PB 1IC5L 4AEIH 1S7QB 2JIXD 3AROA 2DOCA 1KC5H 5D93C 5J3HC 1J10A 3KLAA 3UTSE 5FB8B 1T5WB 3QUXA 2FEEI 5GGQH 1FFQA 1N5YL 3KDMA 1OSPH 2VITB 5FECB 1PYWA 2AXFB 3U83A 1P53A 2BCKB 5GGTA 2XZZA 3ARBA 3FQXA 3CU7A 1N6QL 3HC0B 4QXUL 2IEPA 1DSFL 2GTWA 1CGYA 1UFUA 2ICCA 2EXYC 1MJ8H 1KPUA 1ZHNA 5T1KB 3U7YH 4RMRA 4Y16B 1JJUA 3INUH 3NAAH 3KPSB 3V0VA 4HWBH 3MUGA 1F6AA 4UIMA 2WV3A 3C5ZC 3QZWG 1LO3H 4Q6IC 3RGVC 5DD3L 4M61B 2Y07H 4U6XA 4ZFFB 3WBDA 5JW4N 4NQCB 1DVFA 4C56A 3RGVB 1H8OA 1RJYB 3NCJH 4PD4J 4QGTA 5I1KH 2BY2A 3T3PE 4RSVA 4IRSC 5GGUB 4K3JL 4N0UE 2UV3A 2Y06H 5F1NA 4GAJL 4YDVB 2BNRA 4OF3A 4XZUB 1LILA 2FEDD 3BD4A 32C2A 4Q9RH 4MNQE 4OF7A 3RAJL 4U0RB 4RAUB 4XCYA 3T08A 3OKEA 5TFSL 1DBAL 1NCDL 3UTZB 1IL1B 2RAMA 2DIBA 1ZT7B 1AXTH 2A9NH 3KPRE 4ODXA 3U1SH 1U41A 2GHWB 1F4XL 5IB4A 3HUJE 1DL7L 3R0MA 5J06A 4JREB 2DKSA 4FN0A 5FF6B 3WL9A 4X7CC 4XNZC 1EMTH 3CFCL 5E1AB 5EU3A 4FQ1H 3CLEH 2GK0A 4HCRH 5D9SA 1HHIA 1YEKH 3FRPG 4N0CD 3C5JB 1QP1A 4I0PD 4XPAL 2CUHA 4PJXF 5TPWH 4R97B 2XWBB 3H9HA 3IF1B 5D96C 2E5EA 2ZKHL 3KLSA 3SKUD 3T0AA 2CIKA 2P5WE 3H8NA 3WN5A 1EGJL 5IF0B 3B2UC 1YQ2A 4LLYA 1EHXA 1ZHLB 2AK1H 2P4AB 2VYRE 1BJ8A 1KN4H 4K3EL 2R2EB 2VXUH 5E1HB 3TT1L 3B8SA 1T4KA 3F12A 4XVUC 4ZFOA 3W2DH 1R5WA 4PJIB 2K7PA 1A7QH 4HQQH 3QUYD 5CJXC 3ZDYE 3VFTB 3PJSA 1V7NH 1OARL 4G8EB 4KTDL 5SV4A 2D0FA 3TIEA 1J1PH 5SWZB 5T3ZL 4D9LH 4R7NA 1H9VA 1LO2H 3SCMC 2HFEA 2VDRH 3FFCD 4WWKB 5CINH 5EG6C 4C4KO 1YMMB 5C0CB 3SHSA 3KR3H 4MXQD 1NANH 3HZKB 3ULUC 1S7TB 4F80A 5HI5D 4RAHA 1U8LA 1P4IH 1MI5E 2UZYB 2R39A 2VXQL 3LKQA 4HUMB 4H8WL 3T2QA 3BWUC 4NP4H 4AIZB 2N7BA 1AD0A 1OB1B 3VGAB 5INDA 3UZEA 4P23D 1GGIH 5H37G 3B5TA 3O41B 5HHQA 2DDQH 5ITFA 1WEJL 2KBGA 4NBYB 3IS0X 3DX9B 4LBEB 5IR1A 3S36L 1PKQA 3MJ9A 5DJ6A 3H3BC 2VXUL 1AXSB 3L3KA 4X4ZA 1FH5H 1MJUH 3QEGH 3WNMA 2P5WD 3Q6FB 4JFFE 2VWEC 3NCMA 2XQBH 4ODWB 3EBAA 1MWAB 3B6SB 2P8LA 1E27A 5GS1C 5JW4R 5DQDL 1U8IB 3HZMA 1KJ3H 3AU1A 3QO0A 1YMMD 5C0CD 5IVXE 3F62A 3FT2A 1D6VH 4I13B 3SDAA 1TENA 4JO4L 4MCYA 1GXEA 3QPXL 3BD5A 4U7MA 4HG4K 1KEMH 5LCVH 3GMQA 3ZKNC 2FD6L 5HHOA 1RZGA 2X4RB 2FEDC 3K8LA 5C0RL 5GRUL 1KEGH 3EOBA 4D2NA 1BD2A 3CFBB 3IU4L 5D5MB 5FM5M 3TVMC 2NY5C 3V0AC 1CFNA 4K71C 5BMFH 5TE6L 4S2SA 1NL0L 1UH2A 3MBED 5SWQA 3GIVB 5L8JB 3MCLL 4IIQB 3GSUA 3WHXB 4HX1B 5KSBA 4OZHA 1DTUA 1IBGL 5F7KC 3TNMA 2Y7QA 5C0GB 2VUOA 1BLNB 3DX6A 1S7XB 4N68A 3K8MA 3Q6GL 2X7LB 5DVOA 1AFVH 1JHKH 2B1HH 4LHUD 3DTXA 2QQNH 1GAFH 1K4DA 3IDGB 4KU1A 1FQ9C 1UWEL 3QFJE 4LEXH 4Q74A 3T77A 5LBSH 5F3HB 4OCLC 4UTAH 1RZJC 4LCWE 4LRNH 2VJXA 1JWUB 1L6XA 5IEKA 4M6ML 1HINH 1FCGA 4XI5C 5A3IC 4U0RC 3P4OA 3GM8A 4LNRB 1V7NL 3OJDA 1RZIA 3THML 1RUMH 5J13B 4HQQL 4JKKA 5FUCC 4NHCH 2XNAA 5CILL 3SDAC 1FZMB 2E9BA 4PJ8B 4JFED 5CILH 4JM4L 5B39G 2QSTA 1N2RA 1KC5L 4R90L 1I4FA 2YRZA 3JXAA 4QTHA 1CICC 3ZYJA 3PUCA 3MLRH 3ZZ1A 2PW2B 1HSAA 1SY6H 3K3QA 4GG8B 5JUEL 4OZFB 4RGNC 4PGEB 3QDJD 4HKJB 3RZCB 1L7IL 3BN9C 3WSQH 4I1NB 1VEOA 2DM3A 4YXLL 3C6LD 2BVOA 1FN4B 3D6GA 3H0TA 3L3OB 4KRPC 4L3EB 1XF1A 5EBLB 4ENEC 5J11C 1DQQA 4HZLB 2FBJL 1NEUA 3IJSA 4KQ4L 4WWKC 2CXKA 5ICYB 4WW2A 3DWTA 4AM0B 1XGUB 4LSVL 3GIZL 3UTQA 5DRXA 1UXWA 4PFEA 3PWLB 1DQDH 5CJ8A 3X12B 2FR4A 3ZDXE 4JZJA 2Q8BL 3F8UB 4TSAH 5F6HI 3PABB 4IOFD 1T22A 1MI5D 4NC1E 1T7XA 4TOYL 3CVHB 4K55A 2F8OA 4IOIA 1QVOA 1RZ7H 4I3GA 3SCMA 3B9EA 1CXIA 5C0AA 1RZ7L 2WK2A 2I9LB 4OF5A 3R06A 4NQXB 5D2LB 3TO4B 1MFDL 1X5HA 1LEIB 3NCEB 1MFNA 4X6FB 3F5WB 3VFUB 2X4QB 3QI9B 4KRPB 1ITBB 2X10A 5F9OL 2Q7YA 1W72L 4GXVL 2Y6SC 5GS1B 2ZSWA 2EDEA 4YE4H 3DXAB 5E94B 4U6TA 1U36A 4D9QD 3DO3A 1TDQA 4S1QH 3S7GA 4RMTA 1J1XL 4BUHA 2BOBB 1LK2B 4GO6B 3VXRA 1FVCA 4PPTA 3OR6A 1E6OL 2DQCL 4P2RB 3CX5J 2CGRL 4S0TD 3HFML 2KQMA 3HNSL 1CF8L 3TJEL 2CKNA 3G6JB 2IPTH 3C9NB 4FS0A 4U05A 4XVTH 4Y89A 4JQVC 1F45A 3EUUA 4YC2C 1S9YA 3WNOA 4CW1A 4UV4H 1CCZA 3GHEL 5I1GL 1MH5A 1FNAA 5BS0E 4FQPA 4FFVD 5DUMH 1AGDA 4UIKH 4YHYC 3NPSB 1LEGB 4QNPF 1JNHB 4RMVA 3DVNB 4DKDC 4HH9A 1HQ4B 4MA1B 3L5HA 2NY1C 5HGBB 4QY8A 4NNYA 4O58H 2J8UE 1BFTA 4LSPL 3SGDH 3IAPA 4BSVA 1CD9B 3L6FB 4G42B 5FECA 2GTZA 5C0EA 2PTVA 4BSWB 1GCFA 2OTWB 3FB8B 5GXBB 1JF1A 1AD9A 2ATPA 1N6UA 5DT1H 3NMEA 2YR3A 2F74B 5F7LB 1AO7A 1J7VR 4TUKH 3X14A 4XMPH 2VE6A 1VFAA 1BVLB 3KPSA 3MOBL 1C5CH 2R1WB 4HS8H 1A9EA 4JQIH 4H26A 3EO9L 3P2TA 1XCTB 4DEPB 4TVPD 1WZLA 4LAJH 2DL9A 1GGBH 5HVWA 4LOUC 5I8OL 1BIHA 1TQBC 4QRRD 2NX5D 2CRMA 4LRIC 1P4BH 3LH2L 4M6NL 4ZSOE 2J6EA 3HAEA 1Z9LA 3OB0H 3WKNA 2EKJA 4OFVA 1I9EA 2HRLA 1ZGLP 4NWTH 1JV5A 3T2NL 3PWPD 1QNZH 4HPYL 4TRPL 5D8JH 1NCBL 4QLRA 4LVOB 4EI5A 1QRND 1IAKA 3T0EA 1SYVB 4KDVA 3FT3B 2VZ1A 4L3EE 5B22A 4GT7A 5EC2B 2M1KA 1BJMA 3KYKH 3FB5A 1DBJH 3GMRA 4MZ2A 1I9JL 4QYOB 5T1LD 4YBHA 1MCWM 1NMAH 4ODTL 4PJ9A 2R56L 3QFJA 3CCHB 3ULVH 1PKOA 4NQVB 5IB1B 3IFPA 1OTTC 4XH2A 5HGDB 4MA1C 5DFTA 4OT1H 1FAIL 4ZO9A 4CJ0A 3E2HC 1RU9H 3TO2B 1RULH 2HH0L 4KK6C 2O61B 5IFHL 4HT1L 3BP5A 2HH0H 3NIFE 4CN1A 4EN3B 1WV7T 4NIKB 3CDFA 1Y18B 3G5VB 4ZTOH 4B7LA 4C83B 4NQEB 1DUZB 5E8PA 5KJRH 3SDYL 4P2QA 4WNQB 1NFIB 2H3NB 4KKAC 4ZO6A 3NABL 3I2CL 4X7SL 3N1FC 4NM4L 5C09D 4BFIA 2LAGB 4OZFH 4Y5VB 3GSOA 4Z76A 1ZSDA 2V17H 3KXFE 2PKDA 3O45A 1KNOA 8CGTA 1MLCB 4JFZH 4QHLA 4N0RA 5F21B 5IT2H 4ELKB 1V5JA 5F9WC 2NXZB 1H3UA 1S7TA 5IV2A 4LLUB 3MV01 3V4PL 1ZTXH 1DBKH 1FRGH 3G6JE 4HK0B 2XI9A 4JFXB 4I0CC 1YECH 4UILH 3HR5B 3BMWA 2VDNH 3O6LH 3IDMB 1OB1A 1NAMB 3ZKXC 2BRQA 2GFBB 3MV9A 5J3HD 3OXRB 4ZUWB 5FYLE 3B9KD 3WHE1 1NGQL 3C60C 2Z8WC 5ACZB 4C57C 4H8WC 5C3TA 1UZ8A 3I75B 4D0DB 4KVNH 5IKCA 4MXWL 3VJ6B 4X5WA 1R5VA 3TGXA 5BZDA 1PLGL 1T83C 2FBJH 1EBAA 2EE2A 2P8LB 3QDGD 1G7MB 1JGVL 4M48L 1B9ZA 1YN7B 1C5CL 3H9YA 4DN4L 5ADOL 2NPLX 3NPSC 3GSVA 2GI7A 3V0WL 4D0BB 2DKUA 3UTTE 3SKJH 1XGYL 4ZQKB 3GMQB 2EDXA 3GB7B 4P5KA 3HB3D 4U1NA 3EHBD 1HXMB 1KJVA 4JO3L 3ME0A 4M5ZL 4MA8H 3WUWA 1UWGH 3TWCH 4GQ9L 2RGSA 1II4E 3QIBB 1CFVH 2OSLA 5E56A 2F53A 3B9KC 3L3IA 4IRSD 3ESVF 2VLKB 2VSDA 4OCYH 1A0QL 1GOGA 1A7NL 5LAXB 2B5IB 3D48R 3H9SA 3NTCH 1LNUA 4HKBB 3ETBF 3MC0A 1FFPA 1T6VN 3QIUD 3O8XC 3BGAA 3MJ7A 4M61A 4NKQB 1JPTH 1NDGA 1AE6L 1CYGA 1OW0A 1KGCE 4YIQA 4XP1L 3S35L 1JL8A 1T2QL 4X4MA 2BSRA 3VGFA 2CRZA 5KG9A 4WHTB 3E3QC 3D0LA 2Y5EA 3JV6A 5IEHB 1EX0A 3IU3A 5L2KB 4UDTB 2O93L 2VLRE 2CLVB 2FNBA 1C08B 2IMMA 1L0XA 1N6QH 5F6IC 1UB5A 5H37H 4HGWB 1XF5B 1S7WB 3HN3A 1KBGH 4JDVB 1YNLL 1D5IH 1T21B 3QEQB 1KB5L 3ECBA 4WW2F 1IT9L 1NC4A 4ZPVB 4GRLB 4HBCH 4HUUB 4A6YB 5C6PB 4IIQC 1SJXA 1YY8A 3E0GA 1IGML 3T0XA 4U1IA 1YMME 5C0CE 1IKNC 2GK0B 4YXHH 3N06B 2O5XL 1ZA3B 4X7DC 3WJJA 1HEZA 4JPKL 4LARH 4GJTB 4OZIB 2QHRL 4Y4FA 5HYFA 4JFDE 2GEEA 3ARBC 3C2AH 3OG4B 1RPQA 1XZ0B 5SWSA 2X4OB 1KLGB 3S37L 3QEQD 1MJ7L 4G6FB 1YEDB 5ESVA 2VDQL 5CEYB 4H20L 3IKCA 3VWJA 3MROA 3NN8A 4WFHE 3UP1A 2DQFA 1TMCB 3BXNA 2OM5A 5IBUB 1QSEA 4E41A 2F5AL 3L9RA 4PJ5B 3VA2C 1J5OL 1BZ7A 4P46D 1KIQA 1AGCB 4XNMA 2HKFL 1INDL 1KELH 2AEPH 2R23B 1NMBH 2FZ3B 3D39B 3MACL 3L7EB 4WI5A 4MQXC 4KK9C 3G08B 4Z7NE 3RL2A 2QADC 2OMBA 4YZFE 4ZYKA 1F4YH 4NJAH 4XVJH 3MRCB 4MSWA 1WBYB 2WBKA 3QEUB 3UTPE 3M07A 3LPWA 3F7QA 4R2GC 4RBPH 1H5BA 3QUMH 1RUML 5CBEA 2VMFA 2H2SC 3NIDE 3IDNA 5IQ7L 5C0AB 1DUYB 1FO0L 4LIQL 3MOQA 4AYFA 1KCLA 3T4YA 3MRQB 4CDGC 5EU4A 3TV3L 3V5DA 5ITFB 1RZ8B 1WIOA 1V05A 2ILLA 2XN9B 3DX9A 3FRPA 4LBEA 2IFFL 1BPVA 3MOBH 3GBML 3BPOB 4HS8L 5E5MB 4Y8AA 4HUWB 1EPFA 2VDLH 5JOFA 1ETZA 2C26A 2Q86B 1AXSA 3K46A 4RMSA 1FNEB 3WFEH 3W9EA 4L1HA 2VLJD 3LQMA 2ZCLH 5GJTL 5D1ZB 4JFDD 1XR9A 4XXDB 4GLRH 4FZEH 5C0BA 5D6CB 1CDJA 4P4RA 2V6HA 2YC1B 3HG1B 4GW5A 5IROC 3QDAA 2E7CA 4PJAE 2IFFH 4LDEB 1XGQB 2Q6WB 4G8IB 5CSZB 2VQUA 2AK4E 2OI9C 2QR0A 2R0WL 1I8LC 1V3LA 3CSBA 4J23A 3EDFA 3L5IA 2ENYA 4RGMB 3ARTA 4PJGF 4NBZB 1QOKA 1UB6A 5B8CC 3KPLB 1ERNA 2DKMA 4OF8A 1A1MB 4P48A 1MFAH 5BW7C 1G6RB 4JM4H 4TOYH 3B3IA 2QV2A 1I8MB 3WDHA 1M7DB 3CSPA 4DCQB 4M7KL 5EOTA 4Y7MA 4HMEA 1SYSB 1QSZA 3HZYB 1K6QL 1Q0XL 4FRWA 3SE4C 2ICWA 4M6OL 3ARWA 1KIPB 1G7PA 2J4WH 5HYJB 4S2SB 3MRDA 4TPRH 4RZCA 4GQPH 3OKYA 5FV1L 3NOIA 4RISH 2WQRA 1LO5A 5BS0B 1GZQB 1KLUB 2VXSL 5DJ2A 3LSOA 2B5IC 2XTLA 3SDCD 4AEFA 1YJDC 4M1CD 1Q9WA 2Y36H 4NQDD 6CGTA 2ITDA 1OTSC 3DGGB 3MBEC 4K23H 4UQ2A 1VFUA 4O2CA 3U0WL 1U8KA 3P4MB 3FAWA 1ZA6A 5IBTH 2Y06L 4LVHB 2HFGH 5A2LH 3VG9C 1S5HB 1NEZB 3CX2A 4FZ8L 4PJFE 1MFDH 4PRID 4ORGB 2E9IA 1U95B 1FBIL 4H26B 2A83A 2DYPA 1IGMH 4HKXB 3DSFL 2W9EH 3MO1A 2GT9A 4ODBD 2N1KA 1CU4H 1OP9A 3VWJC 1UACL 3GHBH 4OGXH 2ZUQB 1KT2A 3M1BA 2KDGA 5HVFB 3UJTL 2CD0A 4OLXL 4PP2A 1Y0LB 5TE6H 2WBJA 3DUSA 3RX8A 4D0CB 3B5HA 4LF3B 3QRGH 5DXWA 1C1EL 1NGXB 1KBGL 4JEGB 5D70H 5B4MD 1G6VK 1RAMA 4CNIB 1OGAA 4M6MH 1LP9F 1EFXA 1ZVSB 1FZMA 4NYLA 3FQXB 2ZCKL 3ARBB 5DD6B 4JPWL 2CK0L 5IW1B 3SO3B 1RHFA 2APFA 2E7LA 2YUWA 3C09B 5C86A 2YPLD 2CK0H 1Z9OA 4JQXC 1ZANL 4PJDE 4XPFH 4TNVF 5LGJB 5D7JA 3IRZA 1BREA 3GMNB 3P0VH 1G9NL 3QIUB 5I16A 5LGKA 1EEYA 1UYWL 1UZ6E 4JFOB 2M8XA 2GUOB 3LKNA 4XBGB 4NFCA 1J1OL 5FYLD 2DQDL 4IMKA 5K9KB 2X4PB 3IYLW 3ARDA 4X6EA 5H94A 4OGZA 3GRWA 4XRCA 4Z6AT 4WHDA 2DS4A 3TBWA 1UM6H 3TA3C 5A40E 3VD7A 2K3TA 1QR4A 1WAAE 5JPNB 1KV3A 3TO2A 1PFCA 3VFOB 4ZNEE 1K5NB 3VD4A 2EE3A 1IGYB 5E8NA 1D3CA 1R3HA 1X5IA 4HJGA 2QADD 1A4JA 2ZSVA 2VC2H 4G43B 2M26A 2DDQL 1HXYB 4YFEA 5ANMA 3RIFK 4JKLA 4XWOC 5IFJB 1X5ZA 1K4CB 1VFBA 1Z5LB 1KFAH 2N56A 5DHVA 4BH8A 2C3WA 2LTQC 1GPOH 2EDLA 5DEGA 2X41A 3BZFA 5DD0L 2XKSA 2DICA 1TVHB 2I24N 3RZCC 3MFGB 4M7LH 4TULL 3TO4A 1HSBA 43C9B 5KS9E 4X9GA 1NBYA 1JF5A 3WV0A 3RAJH 1BBDH 5DQJA 1I9IL 1UM4H 1INQA 5D5MF 1RURL 1U0QA 4TUOA 5ERWA 1KACB 2X4SB 3MXVH 4X6DA 2R8SH 5J89A 3DECA 3OKDA 2ZOKB 3SKNB 4F58L 5ENWA 1IBGH 2AV7B 2GFBA 3IFLL 1A5FL 3SE3A 2AXJA 5DJ0A 3IB4A 5D7SH 2FB4H 3G04A 2NXZD 3EW3B 4NDMB 5GPRA 3UO1H 1P9MC 3OF6D 1FNHA 2EYTB 5DVLA 3DV4A 4YHOL 3QUMB 2FJHB 2FJGB 5TPWL 1ZGLM 1D7FA 4Z7UB 4N9GA 2C5DC 5C07D 3MRHA 1CL7I 1GYAA 2V9RA 5CIPH 1SMAA 1P6FA 4GXUM 3OMZA 3WIFB 1AGFB 3SE4A 3K2MC 3MRKB 2OJZH 5BVJA 4PJHA 5E2UH 5HGBA 2BMKA 3BUTA 3QAZC 5C2UB 1CFTB 1IEBA 5GISL 5MENB 1NANI 3HE6B 4TUJB 4MD0A 1SM3L 3FQWA 3GI8L 5TFSH 4ZTPL 4N5ED 1PY4A 1QFWM 1SBSH 1G6RH 3NZ8B 3C5SB 1M1SA 4Y19A 4PRDB 3JWDC 5MHSD 3LZFL 5C07E 4X6CF 1JF1B 1CZ8H 2XQBL 3SGKC 1BM3H 4NJ9H 1V8HA 4QT5A 3PGDB 1WWAX 1CU4L 2ADIB 4HPOH 2LU4A 4R7NB 3OB8A 1AJ7L 3NH7H 3AXLB 3S88H 4XNXL 4UV4L 5L0QC 1LNUB 3FONB 2VZOA 5JORB 3FQNB 5DMIL 3QULA 2Z9TA 4MQ7B 3RNKA 3RFZC 5B3JF 4OAWB 4YJZL 4L8CA 3HNSH 3ZLQC 4HWEL 1WAAF 3NFNA 2Q20A 3B2VH 2APVA 3SDAB 1LMKA 3QNYB 3EO1B 4U1HA 5I8EB 4BFBD 4R4FH 1JNNL 5CHNA 1X5XA 3VXMA 2K7QA 2HLFD 5DZOA 4F7MB 1GHFL 1DCLA 3Q5OA 4D3CH 2EICA 3D85D 5I1EL 1IAKB 1NDMB 4XTRC 4ODHH 3BESR 4JDTL 5BVPL 3TN0A 3VXSB 5HVHB 3I9GL 5F1IA 3SE8H 1G84A 4JRXB 3B5GA 4LHJB 4PRPA 5IUSA 1OAXH 5JNYB 2I60H 4I2XA 4KH2A 3AS0A 2MMXA 3SQBA 4R3SB 4ZOEA 5ICZA 4K9EL 3FT2B 4YWGL 1HCVA 4TSBL 5JHLL 3DIFB 3N50A 5F1OB 4C4KT 2ED7A 4PS4H 2YWYA 4N1EA 1FE8L 2F53E 3TZVA 2AEQH 3SDXE 3EYSL 3ZDYF 4PJCE 5IMLA 3TCLA 5CMAA 3UJJH 1Z0NA 1NGYA 2X89D 1IGTB 2D7QA 1V3JA 1AQDA 4MWFB 2F53D 1JE6A 4XPTL 1T89A 3UC0L 4OBSA 2G9HB 2HJKB 1CFNB 4XP1H 4TNVK 2DLFL 4GRMB 3RRQA 5E00B 1FIEA 4WEUD 1A6UL 4M7LT 3V6FB 4M3JA 1FE8H 3ARFC 5J7CC 5KAQG 1CQKA 3L5WB 3QXDB 4BFIB 4NHUB 3NA9L 1S7RB 4G6AC 3VG0H 4JM2C 2CDGB 3L7EA 3BPLC 4DGIH 3SDYH 35C8H 4XB8A 3RL2B 4DUVA 3QDGA 3IKKA 2F54D 1VEMA 4L9LB 2X4NA 4ZFZA 5I9QB 2DJSA 2C7UA 1I4FB 4WUUA 2IPTL 3U9UA 1NAKL 1WF5A 1TZGH 3VFVB 4G9DA 5E99H 2DM4A 4U6HB 5FUZH 5E03A 1U42A 2OL3L 2AEPL 1PG7X 5B39B 4WJ5B 1W8NA 2NY6B 1J1XH 4D8PA 2YMXL 5DRWB 2FO1A 2A74A 3GRWH 4BZ2H 3W0WE 3MV8E 3NAAL 4NKIH 1KJ2H 4O2FB 4PJDB 4X6CE 1I7RA 2E6PA 4PV8A 5D1ZA 1TPXC 4X5WB 1T1WB 1W72H 3PWVB 4PJBE 2MQ3A 4WVRA 3GMPB 4PJAF 5IW6B 4F7EB 5E6ZA 2HJLA 1W0VB 3TESA 5D1QB 1KCSH 4X7EC 5I2IA 4NT6B 1SJHB 4KTDH 4WFHD 5T3XL 4UBDD 3LEVH 1P7KB 2BNRE 1DVFD 4W6WB 4OLYL 5JW4M 3TA3A 5GS0H 4JR9H 1CZ8L 4OLYH 3FMGH 3QXAB 4OZGA 4PD4K 1MVUB 2P48B 4QRUB 1F4YL 1FSKC 4Q6IB 4PJ7A 4P3CL 2X1WL 2GJ6B 5AUMB 2FECI 2YPKB 1EO7A 5EU7C 4NOFA 4P2QD 1PG7W 1MCSA 4FG6C 5F93C 2D0GA 1TZIB 5I17B 4GRWH 4LCIL 1EHLH 2NY0C 4MVBD 1MCQA 1AGBA 1T7VA 2VQ1B 3RPIB 4QHMA 3G5ZB 5FGBC 4XBPA 3VGHA 1LK3L 2FIKA 1AQKH 4AMKH 3NFPB 4M3KB 3BPLB 2BFVL 5ACMA 2EDWA 4E0RB 1J8HD 1CLOL 1HHHB 1H0DB 2WWMD 4J3TA 4P5TB 1T7YA 1QFUL 2V9TA 4O51B 4DUWA 4H88L 4YIQB 3FRUA 5TH2B 1AR1D 1A6TA 5E2VL 1A5FH 4Q97A 2NXYC 4KUCF 4XNYH 1JYXA 2V7NB 5C9JA 3NA9H 3DMMB 3PL6C 2IGFH 5C0FA 3BJ91 3HTLX 1S5IH 2P24B 1AGDB 1KENH 1IRAY 2WNGA 1EEUA 4WDIA 1ADQL 4YHNA 1G9NC 3QNZA 2IBZY 2AJ3A 3X13B 1WEJH 1MCIA 1YEHL 1YEJL 4WI6A 3TN0C 2R1YA 2FWOA 2BSSB 1L9MA 2NY3C 2CJUH 3WHXA 1F58L 3UC0H 5HHXL 5TF0A 3X11B 4E5XB 2X1XR 4FTVD 3MXWL 2XT1B 2R0LL 4KQ3H 4LSRH 5FDWB 5GGSA 3VFNB 4MJ6A 2YD7A 4B5EA 5IM7A 1DFBH 2C4XA 2FEEL 2CQVA 5AZEL 5ALCH 3LRHA 1RZFH 3RKPA 5KSUA 2DQTL 3FO9A 3VGAC 1EGJA 3MROB 3KGRA 5IOPB 1A6WL 4I48A 1FV1A 1Q9LA 4OV5B 3CD4A 3R4DA 1U8OA 1FORL 1WZMA 2AEWA 3BPCB 4UI2A 3QDME 1VGKB 3QT2A 5DS8B 2XYCA 4RFEB 4XP5H 2R2BA 1D9KD 5E6IA 3WNNA 4ZS6C 3OKNA 5J1TC 3GEWB 3WIHA 3KDMB 2ZUXA 2Z31C 1IGYA 1NBVH 4DVBA 3G08A 2MCPL 2F58H 1J0ZA 2J5LB 3ZTJG 4RGMC 4KROC 1IFHH 5IFJA 3V4PH 2QL1A 1CXHA 5EPMA 2DJUA 1BVLA 4Y1AA 1CFQB 4WW1B 5DHVB 5TE4H 3WDIA 2HT3D 4J6RH 3MNZA 1XH3A 4BH8B 2DIJA 1AC0A 3KAAA 4Y2DB 4PRPD 4CMMB 2AAVA 1JTTA 4OZFA 4BQBA 2D31B 5A43C 4PLNC 4OZ4B 4XP6H 4ZAKC 5HGGS 4HFWB 2XFXB 1KENL 3S88L 1KPVA 3QIUC 5J11B 4DKAA 2D03L 3SPVB 5EN2A 2XY1A 4KRNA 2D03H 4ZFFA 5J1AA 3VXUD 1LDPL 2E6JA 4R90H 5GRXG 3GSNH 4P9HH 4RGOL 1IARB 5E2VH 4U31A 3PHQA 2W65A 4NQDE 3H9SD 4QRRB 1WT5C 1UC6A 1KCRH 3TNNA 5JXED 4GUPA 1XGQA 2HVKB 2Q6WA 1TZHA 3FN0H 5I75C 2O5YH 2PYEA 1MFBL 4OT1L 2H3NA 3FFCB 3SDXB 5IMKB 1IC1A 4NZRH 5IB2A 2Z35A 1QTYT 1BJ1J 3MLPA 3FOLB 4EDXB 5HI5C 1KCVL 5BXFA 3MSPA 1MEXH 4PJFB 5GGTL 2OR9L 3RZWA 2VXVL 4U6XB 1WTGT 1RK0B 4NCC1 4F37F 1EIBA 3U36B 5HYSG 1OW0C 4L8DA 2CXGA 4MJID 4JANB 4ZUTB 4Y4FC 3IT8D 4PLKD 4TSBH 1I85C 2BNUA 2VL5A 2BNQB 1YUHA 2ZSWB 5BOZG 2UWEB 4QXGL 5D7SL 4U3CA 5CBAB 3L7FB 4U7KA 1MCWW 3IETA 4OFIA 5DJ2B 4KI1A 4P2QB 4MXQC 2JCCF 5JOPE 5ALCL 3WNPA 1QEWB 3PDOB 1ZHKA 2MWCA 2ITDB 4Z95H 3ZDZE 1HHKA 1PJ9A 4ZFOB 4XCCH 1DQDL 2P5EB 3OR7A 2E8YA 1UZ8B 2MFNA 3P11L 4M7LL 3NCFB 1EXUA 1OLZA 3BSZH 2P8MA 3WFHB 3F58H 5JHDE 4NKMB 2UZIH 5IVZA 4MQ7A 4IMKC 4B50A 4KV5F 4L8CB 1YN7A 1K8IA 3FOMA 4KQ4H 2GITB 3IJHB 5DD1H 4UV7L 1VGEL 3EFDL 4HV8B 3WN5C 1S78D 3ZSTA 5D7JC 2UUDH 5IHZA 4X6CB 3FQTB 3DXAD 2R4SH 4OGYL 2J6EH 3FAXA 3HAEH 3WLBA 1YPZE 3A6CL 1XGTB 4RMWA 3W11C 4NBXB 4UU9A 4HS3A 4XNUL 4S10A 4HHAA 3UAJD 3RVUD 1KB5A 1RIUL 3GMNA 1RZKH 4CVZA 2NY0B 3DROA 3OXSA 2RCSL 4AIOA 5DHYA 5I1KL 3D85B 3HPJB 2X1PA 1MIML 1PX4A 3MJ8B 1QLEL 3JV0A 3BQUA 3ARDB 3DRQB 2VZTA 1U91A 3FB6B 1ZLWK 2UYLB 4CVUA 1IGJB 1W72A 3W5NA 1CG9A 5FKPA 1JP5A 1XT5A 3CSGA 1OAYH 3L3HA 3ZHLA 5LBSL 2ZG3A 5CP3H 2FH6A 4NPYB 4HAFA 1M71A 4FXLA 1CLYH 2F53B 2FCBA 1TJGL 1RIVH 5DR5H 5MEOA 5FYLL 2VLKA 2HJFA 4K9EH 1XFPA 4IRZL 4GG6B 1MHCA 4YDJA 3TJHD 1A2YB 2LVEA 3BZFB 3QHZL 1ONQA 4Q9QL 3QWOA 2HFGL 4XCNB 4DN3L 2YPLA 4FQ2H 4NQVA 1FFOB 1TJGH 4KJQD 1ZLWH 5HHPA 4OD3H 1INQB 2PXYB 1OP3K 2J8UF 4AK1A 1ORQB 4ODUA 5JR1H 4DZ8A 3OKKB 1IAIM 1A22B 2WP3O 3BKJH 4ELME 3VFSB 2C9AA 4LSTL 1FNLA 2X4OA 5E0QA 3I6GB 2W0PA 3EOBB 4MA7L 1I1FB 4F8QA 4O4YL 4GW4A 1BP3B 4CN4A 2IANA 1S9KC 3BKCL 1Q0XH 1JPTL 4G8GB 2HT2D 4P2OB 4Y1AD 3V5KB 1NGZB 3ARFB 4U6YB 3BEWA 1NC4B 3TBYB 1I7RB 1BZ7B 2FX9H 2CLRA 3KJ4C 1SEQH 2Z8VC 1N6VA 3ZT6A 3O3BA 1Q72L 4BH7A 4IDLA 4F7PA 1RZIB 2VISA 3EZ8A 1I7UA 5FAAA 3EYQD 5CEZL 4U1LB 4Y4KD 5BZWB 2DQGH 3FT4B 1D9KA 2BSTA 3A6CH 4NN5B 1FH5L 1R24B 2BMKB 2WWKT 2AGJL 1J86A 3ARRA 5D72L 2NZIA 2PO6C 4QHUB 2DBLH 3DHMA 3S36X 2ADJA 1KCUH 4JREC 4HSQA 4XVSH 4OJFH 3SKMB 1HWGB 3CFJB 5EU4B 1T20B 3LQZB 2RHEA 1JN6B 1UKTA 4UT9H 4X4XA 5IQ9A 3F12B 2AJSH 4G6FD 4ZXBB 3FO2B 2IG2L 4BKLB 3SDDC 4QHKJ 4MAYB 4X9BA 2ZZUT 2ARWA 4LIQH 5CGMA 1A6AB 3S3PA 3BE1L 1JHTB 4CDHA 3QEUA 4Y5YA 2H32A 2CKBB 3QJFB 3VD9A 2APXA 5E8EB 4PBXA 2G5BA 1JHKL 3VXUB 1C8PA 3GSVB 3IFNL 3IFOA 3LKRB 1NJ9B 3LRSA 4QRTB 4WFEE 4IOIB 5IBTL 3LPFA 4MA3B 5FA3B 5HHVH 4MLSA 5GGSY 3C8KA 3A6OA 2AQ1A 1H15B 5CEXB 3U82B 1KJVB 1HXMA 5D2LA 3WUWB 4HUNB 3WCYA 1KJ2L 4M93C 3KLHD 1A3RL 4XPAH 4Y5XB 2RQ8A 2ED9A 3KNBA 2F5AH 4HCRL 4WFED 5HYJA 1TCRA 2VZUA 3U30B 4G80B 3HUJB 5DJZB 3P30H 2FD6H 3HMWH 5KW9L 4MXWH 1CGWA 1I1AC 4OM0H 3JV4B 4RA3A 4HPOL 4Z7WE 3BKMH 5F88A 2NR6C 4YGVB 1OGTA 4IOSD 4MJ6B 4MCYB 2ZPKL 3NCCB 3VD3A 4KROB 3B3IB 4KC3B 5EZLA 2AJZB 3QZWA 2R2HA 1OSZB 3LKSB 3JV6B 1T0NA 2MQ0A 3QIBD 3WFBH 2VDPH 3IVKB 4XNQA 1PSKH 3MCLH 1QSED 5DA0B 4DN3H 3P4LA 4JN1L 5EZJA 4Q9QH 4KKNA 5KVFL 5KVMC 5EB9A 4UIMB 4A2MA 3ROLB 4FP8L 4JDZB 4RFNB 4OI7A 5DWUH 1AO7D 1JNHA 2OR9H 2V5SA 4BYHA 3V6BR 3JTSB 5BO1H 4JHZA 3OPZL 2JB6B 4F57L 3G6DL 4AMKL 1U3YA 2BVQB 4X6DE 4NQCA 3QPQD 5CJQH 3OR6B 1ZXQA 3VMOA 3ARED 5F7EL 1UQSB 3QDGB 2QSVA 1H3VA 1UJ3A 2VQTA 4P9HC 3E6HA 2Q7NA 4LEOB 4ONOA 4FG6D 3KLDA 3ISWA 5IGXL 4G7YL 4F3FA 3PNWA 3MO1B 4HJJH 1LQSR 1CN4A 4HFWA 3M1BB 3WDJA 1A4KA 4H25B 4M00A 5I73B 4PP2B 1KPVB 1JRHI 4X6EB 3DUSB 3CZJA 2DQTH 2F54A 3PDDA 3QO1B 1B2WL 1KIQB 2PF6A 5I8CB 4ZUVB 3EGSA 3GUTB 1JFQL 3BUYB 3KVQA 4ONFL 3OJDB 1MCKA 3VXRD 5CP3A 1FLRL 1RJLA 5E9DA 5IW1A 5TE4L 1WK0A 5TQ2H 4OTXH 2AXFA 3MXWH 1C12A 4NKIL 4OM0L 1I8KA 4OGYH 4Y88A 1DBJL 4JZOB 1CDUA 4L8SA 5MEPB 3MJGX 5CZVL 4EI5B 1MHHA 4OI9A 4JCLA 2MCPH 5EH1A 4R2GD 1EMTL 3CFCH 2A6JB 5D1XA 3WUWG 1EV2E 4TYUA 5F96L 2Y6SD 4L9DA 3GMRB 1VENA 3DV6B 4Z7UF 1IFHL 3LS4H 1XCTA 2NY3D 3NH7L 4M6OH 2QHRH 5H94B 3P3YA 4GBXC 4ZG1A 1S7VB 1T7WA 4YDIL 3MBXH 1IGCH 3QFJB 5TQ2L 1FYTB 4OD2B 3U36A 1MNUL 1IKFH 3I6KA 5C2BL 2GJJA 4ZUTA 1CBVH 5TJWK 1XGPA 3TZVD 2VL5B 4K7FB 2H9GB 3O6FC 4HJGB 1RJYA 1XCQB 1URLA 1HHJA 2VDKL 3PL6D 1Q9KB 1FORH 1SM3H 2QQKH 3V8CA 5H35A 1UXWB 3ZHDA 1EGJH 5GRZA 3ZE2F 3RWCA 1BEYL 3E8UL 2ZJSH 4YDVA 1UYWH 3UMTA 1KCKA 1REIA 5E8PB 3B83A 2A73B 3DYOA 32C2B 3TVMA 3O2WL 2QR0B 1A6ZA 3BQUD 4LRIA 2CK2A 1FRGL 1U3HB 5DMGD 4B7IA 1KTDA 3VH8G 5IB5B 1F3RB 2DWDB 3BZ4A 3KWWB 3U46A 2NTFB 1PVHA 1FNSL 1MWAL 1N0XL 1CIUA 4JRYD 2EDQA 4M1GH 2A2QT 4XC1L 5IFAL 1CGXA 3MRJA 2OL3H 4PJ5E 5KTEL 4ODWA 3ULUD 1MJJA 3FOMB 1AH1A 2BP3A 4N8VA 1OT2A 2XOTA 4RMQA 5F7WC 5BVJB 2VLJB 1AY1L 5CD3B 4Z7UE 4UTBL 5IV2B 2NY6C 3MUJA 1CFTA 4PYHA 5CGYD 5GS1A 2XPGB 3OJVC 4L4VD 1FNGB 1HKFA 4MB5A 1OCWL 3EJZC 4YHZL 4HXBL 1M05A 4MJIE 5D72H 3WLBB 2HRPL 3KPNB 3VI4F 4RFOH 5DSCB 4MNHA 3DV4B 2VN4A 1YA5A 3PE9A 1EO8L 4W6YB 1I9IH 1KB5B 1UM4L 5D1XC 3ULUH 4V1DA 5IW3A 5TDNA 3V5HB 3QIWD 1AQKL 5IVNA 4HC1L 4JG1L 4D0DA 3BKML 1YPZB 4S1QL 5JZ7D 1S5HA 2YXFA 1IGIH 4U1KA 5J6GA 5HTSA 4Y2DC 1S7UB 2D7OA 1WCQA 4OCRL 2XWJA 2H32H 3GDBA 4IIQA 1G7MA 4LHUA 3V6ZA 1VGKA 4JFXA 3ZKND 1DDHA 2IQ9L 4QXWA 1XR8A 2B2XL 2AQ3A 1SJEB 2EC8A 3RQ3A 5JA8B 1AHWB 3MV9B 4LLYB 1BQSA 4AG4L 2EH8L 4HKZA 4LARL 4PJAB 2H6PA 3QQ4B 4M1DH 3MLRL 2DL2A 3E8UH 4M43L 4UAOB 1FYTD 3MRFB 1FL5B 2ATKB 3WFZA 4HBCL 1VCAA 3D3VB 4GG6A 4PJ9D 5H2BB 3FFDA 2NY5L 4JRXA 3VXSD 5T5FL 4KZEH 3QIWB 2XA8H 1GVIA 3MFFA 3FQUB 1ES0B 1UWXK 2NQCA 2ZOLB 4I2XB 3CMOH 3RWDB 3LKNB 4XBGA 3ZKMD 5DJCA 1LHZA 3Q6FA 4M1DL 4EI5D 3FQRB 5D2NB 1MWAA 3T0DA 2IJ0C 4XRCB 3KYAA 1GZPA 3HZMB 5EN2B 1FZJB 1ZT4B 3H42L 3QCTL 4KKBC 3I6LD 4JPWH 1G1YA 5F97E 1K8DB 4YBQC 4OJFL 1AD0B 4KKLC 1IM3B 1IQWH 1OQXA 3MYZA 3OKKA 2D4FA 1U93A 1VFMA 4JY5H 1DEEB 4QTHB 3NIGE 4GAFB 5DK2B 1UWEH 4JFFD 4QRRA 5E8NB 3L5JA 4GKSB 3M17B 1HSAB 1GGCL 1TZHB 1YEIL 4WFGD 3PIQA 1QPPA 4F7CA 2HJKA 1FLRH 2JTDA 2PR4L 5E00A 2IALB 2Y25A 1ZHNB 1MFEL 3BH9A 1J0IA 4HKBA 3H6JA 4PIRF 4IS6B 4EDXA 1J05B 3V0VB 2EH7L 5GRJL 3QHFH 2Z8SA 4XVTL 4S11A 4FXGB 1FCCA 1RIUH 2KZWA 4UUJA 1WCBB 3TZVB 3UBXB 2VISB 3I3BA 3WEXA 1ZHBB 4HXBH 4TVSa 4NN7B 4EZMA 5F3BA 1GRWA 5IMLB 3IFPB 4Y16C 4OZHE 4HIIB 4XH2B 4XC3H 1J5OH 1S7XA 1RHHA 1NBQA 3RGVA 1UG9A 2Y1VA 2I5YL 2X7LA 2JIXA 1G7IB 1NMAL 3U2SB 3EJZD 4PV9A 3U4EA 2FIRT 2QEJA 5SWSB 1GPOL 1IC7H 5KOVC 3ZO0A 1DN0B 3D2UB 4ZSOB 5FYKE 2C4FT 3VFPB 3CFJA 3HMXA 4KJYB 3PDOA 2QQNL 1JGVH 3ARQA 5LWYL 5IP4A 4J3OC 3DPBA 3MJ6A 3BKYL 1BGXH 4E41B 3AM8C 3CK0L 5EOCJ 2YRPA 3RNQA 5DQDH 1SHMA 4GW1B 1Z0MA 3P0YL 3GGWB 1KTLB 1KXVC 1NCUA 4FABH 3GJFB 4JKPL 3JBG7 4QOKA 4HH8A 4JY6A 1EHAA 5M94B 4EN3D 4HUKB 5D1QA 3PGFH 2GJZB 3UZVB 1G1CA 4OLVL 2WBJD 2C7UB 3WFCL 2H2PC 5C0NC 1HKLH 3DRTA 5GGVY 4YHYB 1N59A 3D18B 5L6YL 3FQTA 4OFYA 1T2XA 4QXGH 3AUVA 5CSBA 3PP4H 3SJVA 3FQWB 5BVPH 1MLBA 2PTTA 2ESVA 4Q6IA 5T3ZD 4WJ5A 1K9TA 4XBEH 4G8FA 3DETD 3MRNA 4HC1A 4PGEA 2GSIB 2ZCLL 4CW1B 1P4IL 3GKZA 1EA9C 4G7VL 5JPMB 4PV8B 5I1IL 3JVGC 3EIFA 2BVOB 4JY4A 4QEGA 3PGCB 5DUBA 4HIHA 3RY5A 4NM4H 2VB5A 15C8L 4ONGL 3IJSB 2R29H 2BNRD 2Z93A 3UO1L 4S1SL 2PYFB 5DC0A 4JLRA 1Y6NR 1HHHA 3HE7C 4JG0L 5J56B 2YD3A 3AREB 1IM9D 4ONFH 5HHVL 2B4CC 1YQVL 1LEKB 5KJRL 1MPAL 4BSWA 1LDSA 4GMSL 3PHOA 2PW2A 1U8LB 2HA1A 5HBBA 1RULL 3DOSA 2CO6B 4LSQL 1S7SA 1D5XA 1VFOA 4K94H 1TZIA 1CR9L 2R29L 5JDSA 4NQXA 3LPGA 3GK8L 4JDZA 3VFUA 3H7BA 5JMOC 1UJ3C 2OMNA 5I15L 1U8PA 4KJQC 3TBTA 3UTQB 2YC1A 2IPUK 4J6RL 5JIIA 4TN9A 1MELA 3QSKB 4Z7QE 1PLGH 1FFOA 4B53A 1YJDL 3HAEB 3QXTA 1LO4L 5J8OA 4Y4KB 4JPKH 3V95A 1KSRA 3BRDA 1FL3A 4QRPE 2G60H 1UCBL 2I9LA 2BRRH 2PYEE 3Q0HA 2V7HA 2VLKD 2Y5TA 4FP8H 4Z9KB 1U8KB 1QRNB 2A6KB 4JHAH 4W4OC 2I27N 5KOMC 4PLJD 3F5WA 3MUY1 1Y6KR 4ZNEA 1HE7A 3OHXA 3EO9H 3ET9F 5LQBH 1ZEAH 4J1UA 4N0FA 4LOUD 3OZ9L 1S7WA 5D5MA 4YPJA 1BGXL 1KCVH 2AKRB 2R2CA 5DMGC 4OLWL 4LU5H 5T33L 2CDGA 4PP1D 2NW2B 4TUKL 4HUUA 2NW3B 4G42A 4MAYD 5I1CL 1YY8B 4WWKD 1BQUA 2N7AA 3DGGA 1AI1H 3VFGH 1C12B 4U1IB 3BGMB 1Y18A 4MS8D 3ARXA 3ARGA 1G9MH 1DQJA 3LD8C 4L8SB 4R4FL 2BNRB 1K2DA 4PRBB 3KXFD 4I3SH 1KULA 2IC2A 3NGBB 1DANU 5B38G 5I16B 4K94L 1K4DB 2DQEL 1CICD 2A83B 3BIAX 2GUOA 5F3HA 1UM6L 3O3AB 5IFHH 1A6VL 2X4PA 1KT2B 3DVNA 4D8PB 4Y5VA 1S5IL 5SX4I 3FO2A 4NJAL 1F90L 1X7QB 2HAZA 4P59H 5HHOD 1UWGL 2E9JA 3FCTA 3LN4A 4WENB 4LF3A 1F8TL 4LASH 4GMSH 1P7QA 4LVOC 5KVEL 1LP9B 4KI5C 4EI6B 4U1MA 4WI9A 5EZIH 3RIAK 4Y0GA 3U4AA 3HG1D 1AC6A 1P7HL 4ZUSB 3O2VH 4X9HA 1RVFH 5FIEA 3T8XB 2PW1B 4PTTA 4ODSH 4WW1A 4TVPE 4I3RH 1P7KA 3VW3L 3PWNB 3TVMB 1MHPH 5HHOE 4UT6H 1AI1L 3VFGL 3TA3B 3MCKB 4PJEF 4FFYL 3W9DA 3CDGB 1CD1B 4NNPH 4OZ4A 1VGEH 5A16A 5CBEB 1F42A 2HLAB 5KSAA 4IBLT 3S37H 2EXWD 3ARUA 4IMLB 5EORH 2YPKA 2NY0D 3PWJA 4XP5L 2B1HL 1JI2A 1RZ8A 1WLHA 4L4TE 3F58L 1K6QH 1JZ2A 4YQXL 2XA8L 5EU6A 4NO5B 1UXSB 3D2UD 2F8XC 1T5WA 1TJIL 3QUXB 5IB1A 4QHNB 4QHMB 1HHGB 5IQ7H 2JELL 2BNUB 1RZKL 3HZKA 2L7UA 4X6DB 2D9QB 2R69L 4NZDA 4U1JA 5KN5A 4Y19E 2FBOJ 3HC0A 1BJ1H 4GH7B 2DQHH 1WAAA 2AV1B 3FFCA 4XHQA 1RMFH 3RWH