1IGCH

Igg1 fab fragment (mopc21) complex with domain iii of protein g from streptococcus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
222
structure length
222
Chain Sequence
DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTLHYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTGMYYCARWGNYPYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA MOPC21 FAB (LIGHT CHAIN)
publication title The third IgG-binding domain from streptococcal protein G. An analysis by X-ray crystallography of the structure alone and in a complex with Fab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (antibody/binding protein)
total genus 38
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1994-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igcH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igcH01
3WYRA 1A4KA 4LHUA 5EZLB 2VDML 4H1LG 1FAIH 4L8SC 2VDQL 3ESUF 2DDQL 4NNXB 4NQTA 3RVVD 4H0GA 5LAXB 3DX6B 4MD0B 3IRZA 4TPRL 1RZJC 4OI8A 2DBJA 1BLNB 4HUWB 3QEQE 4LSVL 2FNBA 5GGSA 1AP2A 3BPCB 2Q8AL 4MB5A 3ULUL 4HFWA 2H9GA 1Z2KA 4GBXD 4Z7VF 5B8CA 4JRYD 1MWAH 3BZFA 5HYQA 5DYOA 2YRPA 2CPCA 4JFFD 3B6SA 1I75A 3BKYH 4NCC1 2IALB 1G0XA 3ARBC 2GUOA 1RUKH 1JI1A 4G43A 4P3CH 2FIRT 2YKLL 5CJOH 3MRMB 3MLSL 3FCTA 3GSWA 2H3NB 2A6JB 5C08E 4F9LC 5FOBA 4Z7NF 4IJ3B 4Q9RL 2PKDA 3LPFA 3ZDYF 4WDIB 2CKBB 3HTLX 2FJHB 1A1OA 4WI9A 2IWGA 3K4AA 2N1KA 4ZQKA 5E2TL 4JQXC 4I1NB 3F6IA 2V6HA 4HHAB 3Q5YA 4JKMA 1M7DB 1RZGB 4H25B 4Z77B 5E4EB 4U6YA 2BOBB 2JELH 2VLRA 4JFHE 4EXPX 4PGCB 1MRDL 4PJCE 5J3HD 2VDMH 2Q6WA 4NUGL 4MA7L 1JN6B 1EAJA 2I60L 4UDTB 5I71C 4AIOA 4JFPB 4N0YH 1ZXQA 4P4KC 1GYAA 3BVNA 1VGEL 2EO1A 4J12A 4FZ8L 4NRZB 4PG2A 1U8OA 3PE9A 4DAGH 1QRNA 4BSVA 3ARDB 1EVUA 3UTSB 5F7MC 3JTSB 3VXSA 2HA1A 1B2WL 4HZAA 1JF1B 3BI9X 4JAMA 4JM2C 3OXSB 1CICA 3VD9A 3STBA 3RWEA 5EO0A 1JRHI 3IDGA 2HKFL 4X7EC 1BVLB 3DURA 3QDJE 4ZDHB 3SCMD 1DE4B 5SWZB 1PG7W 5ISZB 2W0FA 1AGFB 2VXVL 3UTTA 2NX5D 1LO4L 3MLSH 2O5ZH 2W65A 4NOBA 3OR7A 1HZHL 1RZJH 1ZA3A 2CO7B 4JHAH 4Z0BH 3WMSA 4GUPB 2HH0L 4RAUB 3HE6A 1KUMA 4ERSH 3PL6C 3ZDXF 3FONB 4X6DA 1IKFH 1YPZF 4NRYA 1JNHB 4JFXA 3ESVF 1C5DB 1JL8A 2NY0C 5AD0A 2MHAB 4X5WB 3GJEA 4XVUC 2Q7YA 1MRDH 4M4RA 5C0RH 2D7QA 4EIGB 4NUGH 4XP6L 4HDIB 4NO0B 1FO0A 3RVWD 2I60H 4QOKA 1T21B 3KLSA 3HS0B 3D3VB 5KSAC 2ZNWA 4FZ8H 1F3JB 4L4TA 5DEZA 1G9EA 1ODAA 4PR5B 5TH2B 4NKOB 4LP4A 5C2BL 1JWMA 5I1JH 1OWRM 3UXFA 3LEYL 4TNVF 4DKEL 4U1HB 1J88A 4KJQC 3WHE0 1AD0B 2EYTA 3W0WE 3O2DA 4O2FA 2R4RL 1LE9B 4MJ4A 3QUZD 3T8XB 2EKSA 1A7QL 2R29L 3MR9A 2A9MH 3QI9C 4KGLA 4P2CG 2W9DL 4OTXH 3K74B 1HZHH 4H1LH 4FABH 4AYFA 4EQ3A 4M03A 5DJ6B 2HH0H 5D7JB 4YGAB 3GSXA 5HGDB 2NY1D 3DXAB 1KJMA 1P6AB 1G1CA 3RKPA 2YUZA 3CMOL 1T0NB 1AXTL 1XGRB 5CJ8A 1MI5D 3G5ZB 2X42A 5D2LF 5FKPA 1IILE 3T0VA 4N9GB 5FM4A 1FVDB 4NN7C 4RZCB 3T1WA 2FGZA 2X1XR 4E41D 3PJSB 1LEKB 3OKMB 4A2MA 3TVMC 4HV8B 1UEYA 4LVNC 4NQCB 1ZK9A 2IJ0C 3HZMA 4Z76A 2J5LB 4X80L 2FBJL 2Q8BH 3PDDA 1QACA 5C2BH 1I4FA 5AWNH 1JHLH 1W72L 2W38A 4RNRB 3FHAA 4YHIA 3VE0B 5LWYL 1A7NL 3MFFA 4DKEH 4IIQA 3IDIA 3MNZB 4Q6IA 4L4VA 1U92A 1I9IL 2EDJA 2FBOJ 2JIXA 2BP3A 1IBGH 3MRKB 4L8BA 1D5MB 4LLAA 3ZTJH 3LMJL 4MJIE 5DTFA 4JDTL 3RGHA 3GEWB 1UB6A 2XWJA 3GIZH 1NMAL 3MGTA 4HMDA 5JNYA 5C7XH 1EPFA 4DWHA 1CTOA 4Z7UE 3VW3L 4GW1A 1BOGA 1BD2D 1XR8A 4KUCF 4PV9A 5DD1L 4YGVA 4FQHB 3IXTA 5D8JH 1AXTH 3GSOB 1CZ8H 4J1UB 5KSVB 3NABL 4DQOL 3IFPB 3NFNB 3BPNB 2ESVD 3FN9A 3KPMA 1CFTB 3RY6A 1ZWIB 3DHJA 4Z0XA 3QDGE 3LH2H 3D0VA 4PJ9C 4WCYL 1IAKA 4PJ5E 4OZ4A 2D0FA 5F96H 4LBEB 4YR6B 2YN3A 4XH2B 2Z8VC 3S9DB 1JPFB 4JN1L 1IARB 5CJQH 2C4FU 4PJFA 4X80H 2ZUQB 2FBJH 1R5VA 3DMMA 1J8HB 4PGBB 3HPJB 4X5XB 3BAEL 1RUPH 1W72H 4LSSH 2EYSB 1NMBL 4YXLH 3V5DA 4ISVB 1JZ3A 2P7TB 5LWYH 3MLYL 1A7NH 4C83A 3KLDA 5C1MB 1QLRA 1MJUL 4KPHL 1CDUA 4Y4HA 4WNQB 1HHIA 5E8EB 2OMBA 5DVNA 3ZKQD 1KTDB 4FTVB 2YPVH 2ZNXA 5K33A 1XZ0B 2DI8A 5T3ZE 3JV6A 1VFAB 3Q1SH 4JDTH 3WUZA 1EJOH 1K4CB 5E2JA 4MB4A 3BEWA 4RISH 4I0PD 3U0PA 5CP3H 5AZ2H 3SKNA 3SN6N 5DD6A 1KG0A 3RZCD 1AXSA 4NSKB 1LK2B 2H32B 4LQFH 3VW3H 4KROD 3BN9D 4MJ5B 5HHPB 5DD1H 5DD0H 4NZUH 4QRSA 4DN4L 5ANMB 4Y4FD 2RB8A 4QTHB 3P77B 3B9DA 4F33B 2Q3AA 1IGJB 3UZVB 4DQOH 4OKDA 5DHVB 4X9HA 1DEEA 2PO6D 5JO5A 4ETQA 1YY9C 5SV4A 3LN4B 1A6AB 1INQB 5L2KE 2EXWC 4WI5A 3BD3A 1U8MB 2R2BB 5FB8A 1XF5A 4YPGB 3K46A 3TH3T 5EOCL 3GSRB 3VGEA 3MNWA 1NL0L 2F9BT 3DWTA 2DAVA 4JN1H 4UV4H 4RQQA 4GKNB 5CBEB 2GJ6E 3AB0B 3AREB 4U49A 4U6HA 1F58L 3IKCA 2UWEE 5F1SA 4G8GD 2W59A 1NMBH 2Q76B 4UB0L 3TNMA 5L88L 3MLYH 2VITB 3EJZD 3H9YA 2YXFA 3PG2A 4NP4H 1CD8A 1G0DA 5F1NB 1EEYA 4YBLB 3L3GB 1HK6A 2WP3T 1DQML 1F90L 2GK0A 3G5XB 1UT9A 1WIUA 5HHME 5I8OH 8FABB 1XFPA 4JRXE 3F7PC 1CGSL 3G08A 5CSZB 2LTQB 2XACC 4APQA 1N5YL 1UXWA 4L4JA 3RBGA 2P46B 3PWUB 1Z3GH 4LLWB 3NCJH 2YR3A 1DBBL 1I1YB 4QHMB 4FNLH 4ELMB 1IC1A 2BMKB 3HAEA 4NCDA 4M5YH 4RIRB 1X6LA 3P4OA 3C5SB 1N8ZA 4OKVB 5LCVL 1CVRA 3DROA 5EU6B 1MSPA 4Q6YA 3LS4L 4CJ0A 4DK3A 2LQRA 5HPMB 2XFXB 4RFOL 4BUGA 3TYGL 5L6YH 4G9FA 3CVIL 4K7PY 5GGTH 1CFSA 4LKXA 2CIKA 4UMGA 4KZDH 1T5XB 1KEGL 1AD9B 5EO1A 1BF8A 4WENB 4ORZC 5BV7B 1XGQB 1F58H 2UYLB 3TCLB 4G7YL 1BJ8A 4UU9A 2GAZB 4ZMAT 1J0HA 1PYWB 2ATPB 1F11B 4A2LA 3STZA 3MZGB 3JXAA 3F62A 5LXGL 2X4TB 4W81A 1O0VA 2J7LA 1UM4L 2EZ0D 4O02H 4MAYB 4NKDB 2X1QA 1IGCL 3QQ4B 1WBYA 4LAQH 4MQ7B 1J9CT 1CGSH 2FB4H 1P53A 2EDYA 1J5OH 4OQTA 4DEPC 3Q5TA 1VFUA 4M93C 2NLJA 5B8CC 4JCLA 1HH6B 1NUDA 5JIPA 2EDLA 2F19L 5FK9A 5ESAA 3QUML 2LAGB 3GMRB 4HIJA 4ONFL 4ZUTB 3CVHB 5GRVK 2EE6A 5LCVH 3QRGH 4XGZB 5FHAL 2WIIA 4FXKB 5B38B 3LS4H 5IQ9B 2C9AA 1JPTL 4DVBA 1MJJA 2L4OA 3QCVL 2HJLB 2VLKB 1JP5A 4LIQL 4RFOH 4K3GA 4Z7OE 2YPKA 5T3XH 4R4NC 5B3JF 5T1MA 5D71H 2DKUA 2JJVA 4HWBA 2K3TA 3PP4L 2BSTB 2BHZA 5F6IC 3MRIA 3N1GC 1CXLA 2X41A 2C4FT 1ZS8A 1ZSDA 5EIVA 1P7KB 3L3DA 3OQ3B 5FYKL 5GISL 3RUGB 2GYSA 1PSKH 1I7UB 3QWRA 4G7YH 1WWCA 3QQ9D 5BQ7A 3BH9A 2DQTL 4O51B 1TZIA 4UNTA 4FQXC 1A21A 3O3DA 1KCRL 1Z9OA 4B0MM 5HYJB 1S7TA 5LXGH 5HHOA 4JDZB 3MJGX 3IETB 2J1KA 4WWKA 1UKQA 5B21A 1Q9OA 3LN5B 3T04D 1KNOA 5K9KB 2UVFA 4EDWH 1IGCH 3CUPB 4PG2C 2P1YA 3U36A 5E6IA 5IEKA 4QHLB 3NTCH 3PABB 3U6RB 3QXAA 4N8VA 3RJDA 3AM8A 3A6BH 3QDMA 3I6KB 4WV1A 3W9DB 3OKLA 4J6RL 4QY8B 4R2GC 1YEGL 2F19H 1CICC 3MLRL 4GG8B 1BHGA 32C2A 4TVPH 5FYLE 3T0EA 3LV3B 4OLUL 5IVXB 1WEJH 4WUUE 4HUUB 3QWOA 1A7RH 4FHBD 4P23B 1HOCA 5ID1A 1PY9A 4PFEA 1JPTH 4OF0A 1AC0A 3VD7A 5FO9A 3V2AR 4LIQH 4U1IB 1NCWH 1JPGA 3RNQA 1Q9KA 3OHXA 3HE6C 1NBZB 4LHJB 1U93A 4ZUWA 1EAPB 4NO2B 1MH5B 5DVMA 2AK4D 4Q2ZA 4PREB 5D7LB 3G9AB 4KDTA 3AAZA 3BQUD 5C0IB 3MUJA 1KLFA 1NC4A 1JFQH 2FR4B 4HWEL 4MSWB 3KPSD 5BZDB 1J0ZA 3NCFB 3WUWB 5C86A 5CWSA 4K3JL 4PY7B 1KCKA 2DQTH 2XPGA 4LCUA 2XZCL 4NM4H 3L5IA 5C6TH 5JDSB 2DMCA 1RMFL 4GW5B 4OCMC 3ZKXC 2Z92B 5D96B 3KAAA 4NFBA 4UOJA 4DZBA 3AU1B 2OSLA 4BSWA 1GZQA 4F7CA 1KC5H 2EC8A 2NY3B 1BZ9A 4JJ5A 2VLJA 1NEZB 1IEHA 3MLPA 1U91B 1FNSL 2GIYA 4YUEH 1J10A 2OZ4A 1JVKA 2G9HA 3UPRB 5HDOA 2DWEA 4U7MA 4YH6A 1BIIA 4J6RH 4D0CB 2WAHA 3QISA 3QEUB 4J3XA 1FSKC 2AJSH 3FQNB 1U9KA 4OFKA 1CFBA 1G9NC 4ZAKB 1MPAH 1NANI 3TZVA 5C0JA 2HTKC 4M8QB 4JFFE 1NJ9B 2C3GA 2F54B 2YMXL 2AEQH 3MYJB 5FGSA 3MLVL 5JXAL 5GIRB 3QEQA 4XC1L 3Q3GB 4Q9BA 1ETZA 1TETH 4Q74A 4BH8B 3HPLA 1S5IL 4G3YL 2WANA 4DCQB 3GO1L 4X9IA 2XA8H 2Y7QA 1T5WB 3L3IA 4QYOB 4QTIL 3E2HC 3C5ZB 1JGVH 1K8DA 2OTWB 3VFVB 4X6EB 4YNYB 1G9NL 5E7FA 5J89A 1UCBH 1FZKA 4XPFH 1CGUA 3O2DL 4ODSH 3SJVE 3WKNA 1YMMD 1T1YA 4FQCH 4PRAA 3KYOB 2ADIA 4K3JH 1G6VK 5ALBH 1QKZL 2ZSWB 3HG1B 4WIQA 4OB5L 1C5BH 5C08A 3R0MA 3NIGF 1DBKH 5IM7B 1MVFA 4IRJD 4I18A 3INUL 1A4JA 2ERJB 3PGDB 2ZCLL 1JPSH 4HS6B 5F8QC 3MRCB 1P7QB 3BIKA 3QNZA 3L1OL 1FNSH 4FQIH 5M95B 4AL8L 4E5XA 5D7IE 1TTFA 4Y19B 4ZNEE 5FIEA 1JF5A 4IIQC 3T0WA 3CU7A 4Q6IC 4PJCA 3CK0L 3EDDA 3GMPA 4HJ0C 1FNLA 4WUKL 2E7BA 5ICXB 3TJHC 4PB9L 5I1HL 3S8WA 2YMXH 4X6CB 5C71A 3MLVH 4U1SB 2FJFB 1QYGH 4YHPB 4WEBL 1DSFL 4H26B 15C8L 5JXED 2NX5E 4NRXA 3GO1H 2VSCA 4BFIA 5CMAB 1CQKA 4LVOC 1KB9K 1GHFL 3NFPB 4EI5C 2X4PA 2VZSA 1FH5H 3QDJA 1OLZA 1W0WA 5HDBF 3RVUD 5JUEL 1G9NH 2MNUA 5F1IB 3QXWA 1MWAB 3O2DH 5DJZA 5TF1H 3T2QA 2COQA 5E8OA 3RY6C 3WNMA 3BZ4B 4S10A 3WDIA 3B9KD 3QFJD 4RX4D 5L7XH 5E5MB 3FMGL 3DUUA 2YD3A 4PRNA 1RIHL 3MXWL 2ZCLH 1MCRA 1M7IA 2DICA 2XN9B 5IB3B 2B39A 4IRSB 4YHZL 4KH2A 3C09C 3VH8A 5JLZB 1IRAY 4LRNH 2XYCA 4PGDB 3DMMC 3ETBF 1AKJB 2WBJB 3EGSB 5MENE 4NN6B 1I1FB 1I7RA 1XH3A 3DV4A 4HD9A 5DRWB 1S7XA 1YMHB 1N6VA 4OF6A 5E2VH 2Z93A 5EU3A 4MCYA 1FPTL 4Y4HC 3CK0H 4P5TA 4ZUSB 1BECA 3VFGL 3D18A 2X1PA 3RKDC 3P9LA 3BIAX 4HPOL 5TDPB 4PRPB 4G6FB 4JHWH 1G6RA 2HVKA 2IPTL 5HVHC 1F8TL 1ZT7B 1DSFH 2VXQH 4PP2B 2ADFH 4KK5D 1T7XA 1ONQB 3O9WD 3W39B 3TIDB 2PW2A 3MODL 4XWOD 1IEBB 5KVGL 3TBVA 3QH3B 1GHFH 3W0WA 4L8CB 3EYOA 1IGIH 1S7VB 5J9PB 3VFOA 3DVIA 2WUCH 5HHQB 1A2YB 1J86A 1IL1B 2F74B 2BSED 1OAQL 1SJEA 1NFIB 1OAZL 5AG9A 3L95B 1JI2A 1JGUH 5I1LB 2AJUH 1RK0B 3TEUA 2E9IA 4XNZC 1A7BA 4L8SB 1XCQB 1YN7A 3Q6FB 5EUKA 1BFOA 3HLAB 3ILPA 1IGYA 4HS8H 4MXWL 3TWCL 3ARUA 1RIHH 3MXWH 4W4NA 1VPOL 3U4EB 2X44D 2PF6A 3R8QA 1WLHA 2Q20A 1KIRA 4LLVA 4HSQA 1JE6A 3HA0A 1UKSA 3JV0A 5DHYA 3OAYK 5GGUB 4Q0XL 3EDKA 5HJ3A 1YYLH 1FPTH 4Z18A 3VFGH 1L7TL 3ARBB 4KKLC 1KF9B 2AEPL 1TPXC 43CAA 4YHOL 2R1YB 4ZG1A 4POYA 2VTFA 3ZE1F 1LVEA 5C09E 1UQSA 3VG0L 1TCRA 1J1PH 5KSBE 4XCEB 2IPTH 4APQC 4Z7WF 1MJ8L 2WSKA 3KPLA 4JO3H 4LPXA 1F8TH 4MWFB 3LPWA 4N0UE 1TXKA 4F7TB 1DQTA 1OF2B 4AH2B 3MODH 2QQLL 1FZOB 5KVGH 4UTBL 4HXAH 3BRDA 1MAKA 4YLQT 3Q2CA 5CGTA 4EBQH 2P8MB 4UIKH 4JDVB 5TGBA 4OF7A 1U8KA 5FDWB 4MJIA 1OAQH 5F7KC 1F4YL 3LB6D 4WO4D 2FCBA 3IGAA 3GUTB 1HNFA 1FP5A 4OFDA 3ARZA 2ESVE 5AUMB 3MGAA 2UV3A 3X14A 5AZEH 1KTLB 3K2UH 2OL3L 5I71B 2G5BB 4ODBD 3ZT6A 4MXWH 4P4KB 4Z7UA 2P24B 4H1LB 1HXYB 3F12B 3B2VL 3PWVA 2ITCA 1CL7L 3I85A 4S1QL 4HH9B 5DD5H 1EMTL 3PWNA 4MA8H 1WCBA 4JM2B 2ZSVA 3S37X 3UTZB 1VDGA 3GK8H 3F7VB 4R4BA 4XNMB 3G6AA 1R3JB 3QDGA 5IVOA 1UXSB 2AEPH 1WITA 4YHOH 4PJ5A 1Y6NR 3ARGD 3OZ9H 1FZMA 3PHQA 4J8RB 4Y2DD 5GSRB 2IBBA 5DQ9B 3S36H 4LARL 3VG0H 3HNSL 3Q0HA 2DLFL 3UMTA 3GBNL 1RJYA 2FO1A 4P9MH 1HHJB 4TSCH 1FN4B 1HI6B 1BQSA 2CRYA 4P5MB 4XMPH 1B9ZA 4X6BB 3UTOA 2BNQB 4KUZH 1LO0L 3X12B 2QQLH 1FGNH 1KT2A 2I9TB 1PJ9A 4KMQA 5C0GA 4NZRL 3PL6B 3CFEB 4FXLA 1VGKB 2QQKL 5FUOH 2V5TA 4ONHB 3MBED 4L3ED 4YFEA 1A9EB 2NY0B 1TVBB 3TN0A 5TFSH 2R0LH 3WL9B 4F7EB 3LAFA 5HVWA 4LGSB 3FQRA 2EDDA 1A6VH 4N5ED 2VDRL 5B3NA 5TJWK 4OQTL 3MV8B 2FATH 5SWZE 1ES0B 3C2SA 1N7ML 5KSAB 1CTNA 3LDBC 3C6LD 2DKMA 3QNYB 1OD7A 2OLDA 1CLOL 2Z0BA 3B2VH 3HAEH 2V17L 5IG7B 4EI6B 2GCYB 4S1QH 5L8KB 1LD9A 1WQVT 4GJTB 2G2RB 5T5NG 4X4ME 1WF5A 2IBZX 2ZKHL 4L9LC 4HJGA 5L2KA 3UZQA 2CIIB 4G8GE 2MQ3A 4HGKC 3VWKA 5J8OA 4WWKC 1XIWA 2NTFA 4HWBL 4LARH 5E6IC 3QCUL 1FFQA 4G8IB 3KPRE 1IC4L 3QI9B 3FB7A 2I27N 1CI5A 3AM8C 2O61B 1FFRA 4RWHA 4U0RC 2GJ6A 1P2CB 2UWEA 4PJBB 3UTPE 4P2OA 1LO0H 3IDXL 4JFDD 3QA3B 4KKBC 3T0EC 1D5ZA 4YHNA 4PJIE 5ICZA 1MCFA 2QQKH 5I9QC 1W72B 3FOMA 3O41B 5MERB 3FB5A 4OSUH 2R23B 3FAWA 5D72H 2FWOB 3I2CL 4JRXA 1T7WA 4NUJA 5T1LD 3QBTB 4YX2L 1V8HA 1JZ5A 4JKWA 1RURH 5I30H 2D0GA 2RFXA 4NN7B 4OQTH 4P57B 5IJVB 1UB5A 3KPTA 4KJPD 5CD5D 3W9EB 1B3JA 1X7QA 3TVMB 4LVNB 3VFUB 4I5BB 3VXQA 1CLOH 4QRTB 4R8WL 5JHDD 4KDTC 4PRIB 4NNPH 4QXGL 2W07A 3LKOA 4JHBA 3IKKA 5C92A 4RA0C 3ULUD 3DRQB 1IQDA 4KI5F 2HJFB 3IVKB 4OCRH 3TV3L 1CFNA 1JGEA 2XRAL 5I6XC 1VA9A 3RDTA 3V6BR 3MV01 4O5LH 4NBXB 4JHZA 3UBXG 5EZOH 4HGWB 4HQQH 4HWBH 5DWUH 1OTSC 3HNTL 1IC4H 4PJXB 1PW3A 1RIUH 1GOFA 4AT6B 3D0LB 2BC4A 2HLAB 2VE6B 4EOWL 2FIKB 4JPIA 3OF6A 5F9JA 5HHVL 2YSSA 3NACL 3RIAF 3IFNL 4G7VL 5TDOB 3HCVA 3TZVC 4R7DA 4R0LA 5ENWB 4YIQB 4PBWD 4C56D 1QR1B 5C3TA 4LLMA 1H8SA 4FS0A 4PB0H 5DC0A 2JCCB 3MRBA 4NDMA 2BY3A 5C0FB 1T7VA 4PRDB 1GZPB 5D1ZD 2GFBA 2DQDL 2BVPA 3MRFB 4PJ9B 1XF4B 4V2BA 5JQ6L 5IFHH 4S0SD 3F58H 1KCSH 1RZIA 1NFDE 4RAVB 5ID0B 4LCWB 4OLXH 3TT3H 5IEHA 1DUYB 3CFCH 3G6JF 5IK3B 4R8WH 4AMKL 5KW9H 1IZKA 4LSPL 4I0CC 1NLDH 4NHCH 5GZND 5IP4A 2AP2A 1KACB 2GK2A 3VMPA 4ODWB 1Q1JL 3TV3H 3VH8G 4S1RH 2X70B 1T3FA 1WT5A 2GT9A 3L3KB 3E8UL 1TZGH 3MX0A 4I18C 4NC2B 5I8EA 3F7QA 1F6FB 1CD1B 2CLZB 2F53E 3IRPX 4KJWD 2P5WB 3HNTH 2BXZA 4RFNC 5TQ0H 3H8NA 2R2CA 1IGMH 3ARFD 4U1KA 4M62L 1LP9E 5LJYH 1P4IL 3FOLA 4EOWH 3H3BC 4UAOB 3E3QE 2NW2A 5HHVH 1Z5LB 3IFNH 5IW6B 1RK1B 3LIZH 3IU4H 2AQ3A 3D39D 2EH8L 3LRSB 3TO4A 1H3GA 4D9LL 2R0ZL 3OXRA 5EOTB 3PWJB 1DDHA 3AS1A 5JORB 5L8LB 1A14L 2VDOH 3QIUA 3S35X 1N3NA 2DQDH 3MJ7B 3MCLH 5C0DB 1BM3L 2OZ4H 4S1SH 4UDUA 5J6HA 5L2JA 2NCMA 1FNEA 1KFAH 1KTKE 4XVTL 3H3PH 1MVUB 2P4AB 1MFDL 4WUUA 1A3RL 1UKTA 3WEXA 5DRZB 1NC2D 1CXHA 4P2YA 2AK4E 3P2TA 1PZ5B 4NPYA 1Q9WA 4G6ML 2ZUUA 3PF2A 3BOVA 3CFKB 1XGPA 3MNVB 1Q1JH 1FL6A 3KPSE 1MCNA 1LHZA 3E8UH 4HIIA 3P30H 1FL3B 3BESR 4KMTL 4MNQD 3QQ3B 3WKML 3KS0J 2DWDA 3PQYB 5ANME 4DUXA 1H3TA 3ECBA 3TFKC 3TBWA 3BE1L 3RWCA 4DN3L 1YC7A 1S8DA 3CDGB 2VXUH 3SQBA 4HWUA 3VMOA 1SYVA 4U1MB 4PBXA 4HK0B 4RFEA 2APWA 3J8F7 4OQ1A 5CCKH 5IFJB 3WFDH 2X4QB 3HKFA 4P5TC 4Q9CA 3MV7D 1A3QA 2VNCA 5D6CA 4NQUA 5EG6C 2WWMC 2IANB 3CH1A 2DBLL 3QJFB 4XZUA 5JOPD 4D9LH 4XX1G 2R0ZH 1MLBB 4QHUB 3OG4B 1C5CL 3GMLB 3V0VB 3HE7D 4Q7DA 1MCCA 3H42L 1K8IA 4M8VA 2RCSL 1YC8A 3U7YL 3OAUH 2Z31D 3HC3H 4UILL 2XQBL 4WW2A 3C08L 5EUOF 3THML 5IESL 4U2YA 4JANB 4ZOAA 1E4WL 3S35L 4JFFA 5DJYB 4ELKB 1A3RH 1DQDH 1CE6B 1JNJA 4X7TA 1I1RA 3QO0A 4E9LA 5FAAA 3VG9C 4NO3A 1A4KB 5KN5A 4LHUB 1YMME 5BOPA 1VB9A 3WS6A 4OLEA 3MRPA 1CGYA 2NNAA 4PRBA 4PY8I 3S3PA 5CD3B 1U6AH 1JYNA 4OGAD 4UNVA 3CSGA 1GOHA 1JBJA 2BVTA 5GGSB 4F8TA 1QFHA 4HFWB 2H9GB 2LV4A 1EBPA 4DEPB 2SEBB 1MIMH 3SJVA 3T1FA 5B8CB 1HSBA 2M1KA 3BZFB 5HYQB 5DYOB 4Y88A 1MOEA 3B6SB 5HHXL 4CUCA 2GUOB 2IFFL 3CMGA 4XHJC 4CL7A 1R0AL 1AE6L 1N0LA 1UYWL 1IT9H 4GMTL 3SGKC 4G43B 5F97E 3H42H 3OWEA 3FCTB 5LGJA 5EZIL 3VFMA 3GSWB 4DGVH 2RCSH 5FOBB 3BZEA 4Z6AT 1AI1H 5D7IA 4ZNEA 4UILH 1A1OB 5ADOH 5F6IB 3C08H 4ZQKB 3THMH 2BY0A 2QTEA 3UZEA 3V6OE 4DJMA 2YWZA 4M6AA 1OAUL 3SCMA 3U7WL 4QWWC 3D85A 1F6LL 1JHTA 4U6YB 3PWPD 2VLRB 4JREC 2EXYD 4FQXB 2V9TA 3KR3H 5A3IC 1M6OA 1SEBA 2Q6WB 4QXUL 2XY1A 2V7NA 2NX5A 3E1F1 4M3JA 2F5BL 5F7EH 1OM3H 3BVNB 1N64L 4OCLC 4OFYA 4R96A 1JZ8A 2OK0H 1OWWA 1U8OB 3VRLE 3EKCA 5BMFH 4BSVB 1MHCA 2IMNA 4R2GB 5IMOA 1N5AA 4JAMB 1CICB 5DEGA 2NY2C 3RWEB 5EO0B 1TQBC 4YO0A 4YC2C 5AYQA 1NGWA 2VUOA 3DURB 2HP4A 1AE6H 1V7ML 4PJFF 2W0FB 4GMTH 5F88A 4HMCA 3UTTB 1AIFA 1B88A 2P5ED 1X5AA 3OR7B 1CQYA 1CLYL 1Q38A 1ZA3B 3RHWF 5MENA 1L0QA 4JPVL 1LILA 2OTPA 3HE6B 5DUPH 5JA9A 1D9KD 4QNPF 5IVZA 2ARJA 4X6DB 5BRZD 1CXKA 5C0AE 4NRYB 4UUJA 2E9WA 4JFXB 4KQ3L 1T1WA 1KJ2L 3TN0C 4PLJC 2R56H 5ACZA 1OAUH 5AD0B 3VD4A 3GJEB 3AS2A 5TQ2H 2FO4A 3QUZA 3S7GA 5IHLB 5AYUL 4KKAD 4QXUH 3NIFE 4GXVL 4C4KT 4QOKB 3ZKXB 4PJAF 5DMKB 3GNML 2HTLD 2O5XH 1KJ3L 4L4TB 5CKAA 3DSNA 3DI2B 2EDBA 3DV6A 3UTSD 1MHHA 3SKMA 1JWMB 3NIDF 4NWTH 4Y5VA 1YYMH 1F5WA 5EU7E 1FSKB 2ICCA 2CK0L 3D87B 4LLYA 1QO3A 4GRWE 3LKQA 1VFOA 1NBQA 2P8PB 3RVXC 3VWKC 1EK3A 2WM0A 4O2FB 4WI6A 1XIWC 4TRPH 3PDOA 2AXJA 3MR9B 5D7LE 5EC1B 3S3JA 3R1GL 1MIEL 3MV9D 4KV5E 5IR1A 4PJDE 2R0WH 1CLYH 1WV7T 2EYRB 1CDYA 3CFDA 5F8RC 2AW2A 4K8RC 4JPVH 1O7VA 4FQ1L 4P2OC 3QP3A 4D9QE 3W5NA 5E4IA 3GSXB 3MUGA 1KJMB 1NDMA 3E2HB 5MEQA 4ODHL 4HH8A 4KQ3H 1KLGB 1NBYA 4JB9L 3SY0A 1UVQA 2KZ1B 4XAWH 4L5FL 5C09A 4LNRB 4G6JL 5E5UB 3RRQA 4F7PA 5FKPB 1JGLL 5KSBA 1IE5A 3M1BA 3WHE1 1NSNL 4ZFOA 4HIXL 3Q48A 1UC6A 2X5PA 4N0UA 3S96A 2YN5A 4HG4J 3OKKA 3TLRA 4K8RL 1HN1A 1MCKA 2YPLD 2XQYG 1FCGA 3HNVL 5LAXA 1KJ3H 5GQBA 3HZMB 1N6UA 4Z76B 4KKCD 3UYRH 2VAAA 1I4FB 1RD6A 2BXYA 3BPCA 3OAZK 5I75C 4X7SH 3ZL4L 4JFZL 4QF1A 4AG4H 3HC0B 4IIQB 5T3ZH 3IDIB 2A9NH 4L4VB 2HVJA 2PNDA 3RDTC 2ESVA 2Z4QA 4OCWH 2JIXB 6CGTA 4GRMB 3FB8B 4L8BB 4X7CC 5CZKA 2H6PA 3VCLA 7CGTA 1AXIB 1L6XA 1MIEH 1PKQE 3ULVF 4L1DA 4O2CA 2GHWB 2QSVA 1NGPH 2QKIB 5FGCB 2XWJB 2IQAA 2H3NA 2A6JA 5JNYB 2M8XA 1KB5L 3WFBH 3ALWA 4GW1B 1BOGB 2VMFA 4LVOB 4WDIA 5DFVC 4PP1D 3QHFL 4PV9B 4EI5B 5CEZD 4YGVB 4R0LC 3IXTB 3ISWA 2ADGA 2FDBP 3VDBA 4HHAA 3OV6A 3WNLA 5J56B 1A0QH 1QFPA 1RZGA 2NY6C 3B83A 1JGLH 4KJYA 5DUBB 4L3EE 4NZJA 3KPMB 4L29A 4Y19E 2W0LA 4H5SB 5FYKD 2Y07H 1IAKB 1PEWA 2Y23A 4OZ4B 4K8RH 4KRLB 1OPGL 4GSDH 4ALAH 3RZCA 3C09B 4K7PL 1R5VB 3DMMB 5DJCA 4Y16D 2FLBT 2DI9A 4PD4J 2GY7B 2R39A 3V5DB 3OAYH 5F21B 3PHOA 1JYWA 4Y4FA 1X4ZA 1H8OA 4C83B 2EDFA 1QLRB 1TTUA 3LCYA 4NQDE 4Y4HB 1OTUD 1WT5C 1HHIB 4IRZH 4NQED 2DM2A 5DMGC 3W81A 2DL9A 4MXVE 5SWZA 1ZHKA 4KK6D 2NQCA 5HVHB 3BEWB 1C12A 4KRMB 2OX5A 2G60L 3SKNB 2OJZL 5DD6B 1YEJH 4X4MA 1KG0B 3MZTA 5K59F 3JWOL 4GUPA 1MCHA 1CDCA 3SGDH 3NA9L 4G8GA 5SWSE 3QHFH 4QRSB 3TO4C 4JFDE 1ZHNB 3FONA 2NY4D 4YHML 1ZANL 1AGDB 1CL7I 4KTDH 1DEEB 5JO5B 4RWYL 4ETQB 1RSFA 3KPRA 3QQNA 4X5WA 1QFWM 3QIUC 3U79A 5F6HJ 5FB8B 1ERNA 1XF5B 5EZJB 2NXZC 4XNZB 5E6YA 1K5NB 1J1XL 3MNWB 4ZYKB 4PJIA 1OPGH 2ZUVA 4U1GC 4HWNA 4D94A 4PRPE 3IT8D 4RQQB 1F3JA 3QIBD 3L3JA 4U6HB 1RVFL 4NKOA 5DLML 3EYVB 1F4HA 1WIOA 3WXWL 3RWJA 3VXUD 1EEYB 1TPXB 3ULUE 4FTVD 3CZFA 2AJXL 2GK0B 1R5IA 2A0LD 3QULA 4K3EL 3T8XA 2H2PC 3RL2A 5C8JB 2GQHA 1DP0A 4APQB 3O3EB 1EO8L 2G60H 3W2DH 4POZC 5DJ8A 3S5LA 2X10A 1JIBA 1EFQA 2CRMA 1CXIA 3HAEB 3CXDH 2D7TH 4U3CA 3P4OB 3DVFA 1I1AC 1N8ZB 1I3GH 3DROB 3T3PF 1ACZA 3U0WL 5I1KH 1WK0A 3C60D 4LHQB 4O9HH 4OGZA 4G9FB 5D2NE 3SDXF 2DYPA 2CIKB 4WI4A 5MP6L 5T1KB 3QZWA 4WW2C 3R4DA 1ZTXL 2R1WA 1CE1L 5EO1B 3P4MA 4HAFA 3PUCA 4F2MB 4OBSA 4JQVA 2EE2A 1RVFH 1T80A 1U41A 5DLMH 3MCKA 2V2TA 4UU9B 3VRIA 5KVMC 4QGTA 3STZB 2DM7A 1HKFA 3WS6C 3WXWH 4EN3D 5FXCH 2AJXH 2R0KH 2E7MA 1WBYB 2GI7A 1NFDA 4K3EH 3HUJB 1NKOA 3MOQA 5FYLH 3IFLH 1KTRL 2NLJB 3KJ6H 5FK9B 1BFSA 3ME0A 4NKIL 5CHNA 4HIJB 4PJGE 2OBGA 5J3HC 1SJVA 5EU6D 2F53A 2WIIB 35C8H 1YJDC 1C08A 4NBZB 5J57B 4DVBB 1MJJB 3IFPA 2AI0L 1NUFA 1AY1H 5H2BA 5DC4B 2VABA 1LP9A 5T1MB 1TENA 4EDXA 3C8HA 1KCVL 1VKXA 2GKIA 5IFAH 3MRIB 3P73A 3LDBB 2P8LB 1ZS8B 1CE1H 1ZSDB 1EGJL 3I6GA 5M94B 1UA6L 4DGIL 3SCMC 4RGOL 3U30C 3L3DB 2DQUL 4J4PA 4JPKL 3WLWD 5BQ7B 3O4LD 4L9LB 3BH9B 1TZIB 3O3DB 4PJ8D 4WTWA 2J4WH 5HHOB 1WAAE 3HRZB 3RTQD 1N2RA 4WWKB 1D5IH 2ZG1A 4KUCD 1KNOB 3I3BA 2X4UA 2J8UE 1N4XH 1JHKL 3QXAB 4N8VB 1VFAA 5E1HB 3QDMB 3BO8A 3S34H 5J4MA 4HEPG 3FO1A 1NGYA 2AK4A 4K9EL 4ZS6C 1U42A 4FXGB 3IJSA 1AQDA 4NKIH 4GMSL 3H0TA 1MFCH 3T0EB 1E4XH 5A43C 3KPSA 5AG8A 5HHPA 5I9QB 3QWOB 1HOCB 3MV7E 1TZHA 5ANMA 5ID1B 3P77A 1YEIH 5JOPE 3RVWC 3KXFE 2MPAL 4WHYG 5ELIA 5FO9B 3CSYA 2ADJA 3L7FA 5JQHC 3IDNA 1A6AA 3RNQB 1Q9KB 3OHXB 2FX9L 1TNNA 4WFFD 4HIEA 3NZHH 1U93B 4GO6B 4YPGA 4ZUWB 1KCVH 3VWJB 4LRIA 4D3CH 5D7SL 1F3RB 5CSBA 2Y6SD 4LCYB 3QCTH 3AAZB 4HFUH 3B9AA 1MAJA 1NC4B 4GKNA 4JKPH 1R3KB 3QUZC 1S9WA 5CWSB 1YJDH 2XPGB 4LCUB 2NR6D 4P5KA 1NCBL 3GHEL 5GRUL 5HYJD 2K7PA 2HFGH 2VITA 5I6XB 4W6YB 5SX4I 4XP4H 3OG6B 4DZBB 4HUVA 2OSLB 4BSWB 4F7CB 1N6QH 3LQMA 1QVOA 2VYRE 4JJ5B 2OCFD 2VLJB 4ZOEA 3Q5OA 1ZLVK 1CK0H 1F13A 2NY1C 3DX8B 5DJAA 2G9HB 5FYJU 4XBEH 2DWEB 4XMKH 3MRQA 3PWUA 4YQXL 3SE9H 4GMSH 4QHMA 1YMMA 1DN0A 3LHPH 3ILQD 3TZVB 3UJTL 1B0RA 1T04A 6FABL 1E0OB 3MUHL 4ONGL 1MAML 2FHBA 3VXME 3UTQA 1UG9A 4IRJA 3QEQB 3FO0H 4HUNB 4ZXBD 3LPGA 1ETZB 3HPLB 3V52L 4DGYL 3L7EB 4D9RD 5HPMA 3GDBA 2FX9H 2OR7A 3OJMB 2AXGA 2Y7QB 1Z6JT 3L3IB 3AC0A 1MFAH 1ZLWK 4EVNA 3REVA 5ALCL 1T5XA 1IC5H 1HINH 1FZKB 3WXVH 4CVXA 4W70A 3U1SL 5F7NC 4GAJH 4K3HA 1T1YB 4P59L 4XNXL 4PJEE 2UYLA 2ADIB 2V7HA 4KHTL 1H3WM 1NCBH 3GHEH 5CZXD 3LZFH 2ATPA 3E0GA 5TE4H 3PWPE 2P43B 3NAAL 3KHQA 4I18B 5ETUA 1A4JB 5IMMB 1EFXD 4LOUD 3TT1L 5I1EL 3H9SD 4FP8L 4HKBA 3MLUL 3MBXH 4G42A 3V6OA 5EBMA 4RFNB 3BIKB 3QNZB 2BVYA 4MYWB 1LGVA 1QNZH 5LKNA 3RI5K 2EH7L 1KN4H 1ZGLP 4JY5L 1YEHL 4YQXH 4PJCB 3GMPB 3LSOA 2H8PA 5EBWA 3UJTH 6FABH 2F54D 4UT6L 5JW4R 1CDIA 3CVHA 3X11A 3A6CL 4RX4A 4QRRD 4XGZA 2X40A 4ZPTA 1ZOXA 4JO1L 3I9GH 3QXTA 4FQLH 2R69L 3GMOB 2HJLA 4DGYH 5DO2C 4NRXB 1NCTA 2M26A 4BFIB 5DJXA 3LS5H 2LVCA 1P7HL 2X4PB 3C5ZD 5KTEL 4TTGA 1UGNA 1UZ6E 3QDJB 4OZGF 4HF5L 1W0WB 2P5WE 1I7TA 5M7QA 5E2UH 1QR4A 5DJZB 3U1SH 5JW5A 5BRZE 4P59H 4YWGL 5E8OB 3HG1D 4KHTH 2UVEA 2ICEB 4WI3A 4R6UA 1LE5A 2QADD 2H45A 3U2SA 3DUUB 2AS5M 4WHYH 4IS6A 1M7IB 5I1EH 3ULVL 4FP8H 3RZCC 5C0AA 4QHLA 1TLKA 2PCPA 4KROC 3BN9C 4B7IA 4P3DA 4FRWA 1JTPA 1XH3B 4MA1C 4Y4FC 1JV5A 1S7XB 1FORL 3FO9A 3EOAA 4OZIF 2Z93B 3OGCA 4Y5XA 5EU3B 4EQ2A 4MCYB 4JVPA 4P5TB 3P9LB 3LV3A 1SVZA 1Q8MA 3ZO0A 1OB1A 1LEGA 3K4DA 1FV1B 2X9YA 4KRPD 3VJ6A 25C8L 1VACA 3QT2A 4I77H 4IMKA 3RZWA 4RMRA 2HVKB 1MF2L 1Z0MA 4U1JA 2R69H 2BVOA 1CD0A 3O8XD 3QPQC 4U1IA 4XWGH 2PW2B 3BYTA 1HCFX 3TBVB 1NBZA 3AY4A 3W0WB 5DRXA 3PQYE 5F1OB 3WN5A 3EYOB 1MFNA 4HF5H 4XVSH 4LQ1A 4XCCL 3VFOB 1IGFH 4GLRH 4O2EA 4XPHL 3EYUL 4WW1A 1ZT1A 5D7LA 1SJEB 1CDGA 4YWGH 3QZWG 3V4PH 1PVHA 1FLRL 4PJDA 3VG9B 3WFEH 1ZHLA 4AEFA 1YN7B 2APBA 5EUKB 5F6HI 1BFOB 3ILPB 1U8JA 3QXVA 1AQKL 3SDAD 1NMCC 4CW1A 1ED3A 4PG9A 1KIRB 2FGWH 2YPLE 4XI5D 3V0AC 4OIIH 1T66D 2BHUA 5HJ3B 1SMOA 5KS9B 1A7PL 3CX2A 2AK1L 3O3UN 2KQMA 43CAB 1BFVL 4NC1E 3CFIC 4DKAA 1UQSB 1TCRB 4G6FD 5CJBA 25C8H 2ENYA 2BFVL 4JZNB 1MF2H 3S88L 3KPLB 1U36A 2X09A 4MXQD 3JBG7 2DLEA 4BZ2L 4KQ4H 4BH8A 5D5MF 4TULL 4S0TD 3VFSA 5I2IA 1TQCC 4L3AA 1KENL 3ZT5A 5GGRA 3PWLA 4XPHH 1JMXA 5TGBB 3EYUH 4WFED 5CEZE 3VD3A 2ED8A 1S9XA 5JTWA 7FABL 4MJIB 5FDYA 2EZ0C 1PKQA 4BZ1L 4NQXB 4P3WA 3ARGA 4KWUA 1SY6L 4JREB 1NAML 3QUXD 3IGAB 3KWWA 1MCBA 3KYOA 3X14B 4FQJL 2XZQL 5E99L 5JHLL 1RULH 1U2HA 2I9LA 5FYKE 4Z7UB 1F2QA 4YXKH 4DOHE 3TPUA 3PWVB 4ODTL 2ITCB 3MLZL 4JQVC 1MCOL 4OUOA 4U6XA 1CFQA 4KGJA 5EIIA 3PWNB 1H3VA 4M1CD 4Y89A 1WCBB 2ZSVB 2NY2B 3MBEA 2Z91A 4L3EA 1TQBB 4Y19A 4YC2B 1A7PH 1PG7L 4R4BB 3G6AB 2IGFH 1MQKL 1T6VN 1FYHB 3QDGB 3GKZA 4OCYL 4RGND 1MY5A 4PJ5B 4MCZA 1CIUA 3PHQB 2A6IA 3GM8A 3ZDYE 2IPKA 4NQEE 2DOCA 1RJYB 1UCTA 1GC1C 5DHXB 2NXYD 3BSZL 1W0YT 4BZ2H 3V8OA 2FH8A 3Q6GL 3F7RA 1KT2B 1EHLH 2O26U 2MFNA 3TF7C 1SQ2N 5C0GB 1DLFH 2PXYD 4NQDA 5F93C 5CMAA 4HBCH 1KENH 4HULB 3T09A 3S98A 1PEZA 4OZHF 3TN0B 1CXEA 1I9RL 7FABH 1J11A 1BAFL 5KZCD 1RIVL 4IEFB 4XNYL 1PBYA 1NAMH 3FL7A 4YPJA 1LO2L 3QFDB 5TE7L 1Y0LB 2J6EA 5E99H 1MCPL 2W60A 5E5MA 3HI6H 4HPYH 5SWSA 4ODTH 4JFDA 4IRSA 3OAZH 1MCOH 1RQ5A 2IAMA 2X9XA 4M6ML 1LD9B 2ZUQC 1OTTC 2VLMD 4JM2D 4HJGB 3EJYC 5L2KB 2GY5A 5BS0E 3CNKA 4M1GH 1PG7H 3MRLA 5F9OL 2PN5A 3VWKB 4U7SA 4OCYH 5C0BB 1MY7A 1XIWB 1PX3A 4TTDC 2NTFB 5DRNA 1K4DA 3FB7B 5TDPA 4PRPA 3ZDXE 1A6WH 1FE8H 1YPZE 2GJ6B 3FT2A 3BSZH 4FMFA 3ZE0E 2L7UA 2UWEB 4P2OB 3Q6GH 5I8KH 5ILTH 3QNXB 4YDKL 1D5ZB 1IEBA 3PL6D 4KKNA 5IHZA 5ICZB 2X05A 1IQWL 1MHPH 5I15L 3FOMB 4OFVA 1S7VA 3HB3D 3FB5B 5F9DC 5HHMB 3MA7A 1I9RH 4JRXB 1BAFH 4NUJB 1RIVH 3RWDB 2F74A 5BOZG 3AGVA 4Y4KD 5DMIL 5E1AB 3L95A 4FFZL 2IC2A 5IHBA 1GC1H 2RFXB 43C9A 1RK0A 1UB5B 1XCQA 4LRIC 3HLAA 1QA9A 1AH1A 1FFNA 4DVRL 3QIWD 1ZHBA 3HHRB 3DRTA 3VXQB 3WIFA 4K2UH 4YZFF 3RVTD 3U4EA 3REWA 3CXHJ 5H37H 4M6MH 5JIHA 3LKOB 5I75B 4XAKD 4KJQD 2LE9A 1IQDB 1GOGA 1CFNB 5D2NA 5F9OH 2G75A 1U3HB 3RDTB 1KXTB 3NN8A 1AJ7H 1NKRA 5F7FA 4M7JL 1GGBH 3AS3A 3WIHL 5DFTA 4UNUA 2Y36L 1FNHA 4HJJL 4JPIB 5F9JB 5D2LE 2YSSB 2LFGA 5IF0A 2DD8L 4YDKH 1EEZA 3HCVB 1FZOA 4LSQH 1XGYL 5B38G 4R7DB 1IQWH 3BW9A 3TPKA 4YDIL 1WZ1L 3I6LD 2CDGA 2ZCHH 4LLMB 4IRJC 5C07B 2NY6B 3VGFA 2I07A 3MRBB 4NDMB 5JW3L 4I3SH 3BPOC 1G9MC 3AVEA 2H2SD 3SE4A 2GFBB 1VEPA 3VXNA 4GQPH 1F3DH 5DQDH 2BHYA 4BK4A 1V3LA 4DVRH 2P24A 4PJGA 1WBZB 3BKML 3BHBA 1HXYA 1KCLA 4OCSH 4BFEA 5E9DB 2BK8A 4LLQA 3MRJB 4AEIH 5IB4B 2DMKA 4NIKB 3GJFK 4M6NH 3QDAA 3UYOD 1Q9LA 2DL2A 1DFBL 1W0VA 4CGTA 2GT9B 1LDPL 3O4LE 5I8EB 1J18A 1QSFE 1HYSC 2WNGA 1JNNL 1JYXA 5BCAA 2PW1A 5E2WH 4J8RA 3V6OC 5DQ9A 4M7JH 5GS2D 4U1KB 4NBYB 2F58H 3SKJH 3RVUC 2MKWA 3FOLB 1EIBA 4P5MA 4XPTL 4F37K 4PGJA 1KEML 2NW2B 4OGYL 2DN7A 4BH7B 2QR0A 2AV7B 2I9TA 2B1AL 5IT2L 1WAAA 3TO4B 3OXRB 5F3HA 1WZ1H 1RJLA 1WC7A 4M7KL 4YDVB 3CLEL 1DDHB 1LEIA 2J8UA 1CBVH 5HPOA 5BO1L 5GXBB 2BNUA 3WL9A 5JW3H 4F7EA 4UINL 4M9OA 1OARH 3LKNA 1LNUA 3QIUB 1N3NB 1DLHB 4NQSA 2B2XL 2NXZB 4PJ9D 4KK8D 5L2JB 2YD8A 5I16A 4ZSOE 2CQVA 1G7MA 4XXDA 1EA9C 4U1GB 3L5WA 1OGAB 2H1PH 3QNYA 1AFVL 3WEXB 3WUWG 4EKXA 3MV7A 5IG7A 3T0DA 4KXZI 4LCIL 3KXFA 2VUYA 2R8SL 4NPYB 1Q9WB 3OPZL 1XGPB 1FL6B 1EV2E 1DFBH 5IB2A 2OQJA 1LDPH 1K6QH 2FL5A 4HIIB 1KLUA 1PLGL 3MLXH 1G9MH 1NEZG 4KK5C 1ZVHA 1JNNH 1T0MA 5MHSD 3ECBB 3HI1B 3ZSTA 3TBWB 1QBBA 4XWOC 3UEZA 2Z31A 1S8DB 4G8IA 3P40A 1DN2A 1XF3A 1SYVB 4RFEB 2EDQA 5J13C 4GW4B 4KY1L 4KTYA 1V7NH 4Y5XC 3GGWA 3DVGB 1AO7B 3QEHA 3WLBA 4ODVL 3P0VL 5D6CB 3CH1B 1I1AB 3LRHA 1Y6MR 4G6AD 3KPOA 5D70H 2XT1B 1OAXL 1C16A 1F4WL 1M05A 5I1DA 3O41A 4IMKC 3GHBL 4KI1A 5BO1H 5MERA 1KYOJ 2NW3B 3GI9L 5J0BA 2FWOA 4UINH 1VADA 2EXWD 3FT4A 4LSTL 3TYFA 1F00I 4P57A 4D9RE 4E42A 1A6UL 5KSUA 4WW2B 3AY4C 3C87A 3WN5C 1FGVH 4TSAH 4F57L 1MREL 2BRRL 3OL2A 3W9EA 4JFFB 5ITBL 2F5AH 4BFBD 2C4XA 4ENED 4CN4A 1BJ1J 3VXMA 4HEME 4LCIH 1CR9L 5A40E 5CGMA 4E0RB 1ZVYA 3QO0B 2R8SH 3BPLC 4UI2A 5KN5B 3OPZH 2N7BA 1FYTE 4NJ9L 3DRQA 3MRPB 4PRBB 1PLGH 2L7JA 4C58B 1WFUA 4PJ7F 4M48L 5I74C 1ADQL 5I66A 1GCFA 2CO6B 1S9VA 3H9SE 3SJVB 3FQWA 1FRGL 1CS6A 3H7BA 3QXDA 1KPRA 4KVCL 4KY1H 4PJEA 1K85A 4OLZL 5TPWH 1D5XA 3HZYA 1QFWL 4ODVH 3HI5L 3P0VH 4WO4C 3PWPA 5GGVY 2AVGA 1BBJA 2E27H 2JB5L 4R90L 4P2RD 1DL7H 3OB0K 2XNAB 3AMLA 3JV4A 3GJFA 4YIQA 5FECB 2EEBA 3QO1A 4QRPD 4PLKD 5E03A 5LGJB 2XZAH 4GT7A 5F71A 3ROOA 3TO2A 5I1CL 4QRRE 4U7KA 3BZEB 2W9LA 5D7IB 1HSAB 3I84A 1GZPA 4KI5D 3NCBB 4UBDD 4OD1L 3RY4A 3KLAB 3SPVB 4P9HC 4W6WB 3WFHA 3HUJE 3DX9A 3N9GL 3SCMB 3U30B 3CCHA 4TVPD 1CR9H 2VDKL 1JHTB 3ARGC 4PJHF 1HWGB 2DJUA 4PTTA 1KJVA 3B2UD 4DTGL 2ZUTA 2OMNA 1M6OB 1SEBB 5HGBA 2V7NB 3MQIA 5GS0D 2NY7L 1J05B 2NX5B 4YFLF 2UZYB 2MJWA 3L3KA 4ORGA 3QPXL 4CDGC 2DQJL 4R96B 1ZLVH 4M48H 4G8FA 4GRWH 2LVEA 2P5WA 1D9KA 1ADQH 2CLRA 1MHCB 3VA2C 3PIQA 1UWEL 5BRZA 1FRGH 5DT1H 5IMOB 1N5AB 5HGHA 3MBEC 4YO0B 4OLZH 3SO5A 1TCMA 2J12B 5INCA 2IMMA 3HI5H 5IW6A 2VDLL 4R90H 2DLTA 5B3JE 4G8EA 3LRSA 4N5EC 3S4SB 4LGRB 4G6KH 1QTYT 1WSST 5E8NA 3WNKA 1AIFB 1EEUA 1YA5A 3EHBD 4WFGD 5MENB 3VI3F 1CGVA 4HXBL 5CINL 2DQFB 1ZLWH 1MNUL 3DYOA 4OD1H 2VR4A 5IVZB 1JUFA 3DYMA 3T2NH 4DKFH 3EOTH 4MHHI 4UUJB 5C0EB 3HMWH 2BZDA 2MCPH 1A3LL 3VI4F 1J0KA 5DRZA 2VLRD 4M7LL 1RFDH 2AKRA 2ED7A 2FO4B 3QUZB 3W11D 2IBZY 4D2NA 1MRFL 3B5TA 1FAKT 1CU4H 3GSNL 1P5UA 3VDAA 1FL3A 4AJ0A 4OJFL 1AC6A 3B8SA 2D4DA 3PQYA 2FEEL 3AXLA 3EDJA 4B5EA 1QRND 5HI5D 3DV6B 2IAMC 2NY1B 1MHHB 5CEYA 3SKMB 3EYQD 3PXJA 4UTAL 3VXSD 1YEFL 1VESA 4LLYB 4X6FA 1QO3B 3LKQB 1HHKA 2QV2A 3R06A 1SHMA 1YNLL 5FCUL 2VDLH 5FUZH 1GAFH 1M7XA 4GLRI 4N0CC 3U7AA 3IB4A 1F4XL 1L7IL 4QHUA 3UTTD 2QSQA 5J7CC 3N85H 4KJPC 4ZOBA 2YPLA 4X4YB 1IM9A 3CFDB 1QSVA 2IPUK 5IJKA 1RUML 4UOW0 3E6HA 4P0DA 1MNUH 3BYYA 4IHOB 3MUGB 3QYCA 1NDMB 4UQ3A 5MEQB 1NANH 4ODUA 1NBYB 3ULUC 3SY0B 1UVQB 2X89A 4FZEL 5C09B 5JW4M 4F7PB 1Q0YL 5IHUL 5KSBB 4M7LH 3IFOA 2C3HA 3D9AL 1YNKH 3M1BB 5DK2B 4ZFOB 1INEL 3QEGL 3QUMA 3BGMA 4TNVK 1MCEA 1A9BA 1MRFH 4S11A 4N0UB 4OCXH 4NM8H 3S96B 5DVOA 1OHQA 4N8PA 3OKKB 4RSVA 4OJFH 5CD3A 1BBDH 5LGHL 1FL5A 1JWUA 2VAAB 5D93C 4UTAH 3SKOA 4CKVX 4D8PA 1YEFH 1NCCL 5J1TC 2SEBA 4QF1B 2YS4A 4M6OL 4LPVA 2BVUA 1H3PH 1OCWH 4Y8DC 4X98A 4OV5A 5D2NC 4AEHL 4ZFGL 5ICYA 2HVJB 2QHRH 2GSGB 2ESVB 3MGOA 2Z4QB 4MZ2A 3T2PA 1YNLH 4JZJA 5D1ZC 2H6PB 2J6EH 3VCLB 2APVA 2AJ3A 4RGNE 1BX2A 1MRCL 3BP6A 1XT5A 1KBGH 4O2CB 5DZLA 3O6FA 3O3BA 5EORL 1KN2H 2D4FA 2IQAB 4CVZA 1GGYA 5DSCB 1RHFA 4Y16A 1RZ8A 3CGTA 4FN0A 5GZNC 4JVUA 4DW2L 2BY2A 1T1ZA 2ADGB 1DBJH 3NIGE 3O4OC 1VHPA 5AEAA 4JVWA 4NQEA 2ZOLA 4XMLL 3JV5A 4KJYB 1A5FH 3UC0L 2MQ0A 4L29B 3ZTJG 5DVLA 4KJWC 3SE4C 1KV3A 1SYSB 4JGMA 4FQXA 1KCUL 2MTPA 3ARFC 1S7QA 4B7LA 4DZ8A 2VDQH 2DDQH 5CILL 3VA6A 3RZCB 5H94B 1P69B 4TPRH 1HXMA 4I0KA 2DJSA 4HLZH 5DJCB 5LGHH 4KROB 5IBLD 4LSVH 1FJ1A 1FCCA 2Q8AH 4CU6A 5J11C 3ULUH 3WFCL 3PHOB 1NCCH 4MA1B 2Y1VA 4Y4FB 1HCVA 1BZ7A 1I3VA 2WZPD 1FG2B 4EIZC 4L4VD 4ZFGH 4IDLA 2VLME 4HJ0D 5TE6L 4HS3A 1ZHKB 3V4UL 1MRCH 2UZIL 1GGCL 1I8MA 4O58L 3K8MA 2YKLH 5HDBE 1C12B 4LAJH 3MOAL 1ZEAL 2DQIL 4Q9QL 4Q9RH 3QIBA 1Q0XL 3RPKA 2AQ2A 5BS0A 4G8GB 4DW2H 3BKJL 2BVEA 5E2TH 1O5DT 3BFOA 5EN2A 3ZTNL 4XMLH 2PUQT 3KPRB 2MSPA 3UC0H 1C8PA 3WJLA 4WTZA 1YPZA 3KYMA 3U4BL 3MO1A 12E8L 1CLZL 3AROA 1T2XA 4MA7H 2B1HL 2VAJA 4P2QD 3VD5A 5DMKA 4PJIB 1WICA 1VGEH 1NMCB 4ZTPL 3L3JB 4HT1L 3FJTA 3ORJA 3WFCH 3VGHA 3LRGA 1PGRB 1B2WH 4XP5L 4JFED 1ND0A 4C57C 4Y4HD 4XAKE 1WJ3A 3RWJB 2HKFH 4HKZA 2YUXA 3TBTA 4JCMA 4QKXB 3CZFB 4C4KO 2P8PA 3HZKA 1R5IB 4MQSB 5TE6H 3M17B 3QULB 5C0NC 3FB6A 1NAMB 4GFTB 2Z31C 2UZIH 3RL2B 5EC1A 1BQUA 2Y9RT 4K7FA 1JGDA 2VXVH 3HZVA 4QHNA 1LO4H 3SGEH 3RU8L 4ZTOL 5DJ8B 3S5LB 3T3MF 4KTEL 2EYRA 3SDYL 3FFCD 2DQCL 3OKDA 1TQCB 4MA3A 4Z78A 3JUYA 3BKJH 4Z9KB 4G80A 1T89A 4GS7C 1XAUA 1FNGA 1JZ7A 3ZTNH 1KLGA 4OIAA 1KSRA 3QAZC 4EN3A 1NLBL 1S7SA 4LNRA 1FZJA 3I6LE 4OGAC 4ZFFA 4D0DA 2DYPB 4LL9A 1QFUL 5KS9E 12E8H 4ELMF 5DJDA 4YAQA 1C7SA 3QZWB 3H9HB 4XP6H 4PYGA 1MEXL 5D2LA 5D7KD 2BNRD 2B1HH 3S3SA 2VN7A 2R1WB 1J1OL 1FDLL 3P4MB 1FNAA 4YHYC 5ACLA 4HT1H 1DQQA 5L0QB 3MCKB 3ZE1E 2V2TB 2GJZB 3AFLA 3VRIB 2XTJD 1NFKA 3D69A 1EZVX 3LEYH 3FRPG 3HC0A 1PFCA 4Z7WE 3L3HA 2UY7A 4MNHA 1V05A 4FA8A 3KYAA 2R4RH 1HQRA 4GRMA 1NFDB 3O11A 3FB8A 4Z7QF 1A7QH 2R29H 4LVHC 4APQD 2W9DH 4KDWA 2QKIA 4X9BA 5CHNB 3BD4A 5KBNC 3ZE2F 1UM5L 1WVZA 2NYYD 4LDOB 1BQHA 3O4LA 2EXYC 2Q7NA 4EI5A 1QSFA 4PJ8A 2F53B 4U05A 3CMOH 1C08B 2E7HA 3RTQA 1P1ZA 1CT8A 5A2JH 4NGHL 5DUBA 5H2BB 2VABB 1LP9B 4JJHA 4EDXB 2V5RA 4H5SA 2C1PA 5MEPB 3B3IA 1VKXB 4UQ2B 1MEXH 3QXUA 3MACL 3P73B 3OBAA 3FN3A 1J1OH 3I6GB 2HLFD 2EEDA 5EBGA 1FIGL 3ULVD 4GKZB 3ARSA 2DKSA 5A16A 3K7UA 1SM3L 5DK0A 5E8DL 1P84J 1N2RB 3P11L 2X4UB 5E08L 4ZSOA 1I9IH 3MLTA 4OLWL 4I2XE 3WD5L 1U8NA 1D9KC 3LMJH 3FT3A 2ORBL 1PAMA 5MHSE 3RUGF 5FHBL 3BO8B 5LBSL 4KC3B 3FO1B 1NGYB 2AK4B 3FZUD 4OM1L 3BH8A 3FQTB 5GRYA 3IJSB 1AQDB 1NMAH 3H0TB 4UAOC 3CX5J 3KPSB 1UM5H 4JPWL 4KKAC 1TZHB 1ZHNA 3SQOL 3N50A 2BERA 4LSDA 3NABH 1AGDA 5DZOA 3CSYB 5FYJL 2ADJB 3L7FB 4GAYA 3I3DA 2CKBL 2HTLC 3IDNB 4NGHH 4F8QA 2APFA 1BPVA 3L5JA 2VISA 2ICWJ 2WLYA 4HIEB 1CDJA 5EZJA 4ZUUA 4WCYH 3UCRA 5C0BE 4N68A 1RZKL 3MACH 5IVXF 1K5NA 1QHPA 1U8QA 4ZYKA 4MAUL 4GH7B 4V2CB 4EXKA 4RMQA 4LHUG 4JQIL 3BEVA 5EPMA 5IQ7L 2B7DT 5JW4Q 3GJFH 1S9WB 3BAEH 2FHFA 4P5KB 3EYVA 2CRIA 1DCLA 2HMID 5HHOD 4ZXBA 4KPHH 1MJUH 2HFEB 1S78D 4WWKD 3X3GL 2BDNL 4OF3A 2VZ1A 4HUVB 5E08H 2FJGA 5E6ID 2OR8A 1QVOB 2ORBH 2I24N 5DJAB 4KV5F 5C8JA 5FHBH 4R7NA 1HYRC 4LK4A 3MRQB 3O3EA 2EKJA 4PUBL 2OL3A 3EFFA 4U6VL 5GRJL 1MCWW 1YMMB 1DN0B 4HW6A 3T0ED 1FYTA 4XNQA 3VGAC 1K9TA 5CJXA 4TNWF 1B0RB 1T04B 4DN4H 3G5VA 2PYED 3UTQB 2RBLA 1L9MA 3SQOH 1XF2A 4IRJB 4P2RE 4NYLA 2RIKA 2JLLA 1EFXA 3V4VL 3BPOB 4Y0GA 3H9SA 5IJKC 5BVJA 2AXGB 4KKCC 2XWBA 1ZGLA 1HE7A 4EVNB 5T1KA 5EOCH 1PQZA 2B4CL 1RZKH 3REVB 3MOBL 4KI5E 4NC1C 5BZWA 1NL0H 2OP4L 1E4JA 3U48A 4F80A 4CVXB 4F2MA 1XF1A 2HWZL 3W82A 4JQIH 5GGSY 1WISA 2V7HB 4UB0H 1IAMA 5L88H 4QRRA 1UH2A 3WO4C 2BOCA 2V5MA 5ETUB 3SHSA 1U3YA 3RI5F 3D1MC 4BJLA 4YXHL 1QLFA 2WQ8A 1PY4A 1DQMH 1F90H 4HKBB 4TQEL 3WE6A 2VLJD 2ATKB 4G42B 5GRXG 3ZLQC 4PYHA 5EBMB 5C07E 5T1DL 1CN4A 2EE9A 3HUJA 4PP1C 1J7VR 2QQQA 4CNIA 4QLRA 5I19L 4Y1AE 4F58L 1N5YH 1DBBH 5HGGS 1IKNA 5FFLA 5EBLB 5LGKA 5IGXL 3LSOB 2DB8A 2H8PB 2K9UA 5EBWB 3SO3C 4JZJC 4LSRL 3X11B 3O81A 3B9KB 3QFJB 1JYVA 5E9DE 3ARRA 3QEQD 4ZPTB 3O6FC 5C9JA 4V1DE 2GITA 4YBHA 1S7WB 3G6JE 4JM4L 3TYGH 3CVIH 5CEZL 2ENSA 4Y16C 5DJXB 4WFGE 5F89A 1H0DA 4FQ2L 3MOBH 3SBWC 1I7TB 1KEGH 4X6CF 3SDDD 2P8LA 5DURD 2E8ZA 5E8PA 1OTUC 5JW5B 3RPIA 5J06A 2ITDA 1UH4A 1V3JA 1ORSA 3GIVA 4N0FA 4KK6C 5C08D 4L9LA 4FFVC 2WINA 1LE5B 3IS0X 1A1MA 1QFWI 5IB1B 3U2SB 3JVGA 3HRZA 4IS6B 1UM4H 5B39A 3MJ9A 4O4YL 3I3EA 3ZHLA 5CLWA 1D3CA 4TQEH 3U46A 5C0AB 2GTWA 1WZKA 2P48B 2DQGL 5T1DH 2PCPB 4TOYL 2IFGA 1QEWA 3STLA 4P3DB 1HNGA 4CMHC 3HMXL 1JV5B 1PKOA 3FO9B 5J13B 2NY4C 3EOAB 3IDJA 4JFHD 4XCYA 3OGCB 5L9DL 4Y5XB 4L9DA 4FFYL 4F7MA 4FXGA 3VXRD 5IGXH 1FIEA 3OB0H 4HCRL 2FECL 3QUMH 2ZUSA 1QSED 4LSRH 4ONFH 1OB1B 1OGAE 1LEGB 2RGSA 3VJ6B 1QG3A 1VACB 5FHAH 5HYEA 1MHEA 4U1JB 3QCVH 4HG4K 2BVOB 3SDAA 4R97B 4PRHD 2FHCA 3LQAL 4OT1L 1YDPA 3FN0L 5CEZH 3QIBC 5BXFA 4GRWB 2Y5TB 3WN5B 5DRXB 2YZ1A 3PP4H 3QDJD 3VWJA 2XOTA 3OKEA 1N26A 1VSCA 4JO2L 1OLLA 4O2EB 4HC1L 3ZHKA 3ZKSD 4WW1B 5IUSA 1ZT1B 4LCYA 4MQXD 1QPXA 3TJEL 2FRGP 5FYKH 3WJLC 5GISH 2A0LC 1NAKL 4PJDB 3BPLB 1WCQA 5DVKA 1R3KA 1EERB 2Q3ZA 1AO7E 1ZHLB 3QG6A 3X17A 1KCRH 2A73A 1U8JB 1CCZA 4CADA 3KLHD 5LVEA 4CW1B 1ED3B 4PG9B 5I74B 5DA0B 4H8WL 3RL1A 3DX8A 4R3SA 3HMXH 5K9JL 4JFQB 4IDJL 3V6ZA 1DTUA 2H26A 1YEGH 4WFHD 2EDHA 3MLRH 1C1EL 5JMOC 4P5TD 2ICES 4WO4B 4ODXA 4JRYE 4MQTB 3QUXA 1JZ4A 4OLUH 1NDGB 1ZMYA 3E6FB 3IAPA 3G5YA 5EUOE 2ZCKL 4GG6B 4M43L 3GRWL 1IZJA 1OQXA 3K0WA 2FH6A 4OI9A 3PXHA 1BQHG 1D6EB 1E6JL 3L7EA 4OT1H 4CN6A 3FN0H 5KVDL 3VFSB 5I2IB 1UM6L 1F4AA 3O6ML 4PD4K 5GGRB 1T89C 3PWLB 2Y72A 2FEEI 5I18L 4EN3C 1S9XB 4UT7L 1PKQB 2YZ8A 3ARGB 3N1PC 5DS8A 4HWEH 2VDPL 3KWWB 4RMWA 4U6TA 2XZCH 5IOPA 4NZTL 1RMFH 2I9LB 1P4BL 5HD8D 5IMMA 3MXVL 3UJIL 3TPUB 4U6XB 1CFQB 2PXYA 5A2KH 4JR9L 5EIIB 1JPST 1MQ8A 2UY6A 5K9JH 3TP4A 4N1CA 3L5HA 3MBEB 2Z91B 4L3EB 2DM3A 1TMCB 4GRLD 1I1CA 3TBYA 1C1EH 2PTVA 2OI9C 5GZOD 4NC0B 4MCZB 2A6IB 3C2AL 2JB6A 5F7WC 3L3OB 2IPKB 2C3WA 3CDFA 4GQ9L 1II4E 1R24A 1DQLL 5DJ0A 5JXAH 2EEAA 4XC1H 2ZJSL 3OJ2C 3BRFA 4JM2F 3GMOA 4M02A 1E6JH 1S5IH 4G3YH 3PV6A 3G9VA 5KVDH 1YEKL 3DJ9A 5I76A 1UM6H 4NQDB 1I7ZA 4QTIH 4GAGL 4WWID 4PJ8C 1ACYL 5EDXA 5DJ2A 5HDQL 5FA4B 1WBXA 4UT7H 4A6YL 4QWWD 3RTQC 3K8LA 4JN2A 4EZMA 4HWZA 4N9OB 4RRPA 2O5YL 3WHXA 1YQ2A 1QKZH 2HT2C 4OB5H 2ICEA 3CFJB 4NZTH 2W60B 1P4BH 5IMKA 3INUH 5SWSB 4HIHB 2YXMA 5BV7L 3C6SA 4JFDB 4CU8A 3V7MA 4P2QE 2IAMB 4AIZB 5JIKA 5IW3A 3L1OH 2LU4A 2HT4D 4ZO7A 4DUVA 3WO3B 3WFZA 4AL8H 1UJ3C 3OSKA 3MRLB 4MDJA 4XTRD 1F42A 5I1IL 4JFEE 4LDEB 2C7UA 4WUKH 3C2AH 4UV7L 5DRNB 4PB9H 2HFTA 1R3IL 4GQ9H 5I1HH 4P99A 4WU5B 1K4DB 4QNPE 5BW7A 4LFHD 1FV1A 1FG9C 3HR6A 3FT2B 3BUTA 2XG5A 4WEBH 3QIWA 2ZJSH 3HAEG 3IDMA 1J0JA 3WNNA 5C0CD 2C3XA 15C8H 3EO9L 1YEKH 1T03L 5IHZB 1OSZA 1MFEL 1OGTA 3FFCE 2NR6C 2OJEA 3DSFL 4GAGH 4MZ3A 5EB9A 4PLJD 5JUEH 4PJAE 3T08A 3MA7B 3JZ7A 4A6YH 4U1LA 5FF6A 3RX8A 1CLCA 3ROLA 1MI5E 3FFDA 4PJBF 4OLYL 4KK9C 5HI3D 2JF1A 1E28A 43C9B 3NIDE 2ICWI 1LQSR 1QA9B 3FMGH 3ZMRA 1FFNB 1I8LA 2XTLA 3VFNA 1ZHBB 3DRTB 3WIFB 2FSEB 4XNUL 2JJUA 1D6VL 3VRJA 3LQZA 5D7KE 2BNRE 4YHZH 3REWB 2ZUYA 1M1SA 4OM0L 4E41E 2XZZA 3ILQC 5D93B 4WRLA 3SGEI 4C56B 4LP5A 4M5ZL 3B4NA 1LO5A 3DARA 2CGRL 4NN5C 5D2NB 3FTGA 4ZXBC 2G75B 1MFBL 2XTJE 5KS9A 5I1IH 3NN8B 1VEMA 2YBRA 3ZDZF 5D1ZB 2DIBA 3DETD 1BF2A 1R3IH 2VXSL 5I0ZA 4HPOH 3SGKA 1AHWA 4MX7A 1WWWX 5JR1L 2BSRA 4JZNA 2A83A 1Z9MA 1NCDL 2AXFA 3EO9H 5IF0B 5HXMA 1EEZB 3LD8C 5CJXC 1YZZA 4Z7WA 5ERWA 3P4LA 2X9WA 3BW9B 4LPYA 3VFWA 3DSFH 1K2DB 1U8IA 5CZXC 3O4OB 1MLCA 1WWBX 4JY4A 2CDGB 4XPGL 4PJXF 1BD2E 3MRHA 2J88L 2I07B 4LOUC 4NQXA 1OAZH 2CMRL 3VXNB 4O00A 3BJLA 3ARFB 1YEDA 1X5YA 2FEDD 1H8NA 1GGIL 4LCCA 2JTDA 3TWCH 4PJGB 1ZAGA 5IROA 3DUHA 4XNUH 5ACMA 1VPOH 3VXTA 3BHBB 4H20L 4LLQB 3D39B 2JCCF 5J11B 4YFDB 1KIPB 3KGRA 4XXCA 3HN3A 5TDNA 4XT1C 3ULVE 1Q9LB 4Q0XH 1W0VB 3HR5A 1F6AA 3RIAK 2OS7A 3K81A 1MFBH 1ROWA 1IAOA 1KJ2A 1L7TH 4N8VG 2C26A 1K3IA 3N06B 2PW1B 1MUJB 5DDHB 2ZG3A 1SBBA 4R4FL 4JFOA 3N1QC 1MJ8H 5T33L 1NCDH 4NOFA 4HUMB 1IKNC 1NC2B 2JJWA 3EYFA 2QR0B 5DFVD 5ESVB 4UTBH 5SWQB 4I48A 5E00A 4W4OA 4BM7A 5F3HB 1RJLB 1WC7B 1YUHA 4XPGH 1LEIB 2J8UB 2QADC 1LK3L 4I2XA 2BNUB 1YQVL 2VKWA 4QXWA 2DRUA 1I9JL 1F4YH 3LKNB 3ULSA 1LNUB 5GGVL 3NCYS 3ES6A 4YBQD 3BGFC 4LPWA 4NQSB 3ZKMD 3QFDA 1TJIL 1Y0LA 5I16B 2BY1A 3MJ8A 4Z8FL 1G7MB 2AGJL 2OL3H 4XXDB 1B90A 3L5WB 1PZUB 5IB5A 1NBVL 2JJSA 4FG6D 1YNTA 3MV7B 2VH5L 1CL7H 4XCFL 4ZOCA 3KXFB 4LMQI 5KVFL 3BP5B 4F3FB 1FFPA 5C3LD 1EMTH 4KRPC 5IB2B 2OQJB 1RZFL 2D7NA 2FL5B 1KLUB 3JVGC 4K94C 2F8OA 2EDOA 4QRQB 3UAJD 3O8XC 1T0MB 5C0BA 2D7OA 2Z31B 4R4FH 3HNSH 2DLFH 3GBNH 3S37L 1XF3B 4X8JA 5BJTA 1QBAA 5T33H 2N7AA 1IGTA 3SDCA 4NHUB 3GGWB 1BEYL 2Z8WC 3QEHB 3WLBB 5IW1A 5MEOA 3QNXA 1BOYA 3CAFA 4NZRH 4GS7B 3KPOB 4ZUVA 1FAIL 1C16B 1M05B 5I1DB 1Z9LA 3QAZB 4K94L 3MJ9L 2PYEE 1BJMA 3H9ZA 1VADB 3RWDA 3SDAC 3FT4B 3TYFB 1ZVSA 3BUYA 3P0GB 1GGTA 5E1AA 2VDRH 1TJIH 4XI5C 5CGYD 4E42B 5KSUB 5TF0A 1WGOA 4KZEL 3VWJC 1MWAL 2WK2A 1T66C 3RGVD 1N7MH 1TJGL 4WUUD 3BKYL 4YHYB 2JK5A 2V17H 3VXMB 1RUKL 4XCFH 3UJJL 2KDGA 4P2RA 1KB5A 1Y18A 2EIZA 4LU5L 2ZKHH 4X99A 4BQ9A 2BCKB 4NQVA 5CJOL 1RZFH 4P46D 2DLHA 1I8IA 4I9WD 1U3HA 4MXQC 2OXGA 5GS1A 3QCUH 3IF1A 5I66B 4LVHB 1S9VB 3FQWB 3H7BB 3H7LA 3QXDB 3T3PE 1KPRB 4R26L 4YFLI 4PJEB 1Z0NA 1D5XB 3IDXH 3HZYB 3PWPB 1W8NA 1BBJB 2VSDA 2OR9L 3PHSA 3QUXC 3SDXE 1TVHB 3JV4B 4UIMA 2HRLA 1NCNA 3GJFB 3QO1B 4K94H 2VWEE 4NJAL 4N0YL 3MJ9H 5C07A 3ROOB 3I2CH 3TO2B 1K3ZA 3LKSA 4DAGL 4YX2H 4Y1AA 3MRGA 2OM5A 5C2UB 5CS7A 4KZEH 4M1CC 2QLVB 1P4LA 1TJGH 4YHLL 3WFHB 2RAMA 5D1XA 1WBZA 3DX9B 4RRPG 3CCHB 4RGNC 4QXGH 4AIXA 3UJJH 5E9DA 4P49A 3OX8B 4PTTB 1KJVB 3MRJA 4WTXA 4LU5H 4V1DA 5IB4A 3G6JA 5HGBB 2HKHL 4PGZA 2P5EB 2O5ZL 1T0PB 3B9VA 1RZJL 2NXYC 4ORGB 2XRAH 4PJHB 3DLQR 4JHAL 4Z0BL 3WJJA 2CLVB 5H35B 2YUVA 2CUMA 4G8FB 3UX9B 4NNYA 1D9KB 1OP5K 5LQBL 4ERSL 2CLRB 2PXYC 3TA3D 1IKFL 3PIQB 3SJVD 5BRZB 2KL6A 5F7LB 3RIFF 2X2YA 4R26H 5F7DB 5HGHB 4LKCB 4JGJA 5INCB 2A6KB 4BH7A 3NACH 4G7VH 2AV7A 5CBAB 2OR9H 4G8EB 5C0RL 2B5IC 3VXRE 5E8NB 2V2WA 1OL0A 4NJAH 1W2KT 1QSEE 3R0NA 4YDVA 4LLDA 2UUDK 2OYPA 1HHHB 4M61A 1DLHA 3U9UA 1BGXL 5D9SA 5D1QD 5F9WC 5I1JL 2KBGA 4PRHE 4J3UA 2APTA 1JUFB 5JQ6H 3DX7B 3QUYD 4YHLH 1OY3B 4U3HA 4ZO8A 1OGAA 4AMKH 3D85D 3ZKND 4LSPH 2AKRB 5JPMA 2A9ML 2VZUA 4BQCA 1DVFA 3MV9B 2HKHH 4OTXL 4FABL 4BUHA 4X6DF 4CN1A 2FX8L 4OFYD 5CAYB 3AXLB 4D0BA 3HI1A 4I3RL 2E7LA 5LQBH 5CEYB 1HEZB 4M62H 4MJ6A 3RHWK 5DMYA 2HN7B 4ZS6D 4OFPA 3ZE0F 3HB3C 1P4IH 4X6FB 4GW4A 2YEZA 1HHKB 1NGXA 3R06B 3VGAB 1ZLUK 3D2UD 3DVGA 1AO7A 4ZPVB 5INDA 2ZG2A 4WFHE 2EH8H 4Y4KC 1I1AA 5HYSB 5SX4H 4GXUM 1KXVC 5BW7C 4JEGB 2YPLB 4K07A 3QIWC 3PGCA 1IM9B 2NW3A 5MEND 5I8CB 3FHQA 3LKRA 1A14H 4ZS7L 1R5WA 3TM6A 3RVTC 2Q8BL 3UO1L 1BGXH 3UPCA 3E6HB 1BM3H 5AWNL 1JHLL 5J6GA 4X7FC 4UQ3B 4XCNA 1FQ9C 4GBXA 4ODUB 4I4WA 4XVTH 3CIQA 4JRYA 4QCIA 1BVZA 3C8KA 1MFDH 4WHTA 4J3SA 5EUOA 1IBGL 3IFOB 2Y5EA 4E0RA 3QUMB 3BGMB 1A9BB 4G6MH 3WO4B 1GPOL 2Q1EA 3PNWB 2FECI 2EICA 1I8LC 3GIZL 3WKMH 2FX8H 4KMTH 5C7XL 1F02I 1DUZB 1WZLA 3T0XA 5E95B 1U8PA 4I3RH 1FL5B 1JWUB 3BE1H 3WIIL 4DN3H 1E4KA 3SKOB 4D8PB 5D8JL 1UWXH 1CZ8L 4MMZC 4UOW1 3BP4A 1ZV5A 4X98B 4OV5B 3IAQA 5ICYB 3MGOB 3PP3H 1EGJA 2VR9A 1E6OL 4Z7VB 3SO3B 4JZJB 2H2SC 2DBLH 3LH2L 2AJ3B 2D31B 1BX2B 2XNAA 4DOHB 3BP6B 4XP1L 1AHWC 1C5CH 5F96L 5FECA 5L8JB 2F8VA 3O6FB 1BFTA 3O3BB 5E94A 5CJQL 4ZS7H 4CVZB 1Z9SA 4XX1E 3UO1H 3U7YH 4Y16B 1RZ8B 1HSAA 4YXLL 2BJML 1RUPL 4LSSL 4PTUA 4U33A 1WZMA 2XQBH 3SPVA 3KLAA 1KELL 1T1ZB 5IESH 4OZFA 2EDNA 1E4WH 5C09D 3S35H 4NQEB 2ZOLB 1JNLL 3KPPA 2YPVL 4WEUD 3Q1SL 1H3XA 3O6KL 3OKOA 3EOBA 1EJOL 1GPOH 1S7QB 4DZ8B 1J05A 4RISL 1CGWA 3DGCR 5AZ2L 4LCCC 1EO7A 1HH9B 5IROC 3QFJE 5IWLA 1HXMB 4LQFL 3WIIH 1FJ1B 2XWTA 1EHXA 4OI7A 5DD0L 4NZUL 2ZUWA 4CMHB 4GAFB 3VDCA 4XXCC 2NY4B 1UACL 1BZ7B 4RMUA 5F3BA 2YUWA 5HHXH 1E6OH 5C6WH 2HJKA 2IFFH 3AS0A 4HS3B 1R0AH 2E5EA 3S4SA 5DQJB 1DANU 4KK8C 1UYWH 4PPTA 4XP1H 1I8MB 1A1NA 3IDUA 4OZGE 1I8KA 3CPLA 3U82B 4P2QA 1MCDA 2XKNA 4UV4L 5EZIH 5DO2D 1RZ7L 1WFNA 4LEOA 5FYJD 3QIBB 1D7FA 2DQFA 3CXHK 1BWWA 2APXA 3ARQA 2BJMH 5BS0B 5IIEA 5C0CE 2W91A 5F1KC 1T1XB 1KELH 2IEPA 1VENA 4M7ZC 1LDSA 1G7PA 4W4OC 1R3HA 4JFEA 1REIA 4NP4L 5A2IH 5EN2B 5C0EA 2ZPKL 3VXUB 3M45A 2GJJA 4M1DL 3U7WH 1JNLH 4Z95L 1J8KA 4J23A 1YPZB 5I8OL 3GZKA 3KYMB 1T7ZA 4DFHA 3MO1B 3O6KH 1X6NA 4IBLT 1F2XK 2X4RA 4JRWA 1A6TA 1Z3GL 4IOFD 3NCJL 4OZIE 2F5BH 4MNGE 4FNLL 1N64H 3FFCA 3DI3B 2JJSC 1S9YA 3EO1A 3GMQA 4M5YL 3V6FA 3ARDD 4PJAA 2XV6B 4G6AC 1UACH 4OFIA 1ND0B 3GB7A 3FKUS 1MI5A 3C60B 4HKZB 3TBTB 4EEEA 2QSTA 2N4IA 3HZKB 5L6YL 5SWZD 2CXGA 5GGTL 2CK2A 1G7LA 2X4SB 3LOWA 4HBQA 5GS2H 1V7MH 3L9RA 5ISZD 3FB6B 4CVWA 4KFZC 1NPUA 1N0XL 4K7FB 1JGDB 4KZDL 5FEBA 2BNRA 4TVSa 3HZVB 4E41A 4QHNB 1KULA 3QPQD 1ZT4A 1RZ7H 4X4YA 3SDCC 4XBPA 3OB8A 4ENEC 2B20A 3G6DL 2M2DA 3O45B 3OKDB 4MA3B 4Z78B 4IHOA 4RGMC 4G80B 5JZ7D 1FNGB 2MQCA 2ZPKH 3V5KB 4EN3B 1KJ2H 1S7SB 3KPRD 5FCSH 4M1DH 1FZJB 4XB7A 3IAGC 4O02L 3H2WA 4Z95H 1QP1A 1GVIA 4ZFFB 4LAQL 4D0DB 2FB4L 5DK2A 4YAQB 4WJ5B 5DJDB 3BT2L 5AYUH 2Z35A 3UTPD 1J5OL 1SJHA 4NO0D 5D2LB 4GXVH 3BP7B 2K1MA 4XHQA 3GNMH 3D3VD 3ALPA 3MRDA 4YHKL 2Z9TA 4GG6E 1DQQB 4HKXB 4AM0B 1BD2A 4GKSA 5JW4N 3QRGL 3GSVA 3BWAA 3D69B 5FUCE 2HG5A 2CK0H 4PLKC 2OI9B 4WGVB 4AQOA 3L3HB 4MNHB 5KOMC 4EUPA 1UEMA 1U3HC 4A6YB 2GSGA 1JZ6A 5T3XL 5D5ME 5D71L 5GS1C 1HQRB 3O11B 4KI5C 4YK4C 4UBDC 5K9QI 1N0XH 3R1GH 4LPCA 4X0KB 3GBLA 2HT3C 3VMNA 4FQ1H 5D7JD 3G6DH 5DSCA 1D5BB 1PSKL 4PLOB 1H5BA 4JE4B 4HMEA 3DXAD 1BQHB 3O4LB 2EDXA 4CDHA 3B2UC 1QSFB 4ODHH 4PJ8B 4QRUA 5GS0C 1MCWM 4JB9H 2XA3A 3HUJF 3DUSA 2C5DC 3RTQB 4NT6A 4L5FH 1P1ZB 3WDJA 4G6JH 1CT8B 4EDWL 1RHHA 3NTCL 2DYPD 3FO2B 1NSNH 3EZ8A 4HIXH 2C1PB 3BT2H 1SYSA 3A6BL 2D9CA 3B3IB 5GSVA 2GSIB 5T5FL 1QZ1A 5AAMA 4I0PA 1PD6A 3GSQB 3DVNB 4TVPL 4NQCD 3HNVH 5D1XC 4YHKH 5H94A 2D3VA 2YD9A