1IGCH

Igg1 fab fragment (mopc21) complex with domain iii of protein g from streptococcus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
222
structure length
222
Chain Sequence
b'DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTLHYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTGMYYCARWGNYPYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA MOPC21 FAB (LIGHT CHAIN)
publication title The third IgG-binding domain from streptococcal protein G. An analysis by X-ray crystallography of the structure alone and in a complex with Fab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (antibody/binding protein)
total genus 38
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1994-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igcH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igcH01
1CD1A 1IAIM 1N7ML 4NM8H 1DVFA 1SHMA 1I1CA 1VPOH 1J1OL 1FVCB 4GS7B 5IMKA 4YFDB 5DJXB 4W70A 1G7MA 3BEVB 1OSZB 2OR9L 1HK6A 1UCTA 3GBML 1F4HA 1FFOB 1A7RL 2Z35B 2AJ3B 4JQXC 4I18A 1UCBH 5D8JH 4K71C 1JGLL 1ZT1B 3AAZB 3F7YA 3C6LB 3BYTA 4PS4L 4ZFGH 2B2XH 5DK3A 4LHQB 4CMMB 1GVIA 4XAWL 1RZ7H 1TZIA 2WWKT 3AXLA 4C56D 1SEQH 4R97C 5L8LB 1VACA 3GGWA 4U1NA 1RZKL 2ZNWA 3DECA 2WINB 4QTHB 3CXDH 4CN6A 1MQKH 5I1LB 3SGKA 2VDLH 3I6KA 4OZFA 4HEME 4RGNE 3OKLB 3H42L 1RAMA 3HRZB 4OT1L 3G6AA 4CBPA 2EH8L 3LD8C 1N5YL 2CUHA 1RMFL 2X4NB 2DN7A 4PRPE 2Z31B 2H6PB 1Z9SA 3IB4A 4LRNL 2JTDA 4I2XB 4DVRH 4ENED 5J12B 3GHEH 1VFBA 3RFZC 3ARVA 2MQCA 4OF7A 5D1QB 5CP7B 1NPUA 2QADC 3ULUF 2O5ZL 5TQ0L 3TA3C 2VLKD 1HE7A 5T33H 2BVTA 2BNRA 4WWKD 3ZSSA 3QCVL 1X7QB 3B5GA 1YJDC 1OAZH 2PW2A 1FGNL 5BRZE 1C16A 5D7SH 3MJ9A 3HFMH 3WIIH 3B3IA 1KSRA 1UM6H 4HWUA 2WQRA 4IM8A 2R0ZL 4BFGA 1FIGH 2X5PA 4CUCA 2BOCA 2AV1B 1HSAA 4KJYB 4K9EC 5I15L 3T0BA 4YHNB 5E2UL 2IPKA 5EZLB 1XR8A 5AZ2L 3V0VB 3MBXL 5DT1L 3DROA 1BJ8A 3D39A 2VSCA 4LCIH 4WUUB 1NMBH 3DXAD 4IEFB 5CSZB 4BA8A 5DMKA 4HH8A 1DBAL 4YDIH 3BE1H 3RL1B 2W9DL 1UB5A 5AAMA 4LHUA 1MCOL 4J3VA 3S35X 4E41B 3RRQA 2HKHH 3KPRA 1X4ZA 3LEYH 4JFFB 4M7LT 2B1AH 1HWGB 3LKPA 3ZKMC 4X80H 1QQDA 2BJMH 1NGZA 5C71A 5I1IH 1F6FB 2EYTB 5I1GH 2BRRH 5BQ7B 1U3HD 1QSZA 4HWEL 1UA6H 1VFOA 1S8DB 1U58A 2EDFA 4I9WE 2R69H 3GJFA 5IOPA 1YPZE 4FZ8H 3UJTH 25C8L 4I48A 4EZMA 1E4KC 2ZG3A 4M1GH 1I3RB 3IS1X 5TDNA 3DHMA 3PGDB 2VZ1A 1UWEL 4S1DC 3WEXB 5LKNA 4DGIH 2VAAA 5F1NB 4Z0BL 5HHQB 5HYEA 1YEFL 4HK3N 3OKNB 3FN0H 4GRWF 2D3VA 4PJXE 5BZWB 5FYKL 4HDIA 5IFJA 3DGGB 4EI5D 5LG1A 1J1XL 1MCWW 4XNYL 35C8L 4NKIL 3U48A 5CIPB 1KLFA 2VDRL 1ND0A 4V1DA 1FQ9C 3WS3B 1KLGA 2A73A 1K6QH 5FYLE 3N1QC 3V52H 4X4ME 1LEIA 1VKXA 4X6FA 3EYOB 3AU1A 3TZVB 5LCVH 1TTFA 5DRZB 1YMHB 3O6FD 4G9FD 1IAIL 3C60D 4C56B 4N9GA 1NCBL 1EEYA 2DIAA 4B41A 3LRHA 5JZ7D 5DDHB 4G8FB 5ADOL 3QFDB 4PJIE 3EJYD 4CU8A 3QUKA 5EUOE 1KCRH 4PJ9C 4IOFD 3VXMA 3WV0A 1LQSR 1SY6H 2BNQE 4PRAA 3DRQB 1UJ3C 2YD1A 4DEPB 4KKCC 4CW1B 5I8EB 2X9YA 1D6VH 2R2CA 3HMXH 2NR6C 4WTZG 1GZPB 1RFDH 1XCTB 3SQOL 1HILA 1XF3B 1DN0A 2P7TB 3U4EA 4LVEA 3P9MA 1INQB 4OQ1A 4LF3B 4NC1E 1FL6A 3V5DB 1KPVA 3U46B 3I50L 2HFTA 5GRZA 1JHLL 3HI6L 3DV6B 1CFTB 1QSED 3CH1A 4N8CH 4J8RB 5I0ZA 4P46B 3ROOA 3ULVH 2VITA 1YEKH 2MKWA 2I26N 5E03A 1U92B 1UKQA 5JPMA 5DQDH 3ARFB 1JPSH 3UYOD 1KN2L 4PLNC 4DN3H 3DXAB 1JFQL 3IS0X 3ARPA 5FO7A 1L7TL 3BJLA 4JRYE 4X5LA 1CU4H 3WO4B 3RZCB 5CD5C 1KBGL 3VI3E 3WN5C 1FNSL 1KTDA 2XN9D 4G3YH 3QDMD 1NC2D 4HBCH 5E08H 2GAZA 1A9EA 2MKLC 2ZKHL 5FA3B 2FX8L 4NQXA 5I66B 1TZHB 3DVFA 3EDFA 4W4OA 5E8PA 1T1YA 1U3HB 2VLJA 4NM8L 1QA9B 1VPOL 4PRHD 3VFPA 2FGWL 5JLZB 3F7VB 5HDQH 4RMQA 3KAAA 3MLPA 4O5LL 4XNXH 4N9OB 3VXRB 4AH2A 4FG6D 3H9SE 3PQYE 4LRIA 1NGYA 1WTGT 3AFLA 4MSWB 5D8JL 1KIRB 3RGVD 1ZE3C 1FL3B 4NZDA 1NBQA 4P4KD 2FJHA 4ZOEA 5B4MC 5ISZD 2B2XL 2IMNA 1HHHB 3BGFC 1O7VA 4JZOA 5LJYH 4BSWA 5I9QB 1SEQL 4PPTA 2CLVB 5HHNB 1XGTA 3H0TA 3CXDL 4Y4FA 1MQKL 4HK3J 3ZYJA 4OCWH 4BZ1H 3SDDD 3OXSB 2VDLL 3MXVH 1R3IH 3D3VD 4XCYA 3O6FB 4G9FB 1I7UB 1AY1H 3C60B 3VFNB 5GGRB 2XXMB 4KVNL 1M7XA 4OCXH 2X9XA 4XGZB 4ZUWB 2Z9TA 4F7MA 4MAUH 4MNGB 1N2RA 3QP3A 3QUXA 2V2XA 3FQXB 1OP3K 4OF6A 7FABL 3X17A 3EGSA 5DD6B 5F89A 1M1SA 3E1F1 5HY9B 2DIJA 1P7KB 3ZDZE 5LGJA 1OAZL 4G8IA 2Q86B 1ERNA 1OTTD 1YEEL 5D7SL 4NCDA 3HFML 5K9KA 1UWXK 1QFOA 1WBXB 5CJBA 3HKFA 1MJUL 1FIGL 5C0FA 2EIEA 4Z76B 1EBPA 5F6HJ 4H88L 3QG7H 1S9KC 1DZBA 3IJHA 5M7QA 3IDUA 3L9RB 1LO2L 3W0WA 1ADQH 2AJYH 2DDQH 1GCFA 5GRWA 2P42B 1HWHB 2ZOLA 4LCIL 5F9OH 5D93C 4JAMB 4XZUB 5BVJB 2R2HA 5AYUH 4APQA 1LP9E 5DYOB 5DQJB 5K9OB 5IIEB 3LEYL 1WWBX 3G6JA 4G8GD 4OAWB 1NEZA 1T1XA 3RHWK 3L5IA 5F88A 5I1IL 5I1GL 2BRRL 2WBJD 3RWIA 1UA6L 4YE4H 5C0GA 4U1KA 1NQBA 3O45B 3P9WB 1AO7A 3QDMB 1DVFD 2R69L 3BPCA 3AS0A 3VGHA 4FZ8L 3HPLB 3CPLA 5EB9A 4FMKA 4JKKA 2HJFB 2W65A 3PL6D 4OV6F 4JPKL 1IGFH 4ZPTB 3U36B 1LO3H 4JG0H 2WV3A 4PRHB 1DL7L 5DRXB 5J8OA 4LASL 4DGIL 5E8NB 1DCLA 3FN0L 4R3SA 3WD5H 3SDAD 1ROWA 3C8KB 4XWGL 1MHPL 4MZ2A 3ECBB 2WSKA 1XEDA 4KK5C 2DJ4A 3IDYC 3NPSB 4X6DA 3CLEL 4N5ED 3T0EE 5CJXA 2OK0H 5I1EL 1AXTL 3MLVL 4P4KB 1U91B 3ZTNH 2VQTA 1JI1A 3V52L 1JBJA 3CGTA 3OKDB 3S34H 3CAFA 1K8IA 3MYJB 1JPFA 5C07E 4AM0B 3RVTD 1XT5A 4A6YH 5LCVL 1LE5A 5L2JB 1CT8A 3CX2A 4ZNEA 3T4YA 2XIDA 4IRJA 3AGVA 5KSAA 1ITBB 1CLZH 4P2QA 3QFJA 1SJHB 5ACZB 1JNLH 1D5IL 3SDDB 4DAGH 4NPYB 4F7CB 3D3VB 1RZGA 4JFDA 1KCRL 1HQ4B 5DEFA 3BW9A 3OX8A 1V3MA 5C6TH 4LCUA 4ODTL 5KVMC 4RAVB 1KENH 3MV8A 4IS6A 1I1FA 1GAFL 1D6VL 3HMXL 1HEZB 3RUGA 1A4JB 1MJ7H 3ZHKA 3BDYL 2KKQA 1IEAA 1SBBA 1KEMH 4LLQA 4NKOA 5D1ZC 2BNRD 1DLHB 4GAFB 4PJCE 3PIQA 1KCLA 1XGPA 1BX2A 1Q38A 5MEOB 1FORH 4EBQH 1P6AB 3FJTA 4J3UA 3MA7B 4M7JH 2VLME 2I9TB 4C59B 5E24E 3RA7L 1IAKB 1PG7H 5JDSB 4YHPB 3K74B 3X13A 4WJ5A 2QR0B 4GUPB 1JZ4A 3C08L 1IGJB 4GRWB 3VA2C 4N8CL 3IAGC 5DJ8A 4JM2F 2RHEA 4N68A 5JHLH 3D39D 4JY5H 2NW2B 2PCPA 3KNBB 4PLJC 3VXSB 2VQ1B 4O2CB 5LGHL 4QNPE 1WBZB 3LQAC 4CNIA 4Y1AA 1S7RB 5T1KD 2W0FB 4YUEH 4DN3L 4MMXC 5D2LE 4XXCA 3BD5A 1A3QA 4QHMA 4Y2DC 4EQ2A 5CGYC 5L0QC 2PF6A 1CU4L 5CD3B 3V5KA 5A16A 1ACZA 4G3YL 3GHBH 4ZS6C 3HC0A 1U8JB 1HOCA 4MCYA 3PNWA 4FQHB 5C86A 2FWOB 1FZOA 2DM7A 2K7QA 4B0MM 1R24B 4NUJB 1JYXA 4MHHI 4PY8I 5HDQL 3RY4A 1T22A 4JKPL 5C0AA 4NCC2 1CTOA 1LNUB 3VFOA 5A1AA 4XNXL 4XWOC 5SV3A 4OQTA 1BZ7A 3PE9A 5DJXA 4QTIL 3BEVA 4B7LA 4BQBA 3REWB 4NZRH 4JY6A 4KJWC 2JJSC 4V1DD 2NY0B 5HHOD 3TIDB 5T3ZH 2Q8BH 4AENB 3TBSB 3AAZA 2AQ1A 3C6LA 2A77L 4HCRH 4GLRH 2F8XC 4KTDH 3MREA 1FSKC 5F6IB 3RIAK 1X5YA 3V6OA 5FO8A 3HPJB 4CMMA 4BZ1L 5I30L 1I1AA 5IJVB 1R3IL 4M1CC 3DMMC 5DJ6A 5F7MC 3BGMB 4IRSD 4P5TA 1DQDH 4YEEA 4PJAF 4LAQH 3VXMD 1FN4A 4G8EA 1UVQB 3QEHB 3QNXB 3UJIL 1KJ2L 5CP3A 4Q6YA 4KPHL 1BF8A 4M6OH 4XC3L 1GGCL 4MAUL 1I4FB 1CGSH 4X9IA 3N85H 3RDTC 5IROC 1B0GB 2H6PA 4NQEB 3TPKA 1FLRH 3TWCL 3I02B 2G5BB 4OF5A 3HE6B 1BQLL 4YEFA 2GSGB 4YR6A 4I2XA 1TJHH 3QDJE 4HMEA 5C0BB 5C0DA 4O02H 3RTQC 2H3NA 5D1QA 5CP7A 4AEFA 3RL2B 2DQUH 4X4YA 4X8JB 1OW0A 2IANE 1F4YH 5BS0A 1N6QH 2V5MA 3IJYB 3CFKA 2OM5A 2PTTB 1QLFA 5FYJU 4XCEA 1CQKA 1H3GA 1ADQL 2AJYL 3UYRH 4NM4H 4RMRA 1TJIH 4KAQL 3VGAB 3S36X 4XNZC 5MEQA 1MRCH 1U8IB 5AYUL 1TETL 2DQCL 3QEQE 3S96B 3A67H 5I74B 4WUUA 5IB5B 5T1KB 1N0LA 3QUYC 2ZCKL 1AD0B 3IETB 3QH3B 2GJ6E 2Y6SC 4FQ2H 3E2HC 1TVHB 5KVGL 2B5IC 1ZGLM 2ITCA 1A6VH 3TJEL 4AMKH 1L7IH 4JFFA 1TQBB 4XPGH 4HWZA 1HH9B 3BAEH 2EYTA 2CR6A 4KI1A 1IGFL 4JG0L 1S8DA 4KJPC 5DRNB 2OP4L 5GS3A 2N4IA 1R5VB 3BPNC 3SE8H 3MRHB 4LKCB 3RVXD 5B8CB 2NZIA 3WD5L 4LSUH 1B0RA 3JTSA 2H32B 1X4YA 4UIMB 1RUMH 5CWSB 4R6UA 4HW6A 3WEXA 5F1NA 1MWAA 1MI5D 3BP4B 4PTUA 5JNYB 2UUDH 4LLUB 1V7NH 3FRUB 4JM2D 5BZWA 1FO0L 1S9VA 1ONQB 3DGGA 1P4LB 3PXJA 1AKJD 4WO4B 4A6YL 4PRPA 3MRDA 1EEZA 5TF0A 4UT9L 5FHAL 1KJVB 2CPCA 1I85A 3WS3A 4Y16C 5M95B 1K4CA 1CLZL 1NBYB 1A9BB 3L3JA 4JDTH 4P49A 1QSFA 3TZVA 4IMLA 3VGBA 4OB5H 4P2OA 1C5DA 1CE6A 3MYZA 4QT5B 1AFVH 5HGDB 3OJVC 1BBDL 5C6TL 2Z92A 2JCCE 1MIMH 1B3JA 2NXZD 5DDHA 4Z7UF 5J13C 1J0JA 1KENL 4X9BA 4G8FA 3SGEI 1ORSB 1QFUH 3QFDA 1CQYA 1A6WL 3OJDB 3RIFF 5L88L 3GMOB 1I75A 1REIA 3MMEA 4ONHB 3TO4B 4MS8C 4MA1C 1EMTL 4P59L 5BRZA 3TVMB 5EUKA 2AJSH 2N7BA 3IFNH 2E7HA 1EEUA 2NY2C 5F1KC 5K33A 1IC5H 4QHLB 5E0QA 5E00B 3FB5B 1FORL 3UBXG 3JTTA 1FNHA 3MBEB 5JOFA 1GZPA 5A43C 3O9WC 1GC1L 1FE8H 3OG6B 1XCTA 4QLRA 1NCAH 4GH7B 3DTXB 1EUTA 1PG7L 4UV4H 5FM5O 2F58H 3RVVC 4PJEB 5HGHA 2J88H 1QBLH 1MCRA 1BIIA 5HPOA 1INQA 4PJHE 4LF3A 3HAEH 5JHLL 4JY5L 1GGBH 1NAKH 3V5DA 3FFCE 2A9NH 1NCNA 3BP6A 1CFTA 2ZJSH 3G6DH 4J8RA 2QBWA 2AKRB 1AC0A 4P46A 2FBOJ 3WUZA 1X5GA 4Q9QL 1D5MB 1FNFA 3OB8A 5D70H 1R5WB 3ARFA 5D7IF 4QXUH 3RNQA 3MRQA 2EDJA 3GHBL 4LLDB 1JGVL 3EO9L 3OKYA 5IESH 1ZA3A 3D1MC 4KFZC 1DP0A 4NZUH 3RZCA 1TQCB 3C8HA 2NTFB 4L3CB 3BKMH 2X4SA 3KLHC 4E5XA 4Q6IB 4KDTC 4QHNB 4TVPD 4YDLB 4JO3L 4PJXA 1BF2A 5FA3A 4NFCA 4FNLH 4KHTH 3SDXE 4FP8H 3LEVL 3AMLA 1ZHBB 3KHQA 5JLZA 5GHWH 1ZLVH 1FYHB 1QP1A 4X4MA 3MV9B 4Z7QF 4U6HB 3VXRA 3O6KH 3WE6A 5FF6B 1Q8MA 4N0UB 3NVQA 2EZ0C 4BSVB 4C55A 3CH8A 1S9WA 2VRAA 3Q6FB 4OFYD 2Q8BL 4HXBL 5T3ZL 5IMMA 1KIRA 1YQ2A 3UTPD 3C9NA 1MI5B 1VEOA 4PJIA 4HCRL 4NNXA 4JM2B 2R4RL 1FC1A 5EUOA 2BNQA 1FNGB 1NAMA 1C08B 2CLVA 4YGAB 2GSIA 5HHNA 5MERA 1DQDL 1DSFL 2FECI 4KY1L 4K3JH 4LAQL 2XQYG 3NABH 2Y5EA 1QNZL 4LPUA 1K2DA 3MV8D 4Y4KB 1PEZA 1RZJL 4M6OL 3VFNA 4PJ8A 5ABDE 3OPZH 2R1XB 5GGRA 2AP2A 1CGSL 4Y5VC 1CFNA 1BFOA 3LS5L 3N85L 2BOBA 5MHSE 2AXGB 1FGVH 2NZ9D 4XGZA 4TSBH 3CFIC 5ESAA 4ZXBA 5F9JA 1NEUA 3B9KB 4PJ5E 4M8QA 4OZIF 4URTB 5GGSA 5GS1C 4O02L 2DI9A 5CJ5A 2QKIB 2ESVA 4X98A 3FQXA 2X89A 5CEYB 2C5DC 2ARJA 1LDSA 1D9KA 1S7XB 1S7SA 1YDPA 3BH8B 1P7KA 1F4YL 1N6QL 3MLXH 2BSRB 2Q86A 3D9AH 5CHNB 4Z7VF 4BH7A 4FXLA 4QRRB 4DKAA 3PWLB 1KYOK 1MY7A 3RX5A 5KVFH 1J0YA 3C8DA 3ZKNC 1WBXA 1TJIL 2XKNA 4U1JA 4KI5F 3VWJC 4ZNCD 2YKLL 5EDXA 3MLSL 1UXWA 1WWCA 3MGOB 4WUKH 3A67L 4NKDA 1DBMH 1MAJA 1J8HD 2FL5B 5EOTB 2Q8AH 1SJXA 3DX7B 4LPTA 5ALBL 4ODSH 2AERT 3VDAA 4KK9D 3AY4A 3HI1B 4FQ2L 5DYOA 5DQJA 3JWOC 4AMKL 1YYLL 4PJAB 2AJXL 3MNVA 4XPGL 1WBYA 3VRLE 4OAWA 3BAEL 5F7NC 2CUIA 1ULVA 1WV7T 2HRLA 5FUCE 5C0JB 3QQ4B 1F2XK 3B5HA 4CDHA 5KTEH 2EDYA 3BI9X 2NY5L 3ULVE 3ZE2F 4FZEH 1CS6A 4HMCA 4G42B 3HPLA 4WI3A 3NAAH 4G6ML 4HIEA 3SE8L 5I75C 2J8UE 3UBXB 1PAMA 3E0GA 1MCNA 4YHLH 3E6FB 4LSUL 1Z9MA 4WTZA 4ZPTA 3UZQA 2HG5A 3OXRA 3QIWD 1GOFA 4NRZB 5SV4A 1QBML 5DRXA 4IIQC 1BJ1J 5KSVA 2YXFA 1QYGH 2Z31C 1U8HA 4X6CF 2HT3C 4ETQB 2FGZA 15C8H 1OGAE 3TM6A 1LO4L 3MODL 3ECBA 2R23B 1GPOH 5J12C 3WHXA 1I1AD 4KWUA 4MNHB 5MENE 1WZ1H 1U91A 4P5TD 4AY0A 1OAXL 4F9LA 3MYJA 4ERSH 2IGFH 1R0AH 1SVCP 1T1WA 4M7LH 5L2JA 2J7LA 3OV6A 1AFVL 3T3PE 1CFVL 1WICA 4J12A 2P8LB 3VXTB 1FFQA 1T3FB 4HUVB 1SJHA 1P84K 3IAPA 3RNKA 4HIIA 1HQ4A 4Q9RL 2WQ8A 3L3OB 3P2TA 4GQ9H 4KJQD 8FABB 4N8VG 2VLRE 4ZO9A 5EA0L 5IB3A 3LIZH 5DS8B 2HTLC 2VC2L 1CLCA 1A4JA 3H6JA 1IKFH 3T04D 1BFVH 4PD4J 1DLHA 1FE8L 2GJJA 3MNWB 2XA8H 4HPYH 2F58L 2FEEI 1MSPA 5FV2A 4Q9CA 2J88L 4JJHA 2I25N 2P5WB 4WGWB 1QBLL 3C5SB 4QRUB 4ZFOL 4HS3B 2BMKA 2VE6A 4NQCE 1IAKA 3L3KA 1MFEL 5JDSA 4YHPA 3FTGA 2QR0A 5D96C 1N5AB 2ZJSL 4LLWB 3QDGB 4XPAL 2DQTH 3EFFB 1NCWH 4D3CH 3PGFH 1B6DA 2BVOB 4CVUA 1PZ5B 1A22B 4H8WH 3VXSA 5I8CB 2VQ1A 4GW1A 4HUWB 3KPSB 4QXUL 4P48A 3OKKB 4EDWH 2Q76A 4M8VA 5EIVA 2JKXA 2X4RB 4F58H 3SE9L 3S97C 5IESL 5JXAH 4TSAH 1TMCB 4FOMA 2EE3A 4NZUL 3WKNA 5BO1L 3G5YB 1Q94A 2AXFA 2E9IA 3BKML 3HC4L 2XI9A 4MXWH 1EHNA 4JFZL 4Z7UB 2EDEA 3T09A 2FWOA 4FNLL 4PJGF 3GMQB 4FP8L 2XWJB 4RFEB 3MLZL 3S35H 3TCLB 5DJZA 2DM4A 3NTCL 2PXYB 5GHWL 2CLRA 2AJVL 1BZ9B 2ERJC 4C4KO 4PR5B 5C07A 5JHDE 3KS0H 2OTUB 4U1IB 1HHIB 2P4AB 4RGND 5CZXD 2IPUG 4AIXA 4PJFE 3IFLH 1TXKA 3OJ2C 3V4VH 5EU7C 3K4ZA 3M8OH 1IC1A 2KBGA 1P69B 5SWZA 3MR9A 4WW2A 4ORGA 3VDCA 3U6RA 4ENEC 3BMWA 2XTJB 3W39B 3EIFA 3U0TB 4AENA 5C0CB 1QRNE 5CAYB 3L1OL 3ISWA 1ZS8B 4JDZB 3BP5B 1R3JB 1XR9A 4NHCH 1FHGA 3U7AA 4RRPG 2AJUH 4PJCA 4WWKC 5CJQH 5IKCB 4Z9KB 2WMPA 3DPBA 5D7IB 1WWAX 3OPZL 4P5KB 3MUY1 5BRZD 1NMAL 1F6LL 1UVQA 5JR1L 3GFUA 3OF6A 5I8KL 3G04A 1UH4A 1J87A 1FG2B 1KJ2B 4DQOH 4NFBA 1I4FA 4PIRF 4LVNB 2QQNL 4NQEA 4YHYB 3I02A 1J5OH 1J0IA 5EFIA 3HE6A 2JK5A 3KPMA 4XP1H 4I3RH 4MX7B 3VWKB 2NY4D 3MLRH 4OBRA 4WIQA 4GXUM 1LWRA 3MLXL 3D9AL 4MNQE 3B9AA 2QQLL 3IJSB 5D2LA 4X8JA 5GS0L 5FDYA 5KVFL 1F3JA 5TDPB 1J1PH 4UILL 2Y36L 1JIBA 2NY1D 3IJYA 2AJZB 2PTTA 1U3HC 4EQ3A 3MZTA 1UM5H 1AR1C 4I9WD 4WUKL 4NDMB 3PWUA 4UOW1 1DBML 1U8QB 5JW4Q 3FHQA 4WU5A 2OJEB 3EJZD 3S96A 1QHOA 3QJFB 2VSDA 4JFPB 1JCKA 3OSKA 3L5WA 4P2CG 1KCVH 3LRSA 3IETA 1AD0A 1N4XL 3W5MA 3T2NH 5JW5B 1UWGH 3JZ7A 4NUGL 5DLMH 1TVHA 4EI5C 5KTEL 2BDNH 1MHCA 4JPVL 1QZ1A 2C4XA 4N8VB 4XNUH 2AEIT 1HH9A 3V4UL 4N0RA 3KJ4C 5FYLD 1D5ZB 4YHLL 4OZIB 1BAFL 2BY1A 2JJTC 2VDPH 2D7PA 1AQKH 3O6FC 5DRNA 2E27H 4HGWB 3C60C 5ECJE 1S7TB 1M05B 3DUSA 4LKCA 3P40A 2KQNA 3CCHB 2C3VA 5B8CA 5JZ7C 1AGDA 3H2WA 4GRLA 1TCRA 15C8L 4Z7VB 1X6LA 3EJYC 4LLMB 5CWSA 1GPOL 2EDOA 3GIVB 7CGTA 4IOFC 3SKJH 2BNQD 3BP4A 3T2QA 3G08A 5FAAA 1LMKA 2AEPL 4AL8H 1ONQA 1P4LA 3ZYZA 4ERSL 1R0AL 4U0QB 1FO0B 5A2IH 1W72H 3I3BA 5MI0B 2OJZH 2MSPA 4NWUH 4PREA 4BH8B 3O3DB 4ZO7A 4F2MB 4P0DA 4MLIA 2PYFB 5K9JH 3T4AA 5ETUA 4NRXB 4PJ8D 5F7HA 1A9BA 1DBJH 3MTRA 5HGDA 3BHBA 2F9BT 1A1NA 4RX4D 1ORSA 3GMRB 5I8OL 3LIZL 4HKZB 4L1HA 5F97E 1QKZL 4AQ1B 3OKMB 4ONHA 1IKFL 2GY7B 1T0PB 3TVMA 3DV4B 4I3GA 1Z5LB 3HLAA 5SWSE 3S6CA 4TYUA 5EBWA 2VN7A 4O9HL 4QHLA 1A1OA 3PV6B 1RZFH 1EO8H 3MBEA 1JHKH 1KPRB 3IDGA 2PO6D 1WJ3A 4JRYD 4HV8B 3DTXA 2NPLX 1J11A 4WHCA 1F11B 4WV1C 5IVZA 4OJFL 3KLAA 3SN6N 4XPBL 5TGBA 5KW9H 5HI4D 4X4XB 2GJ6A 4KU1A 4X6CB 4LOUD 5F3BB 1NCWL 1PQZB 3S37X 4M1DH 4MB3A 1AGCB 3B5TA 5DC9B 4JRXE 1PEWA 3DHJA 2AKRA 1JZ2A 2CSPA 3DJ9A 4F58L 3FT3B 3EYQD 4TSAL 1D5MA 3H9SD 4FG6C 4L8CB 3FN9A 2VIRB 1R5WA 3PQYD 3VFMB 5J6HA 4UT6H 2G9HA 4M48H 3VXNB 1RJZB 5T1LD 3RGVC 3ROLB 4OIAA 4P4KC 5TE6L 3NCYP 2AEWA 2AK4E 5EG6C 5HYIA 4YZFE 1AGEB 1BWWA 4Q6IA 4KUCF 3SOBH 1CBVH 4QRTA 5DEZA 4JG1H 2ZG1A 1JYWA 3WDIA 4OKDA 4R4FH 5E6IA 5L9DL 1PY9A 1IARB 3SDDC 3WFDH 1ZHBA 3P73B 3K8MA 1DEEB 3O2WH 1A0QH 1GRWA 3FAXA 3MV9A 4R4ND 3MROB 1YJDL 1HH6B 1JWMB 2W0LA 3MLTA 1RURL 5FF6A 5FFLA 5FM4A 3U7WH 5EO0B 1IQWH 1IZJA 3NIFE 4BSVA 2DB8A 4M4RA 4RQQA 3Q6FA 2JCCA 2DBLH 4XP4L 1BGXH 4WENB 1ZGLB 2GW5A 3QNYA 2P1YA 1L6XA 1XF4A 4K9EL 4P9HC 4NHCL 4QXGH 1J0ZA 3TNMB 2H9GA 3BKJL 4XNMA 1C08A 5CJQL 4EUPG 3GSNB 4OLXH 1OTTC 3VU2A 5FOBB 2X4UB 3HZVB 4K3DL 2GY5A 2IC2A 5D7JB 5T5NF 5DJAB 4NT6B 2IAMB 3DO3A 2IH1A 4Y4KA 1BREA 4NO0B 5IJKA 1DUYB 5I18L 4DQOL 1N8ZB 3LCYA 5ENWB 3OKOB 2E6QA 4JDVB 3LN4B 1JJUA 3QXWA 4PJHA 1R3LB 3RKDD 3HB3D 4PJGB 1SYVB 2HJKB 2VDQL 3MLRL 4ISVB 3TIEA 3VFGH 4FQLH 2I24N 2HRPH 3QXVA 4CVZB 4UNVA 2QKIA 1QPPA 43CAB 4YDKH 4F57L 4ZUUB 1XF5B 1KUMA 1ZLWH 3RGHA 1U8LA 4OIBA 5C2BH 1MPAH 2KL6A 4JHAH 1T04B 5HVHC 3SJVB 1WT5C 3BRFA 4QRRA 2WBJC 5DWUH 2JB5H 4HUXB 1WITA 2X1WL 2YA0A 4JB9H 4TPRH 5LGKA 3FMGH 1DVFC 1EZVY 5JIHA 5ITFB 3P3YA 4RNRB 5ITBH 2W9EL 1J10A 1YNLL 5C0IA 5DD3H 4Y0GA 1OF2A 3PL6C 1EAPB 2VL4A 4CVWA 3MGOA 2FCBA 4Y5XB 4YH6A 5EOTA 1QO3A 3CDGB 1KCVL 1JWSB 4S1QH 5CJ8A 5FHBH 5F1IB 2QV2A 3PWNB 3T2NL 3SDAC 5ELIA 3H9SB 3HI1A 4CMHC 5DLML 2EDBA 2BDNL 1AGFB 4PJAA 1FBIH 3EZ8A 3T0ED 4XNUL 4G6AD 1UXSA 2R56L 4N5EC 1IGCL 3UROR 2ATKA 5DHVB 5C0JA 3QQ4A 1T6VN 5C07D 3QUZB 3BZ4B 3RVTC 3QIUD 3SGKC 1AQKL 4G42A 5DSCB 3RPIB 1NCTA 2DLGA 4FFZH 5ESQB 4XPTH 3UBXA 1UENA 4K94C 1NLBL 3RKPA 3OZ9H 2YPLE 4NQVB 1K3IA 1GGIL 2FX9L 4NRZA 5KSBE 5FDWB 3H3PL 1IE5A 1RZIB 3STZA 2F54B 4RWYH 2DQEH 2I27N 1G7HA 2FRGP 1GL4B 3DSNA 4JHBA 5E2VH 5F8RC 5DK2B 4DFHA 4OZHF 1CXLA 1K5NB 3HRPA 5TQ2H 4AL8L 3MRMA 1YZZA 3UJJH 1W72L 5CKGA 1J7VR 3GJFH 3BD4A 4EIZC 4NWUL 3QO0B 3VRJA 4AEHL 2Y72A 2L7UA 4NNPH 3IYLW 4PP2B 3STLA 2R4SH 1ORQB 1MCBA 4LLAA 3GNMH 4WI8A 3O41B 3FO9A 4DVBB 3QA3A 2DKSA 2OYPA 2OSLB 2P8LA 2ZNXA 4WCYL 5LQBH 2R0WH 5T5NG 4HUVA 5F8QC 1NC4A 3B83A 3ZSTA 3PUCA 3DYOA 4JVUA 3VE0A 4BKLB 3BZFA 1NMCB 3ARWA 2J6EH 5DVLA 1JPTH 8FABA 1QFWM 4RIRB 4XVJH 3DX6A 4GSDH 4KMTH 2FJGA 1RZFL 3JXAA 1EO8L 1WIOA 1JHKL 2P46B 2YC1B 1JGDA 2GK2A 3HMXA 4RBPH 4FTVB 3MNWA 4G80B 4R9HA 4UQ3B 3V6BR 2FHCA 2P5WA 3C5SA 1L9MA 2FDBP 3M07A 3CVHH 1HHJB 1F3DJ 4ZFOB 2DLIA 1B2WH 1WIUA 3HG1B 3O4LB 1HKLL 3MOAL 2A1WL 4LKXA 4LLWA 3KPLA 3V6FA 3QDGA 1P5UA 1MCLA 3S88H 2NYYD 4M6MH 3GI8H 1PZ5A 2ZPKH 4PG2C 4D9RE 4EUPB 2FJFA 3L3GB 3TLRA 2J8UA 4Q7DA 4R90L 3VG0H 5E8DL 2X4RA 3I6LE 3S36H 3LRGA 3LHPH 3A0OA 3G5YA 3ARGB 5KG9A 3RJQB 5EC2B 1M71A 5AG9A 2ZUUA 1CBVL 3X3FL 3T0EB 4YX2H 4L4JA 4JG1L 5GRUH 2ZCHL 3DUHA 2XWJA 4R4FL 4PRIB 4RGOL 3TCLA 4XH2B 3WFDL 4GRLD 4MJ6B 2DQJL 5MENA 3RWJB 5DF0A 4PLOB 3O2WL 1BZ9A 4PGBA 4IRSC 2VUOA 4PR5A 1F3DH 1H0DB 1CIUA 2OTUA 2VXVH 4U1IA 5KSUB 3VFOB 3TJHD 3L6FA 3C6SA 2DLFH 4F15B 5EU4A 5KS9A 2ED9A 1IRAY 2DBLL 1BGXL 3NCEB 2J3SA 3BQUB 2X1QA 5IG7B 3MNZB 1A64A 1ZSDA 4ELMA 2VR4A 3SDXF 3QDJD 2V2TA 3W39A 5B3NA 5C0CA 4C83A 4LSTH 4RDQF 5K59E 1R3JA 2ICWJ 3OAUL 4JQVA 2IAND 1MCSA 2JIXB 3CC5B 3KVQA 4YK4C 5D2NC 5IKCA 5K9QG 4PJBF 3FB6B 5D7IA 4BYHA 8CGTA 1NGXB 4QRPE 3W9EB 1P5VA 3GSRB 3AROA 4P3WA 1UFUA 4YWGH 5FXCH 2YPVL 4NQCA 1FG2A 3VFVA 1T2QH 1KJ2A 2WLYA 4FQLL 3KYKL 4AEEA 1IJ9A 3BZEB 2DTML 2ICEB 4MAYA 4YDKL 3QEQD 3U0WH 43C9B 2IQ9H 4DGVH 3GSOA 5C2BL 1JWUB 4JHAL 2GJ6D 1TQCC 2G75A 4D9LH 2DAVA 2C1OB 3IJSA 2FD6H 2HVJA 4JB9L 1U36A 4YDLC 3D85D 5D7KE 3S5LG 5IMOA 1RHHB 1T7WA 5ACMA 2ZUTA 4D8PA 3MOBL 3B8YA 3QXAA 2AJZA 1OM3L 4ZFFB 4HIJB 2NY7H 1MAML 2NY6D 2XOTA 4UOJA 1QFWL 1ADQA 5ACLA 4LIQL 4LRIC 4FMFA 1U8QA 2DD8L 5FHBL 3RVXC 3T2PA 3TN0D 4XVTL 4JN1H 4NJAL 4MA3B 3ESVF 1IMHC 3FT4B 3O3AB 3QJFA 2J5LC 9CGTA 1AH1A 3EYSL 4ZPVB 4NRYB 5CEXB 4YAQA 4HK0A 3MRNA 3Q2CA 3ARBA 3N50A 3WIHH 4ZAKB 3UP1A 3WYRA 3GK8H 3IF1B 1D5ZA 3WSQL 1RUKL 4OZIA 1MCPL 1JMZA 3OZ9L 4L4TE 2QADD 4DCQB 3T1WA 4GAJL 2HH0H 1QRNA 4MWFA 2DYPA 1VCAA 1S7TA 1M05A 4Z0XB 4RISH 4ACPA 1NDGA 3K8KA 4NN6C 2NXZC 5E2VL 5E4EC 4L4VE 3O2DL 5TQ2L 1D6EB 3QUXC 3P0VH 3NACL 4Z7VA 4LLMA 2FEDD 1DANU 2AV7A 2AW2A 1YYML 3QJHB 4MQ7B 3R0NA 4GAGH 2W0KA 1OTUC 5IVXF 4NNPL 1ZA6B 5JXEA 2X7LB 3D2UA 4GKZB 2YRPA 3JVGA 5FGSA 4GG6F 4BH8A 3QDJB 3O3DA 3LQAL 3GNML 4F2MA 1RIVH 4A6YA 3BZDA 1R3KB 3B2UD 2PYFA 4RDQG 5F1OB 3NZ8A 4M02A 4GOSA 4ZSOE 2R0WL 5F9AC 4AJ0A 4JZJB 2IANB 2ITDB 4NKMB 3U9UB 3KYOB 3CLFH 1FFNA 4MB4A 2J6EL 1JPTL 3FFCD 1DEDA 1L0QA 1OOAA 3DSFH 4XVJL 4PJ7F 5IEHA 4GSDL 4M7ZC 5E5UB 5IQ7H 4KMTL 1Y0LB 5DJDB 4HHAB 3QQ3B 4HBQA 4BQCA 2IALB 1D5XB 4OM0H 5FKPA 2MPAH 1OAYH 2CKBL 2Y5TA 3PV6A 4IJ3C 3QEQB 5FK9B 4EXPX 3OAZK 3FQUA 1KPRA 4R8WL 5T3XH 2EDWA 4N1EA 4HV8A 4XTRD 1BD2E 1B2WL 4Z7WE 1F11A 1CLOH 3CZFB 3PP4H 5KVDH 1P9MC 1WEJH 3IGAA 3ZT6A 3RQ3A 4OZHB 3LDBC 4TNVF 4X6CA 3P4NA 5DRWB 1XGRA 1OLLA 4IOSD 4PRDA 4UUJB 3O3EB 5F3BA 4NOFA 3BO8A 3RWHB 1AGCA 4K71B 1H3PL 2LAAA 2XY2A 1A6TB 4LFHG 2VB5A 4MCZB 4HAFA 3NFPA 4XMPL 3ES6A 3VG0L 2J4WH 3S36L 1MCWM 5CEZL 3LHPL 1HXMA 4GQPH 5IFHL 4X6BB 3TN0B 4LLVB 4R97B 4L8CA 4OZGE 1YMME 3VFMA 3IDMB 1I8KB 3CVIL 2FZ3A 2EDHA 2AXHA 5E99L 3TBYA 5LBSH 3ROLA 4YX2L 4CADB 1F4WH 5GRUL 1QBAA 3CFBB 3LD8B 4N90E 4KQ4H 3QAZB 4L5FL 3C2AH 2A0LD 2FR4A 3EO0A 2DQFA 2W60A 4M6NL 3O3BB 3GMNB 4XCFH 4GMSH 2QADB 4IRZL 1DEEA 3TA3B 3VXUE 4ZS7H 1X9QA 3I9GH 5HHME 4UV7L 5CZKA 3MROA 1PDKA 1PKQB 2PTVA 2UY7A 5MHSD 2F5BH 2NZ9C 3S5LB 1S7UB 2X2YA 4X99B 5EO0A 2EIZB 3QISA 4PJ5D 1DBBH 4HX1B 3WLWD 1A4KB 2WUCH 2B20A 4W68A 4H25B 3W9DB 1TZGH 2HA1A 3OR7B 1ZGLA 1NJ9A 3CSYB 3SGDH 3L95A 4HCRA 2DBJA 2Z8SA 3PWVA 1LD9B 2EEDA 4WI4A 3TNMA 3FO2B 5E8EB 2Z0BA 1PYWB 1RIUL 4GBXD 3LH2H 4YJZL 3FOLA 2X4OB 5HHXH 3LQZA 5C08B 2IFFH 4U31A 5D7JA 4QHKJ 3JWOH 3VG9C 3Q1SL 4D0DB 5CD5D 4DKFH 2D0FA 2HFGH 1JPGB 3V7AE 2D03H 5IHZB 1N8ZA 3OKOA 3BIKB 1FFPA 3FFCB 4JDVA 3LN4A 2IFGA 3UZVB 3V8OA 3DO7A 4PLKD 2NXYD 1T83C 1EJOH 2Q6WA 1SYVA 1WZLA 2EE9A 2GJZB 2H8PB 2IQ9L 3U0WL 4BQ6A 1CXIA 4DGVL 3UTOA 1VEPA 3QG6B 5JW4R 2DWEB 2ZCLL 4JRXA 4KK9C 1DTUA 5E2JA 43CAA 5ILTL 3T65A 3IKCA 4D9LL 2UVFA 2JJWA 1OAUH 4H26A 5HDBF 3LMJL 4O58H 3T77B 1MHHB 2YD6A 2YR3A 1T04A 2MOVA 3CK0L 4MA7H 3BPLC 4GKSA 3EYVB 4F7EB 3BIBX 4AZ8A 1ZV5A 2A6IB 3ULVD 4Z18A 1SM3L 3DIFB 1CFBA 2UUDK 4BK5A 5E1AA 3SDXB 1IVLA 4UU9A 3KPQB 1EAPA 3QIWC 5FA4A 1PZUB 1IGMH 2VDMH 3LEXB 2KPNA 4Y5XA 4TUOB 1Q1JH 1E0OB 1JWSA 2CDEA 1X4XA 4PG9B 2Z91A 4P5MA 3GM8A 1OGAD 5FKAB 4PJBB 1EAJA 2F74B 1CD9B 3WIHL 5IB1B 3DX8B 1I1AC 5MEND 1U8NB 4LGRB 5DHVA 4NO2B 4P5TC 2E7LA 4ODWB 3QUZA 1A14H 5JORB 2VXUH 4EI6B 3BZ4A 4GFTB 5DSCA 2Q87A 3RPIA 1B4RA 3D0LB 5ESQA 2E6JA 3LKSB 3OAYH 1HHGB 1JRHH 5EOCJ 1L4IA 4QWWD 4NQVA 2BVQA 1MVUA 3CD4A 5FDWA 3OGOE 1ZEAH 1T66D 1KTLB 3PDOB 2VR5A 1JF5A 2F54A 1G7IB 4KJQC 4M43H 2VLRD 2A9MH 3WNNA 1A2YB 3AM8A 1NL0H 1DE4B 4GLRI 1V3LA 2F5AL 2Q3AA 3SPVB 5HPMA 1RIVL 1XCQB 1QUNA 4DJMA 1IFHH 3DWTA 3O2VL 3BUYB 4V2CB 4LARH 1UC6A 3O81A 3SBWC 2B8OT 3O4OC 4PP2A 3DVNB 4NP4L 1ORQA 3QEGL 4GBXB 1Q0XH 1E28B 4W6XB 3U83A 4BK4A 3BEWB 3O41A 5EU6B 4RMUA 4NQCD 4ALAH 3DSFL 5DJ2B 4HS8H 3GEWB 5E6YA 5H35A 4XP5H 4WDIB 4MAYD 3DGCR 4BKLA 3WN5B 3VGDA 4OM0L 4HJJH 5CIPH 3RWGB 4RIRA 5EOCH 2Q7YB 2X9WA 2NXYB 1JTTA 1YC8A 2AK1L 2IBZY 2YC1A 1KG0A 2E6PA 5T3XL 1IC7H 3DX9B 4V2BA 4HZLA 4G80A 5JW4M 2XZCL 3MGAA 4UQ3A 1U8MB 3PP4L 5KVDL 3WIFB 1WEJL 3PDDA 1A7QH 5BV7C 3LKNA 3QWOA 1EIBA 4ZDHB 1AD9B 3EYUH 3HG1A 3I75B 3IDIA 3O4LA 4FFWD 4MJ5B 5B3JE 3F5WB 5HYFA 3KPOB 4GAYB 4L9LB 4Y19B 5J4MA 3KXFB 5A3ID 3X3GH 3IT8D 1NCDL 1NLDL 5HJ3A 1IC4H 5IVXB 3BGFB 3QUML 5JHDD 2E8ZA 1I1YB 1X44A 2VXSH 1L0XA 4GG6B 2MHAA 4HT1H 3SE4A 4RGNC 2NNAA 4DGYH 4LGPB 4I3SH 3LOWA 4LP4A 5CZXC 5DUBA 3L3GA 4NO3B 3SCMA 3P30H 1DN2A 1GH7A 4AIZA 3ARBD 1KT2B 3T3ME 5F21B 1Z2KA 1RZ8B 4NQDD 1I85C 3RWEB 4PY7B 3IXTA 3TCXA 2YD5A 1J8KA 5EC2A 5MI0C 4PB9L 2GFBB 5E2WH 4PJ7B 3HNVH 1IT9L 4XRCA 1I8IB 3C2AL 5INCB 4P2OC 1QRND 3TBVA 2DYPD 2A6JB 1P1ZB 4LCWB 5D1ZD 5E94B 1LHZA 4PRIA 4XH2A 2VMFA 4MJ6A 3KR3H 4XNQB 2ADFH 1C8PA 3GMLB 2NCMA 3X11B 2D0HA 3I9GL 1OPGH 3IRPX 3MRRA 2BVYA 32C2B 4K8RC 3VJ6A 3VFTB 1KGCE 4FXKB 4R7NB 2R15A 1SBSH 3QIBD 5JXED 5I1AB 1T80A 3BN3B 4NGHH 4YZFF 5A2FA 1TZGL 4ORZC 4NIKB 3UTQB 1QD0A 2OI9C 2NX5B 4ODHL 5FYJL 3BQUA 5IG7A 3MNZA 1ZT7A 2NY4C 1JF1B 3LH2L 2ILLA 2GTWA 5HHXL 4HLZG 4MNQD 4EIGB 3KPRE 5D93B 4Z7NF 4Y2DD 2JIXA 5BZDB 1DANT 3JWOL 3C87A 4UBDD 3UMTA 2P5EB 2WP3T 2NY1C 3FB6A 1G7LA 2D03L 2CH8A 1N3NA 1KNOB 1NGXA 4WRLA 2XACC 3OR6A 3IDJB 1MLBB 1MF2L 4S11A 5LWYL 1EJOL 1YNTA 1MY5A 1RULH 3MO1B 2YUZA 4KVCH 4Y4HD 2MTPA 5B21A 2HFEB 1DLFH 3U82B 2ICEA 3EJZC 2X70B 2WAHA 43C9A 3VDBA 1OAUL 1V7ML 4F3FA 4O58L 1M7DB 3QXUA 3N9GL 3V5HB 2EDLA 3WUWG 4MA7L 5C09B 1PW3A 1ZOXA 3B9VA 1KTKE 4YGVB 3O6LH 3SHSA 1LEGB 5EU3B 5GGQL 1E4XL 1RHHA 4OM1L 3HNTL 3MXWL 1L0YA 3UZEA 2ZUSA 1RVFH 4ZFFA 2FYYA 4HIJA 1U8OA 3IDYB 4Q0XH 3TH4T 1IGML 1KEGH 2VDML 3PV7A 2JB6B 3BMVA 3UYPA 2PYEE 1HYRC 2R8SH 1KELH 1Q1JL 2RR3A 5DVOA 3PWPE 1GHFL 4UB0H 3ZKXC 5CEZD 3DMMD 3VW3H 4HKJA 4MA3A 3PABB 2F53D 3UTSA 3O3AA 1PSKL 4GXVL 4OSUH 3NN8B 2V5RA 3GKWH 3IFPB 2DM2A 4PUBH 3SKOB 4NRYA 4POUB 5EOQH 5CEXA 4NQDB 1GXEA 2VXUL 3KLDA 3WL9A 4S0TD 4ZAKA 2J1KA 3NCBB 3DRTB 4BJLA 3P9LB 1BWMA 1JNJA 1F90H 4GW4B 5FCSH 1FYTB 2YD4A 1G7QB 3IF1A 4G43B 5GJTH 4YHZH 3WFCL 4PJ8C 4GJTB 3ZT7A 1Z9OA 2BHYA 4U6XB 5D1ZB 3RTQD 1B4JL 3ZDXF 5C70A 4HG4J 1Q9KB 4WTWA 1OGTB 4DCQA 4ZXBC 4NC1C 5EH1A 2VLLB 4JCMA 4JFQB 3D25A 4UQ2A 4Z0XA 1AHWA 4M43L 1PVHA 1UEYA 1A21A 3BESR 6FABL 4HIXL 1D6EA 1CL7H 1K9TA 2CGRL 3MRIB 5EWIH 3B2VH 4JFOB 2KH2B 5MP6H 4GT7A 4QRPA 1D9KC 1KB5L 3U2SB 4MQ7A 2VZOA 4KK8D 4EN3D 1IGIL 4HJ0D 5SWSD 1UG9A 4KRPD 4O51B 5EBGA 5B39G 4EOWH 1ZA6A 2X7LA 4GKZA 5EN2B 2Y06H 3ULUH 3Q3GB 2PO6C 4UAOC 5ALCH 1OB1B 4J4PA 3LN9A 5KZCD 5EU5A 1EXUB 3GSQB 4LQFL 5BOPA 5GGVY 4HS8L 4JZJA 3C5JB 5HI4C 2ITDA 4Y2DB 1XZ0B 2AQ2A 5L0QB 4KKLD 3U9UA 3KYOA 5AD0A 3NZHH 5CBEB 4LOUC 2R2EA 1BQSA 3GMPB 4HJJL 1F42A 5CMAB 3K7UA 1JNNH 1P7QB 2I07B 3UC0L 4TNWK 2LVEA 4JRXD 4F80A 4NNYA 3AY4C 4UI2A 4HHAA 3QQ3A 4PD4K 5IB4A 5BJTB 1I8LA 1D5XA 4Y4HB 3EYQC 4B7IA 3MJ8B 4W81A 2EYSA 4OKVA 1H15B 2CKBB 4OI8A 3P4LA 4J7RA 4XBPB 5HHVL 1OHQA 2W1NA 4YBHA 3EYUL 4JFEB 2AK4D 2BXZA 5I6XC 1UADC 4Y7MA 5DEGB 2WBKA 5F7DB 1S7VB 3MPCA 3P0YL 1HIML 2NY3D 3X3GL 3JWDH 5E2TH 4LCYA 5J06A 3O3EA 4JQXA 1M7IB 3HMWH 4HWNA 3AS2A 2VWEE 4QYOA 3U9PL 1A6TA 4DGYL 4L29B 4BZ2L 3LS4H 4I3SL 1FSKB 2OZ4H 5HD8D 4LNRB 2CLZB 4G5ZH 4R4NC 3THMH 3E6HB 4L4TA 2AI0H 4QOKE 4X6BA 2FX7L 4LLVA 1FCCA 2UYLB 1HXYB 3BWAA 3DMMB 4M93C 1BQUA 4LMQE 3QPQD 1BM3H 2F53B 4QGTA 5ESVA 4F9LC 4GRWH 1S9YB 1Q9LA 3IDMA 4L3AA 1KCSH 1MH5B 3HNVL 1B0WA 2V7NB 3KWWB 4L4VA 4CADA 3L5JA 3TT1H 1JUFB 5C9JA 1U95B 3CFBA 3DUUB 1YEJH 5DR5L 4KZDH 3RDTB 4E42B 2DQIH 3O3BA 4KKNA 1OPGL 3DOSA 2FH8A 3GMNA 3U4BL 2Q7NA 3RTQB 3ZDYF 5F70A 1RK0B 3TA3A 3WUWB 4NGHL 1CICA 1KXQE 3ARDD 1PKQA 4R4BA 3W0WE 1KN4L 3OWEA 3IKKA 1S7UA 3MLUL 1A7OH 3F12A 3RKDC 3HB3C 2DL2A 4HX1A 1A4KA 5GISH 2DMBA 5TF1L 4YHML 4GO6B 1BZQK 1GGYA 4UDTB 1K8DB 1T1ZB 4UNUA 3RZWA 4XXDA 4JANB 1N26A 4WI5A 1S3KH 3CFCL 2BVPB 4KRPB 4XNZB 3F7PC 4FQJH 3G6JE 4TN9A 3SY0B 2I9LA 3FO2A 4WHYH 1QVOA 2DMCA 5KAQF 4D9QE 1RUAH 4W6WB 4AG4L 5IEKA 3TFKD 5IB2A 4C58B 5AG8A 2OR9H 5C08A 1AO7E 5TH2B 3QUYB 2ZUYA 4D0DA 3F65A 1RULL 1EHXA 1JPGA 1FH5L 3E2HB 1MFNA 2B5IB 2ADIB 3BIKA 4X0KA 1JGLH 3F62A 3JV6B 4U2YA 2GJZA 2H8PA 5HI3D 2A38A 5D7LB 2WWKO 3QG6A 3LN5B 3IDNB 2A2QT 1DUZB 3G5VB 3BPNB 2ARJQ 1RZKH 1EEQA 4K94H 3NIDF 3O0RH 4MJIB 3T1FB 1QLEL 4JO1H 4X6DE 1ES0B 3T0EC 4G6AC 5GGRY 3T77A 3H42H 4OZGA 2FBJL 5L2KA 1YMMA 4OT1H 5F9WC 4U4BA 1QR1B 2A6IA 4Q0XL 1WCBA 3QIUC 4ODUB 4ZNEE 1W0WA 5GGSY 3DIFA 4DZBB 3SCMD 2R8SL 1KELL 1YEIL 4LRNH 3OHXB 4P2QE 3QFJE 2FIRT 4M61A 1UQSA 2FIKA 3KPQA 3S37L 2YPLD 4MD5B 3ZHLA 1F13A 1X5FA 4F15C 4W4NA 2IG2L 2O5ZH 3BT2H 4JFDE 5TQ0H 3LEXA 4Y16B 1I7TB 4JR9L 1A6UH 4TUOA 5DJCB 3FCTB 4OSUL 4WW2C 3GBNH 3FQRA 5T1MB 4KHXH 2P49B 3QCVH 5GRYA 1TTUA 3UO1L 5EOQL 4PTTA 3RUGE 1U0QA 4PJBA 3VXUA 5H2BA 4OZ4B 3KHOA 4JQIL 2VDNL 3DX8A 1FGNH 3L3DB 4RGMC 5J13B 1R3HB 4NQSB 5F7EH 3TH2T 1U8NA 4L8DB 3HZKB 2R0ZH 1NSNL 3PJSB 3PG2A 5GJTL 1EHLL 4QCIB 3QZWG 2VZSA 3QWQB 4PJ9A 4MA1B 4F7PB 5I15H 1QR4A 1QEWA 4JFHD 5E7FA 1UJ3A 5AZ2H 2NY2B 3HUJE 4LLYA 3RI5F 4QY8A 4P2RE 4NKQB 1CG9A 3O9WB 1DBAH 1CDHA 2W9DH 1CL7L 1U42A 4AT6B 1J12A 3SGJC 1H3UA 1NFDF 3K2MC 1G1YA 5E9DE 1G7IA 3M17A 2IEPA 4Y1AE 5EIIB 1N6VA 2GTZB 3T8XB 4HWEH 2QJDA 2Y06L 4UZGA 5A40E 1EJ6A 2H26A 3SPVA 1W72A 1XCQA 2EIDA 4PJDF 1A6ZB 25C8H 3RWDB 4MQXD 2H32H 4MXVF 3DVNA 5I1DB 5KAQG 4NHUB 1E28A 3NZHL 5EU6A 4TNWF 4DOHE 3KYMB 1DDHB 4PGEB 4Z0BH 4IMKC 1F2QA 3OL2A 2VL5B 4UINL 5EBLB 3QDAA 5C0AE 2X42A 3OTTA 4Q58C 1J1XH 2NYYC 5HYJB 4XNYH 5CGMA 4NKIH 4HUKB 4D9RD 2E9JA 2Q7YA 1HNFA 5SX5H 1JP5A 1T0NB 4EVNB 3I6LD 2XXCB 3WFHB 3TBTA 1IAIH 3K46A 1QFHA 3OJMB 4J1UB 2XG4A 1NCBH 4NO5B 3GSUA 4KKAD 3MRBB 5ADOH 3MRGA 4U6YB 5HGBB 1BVKB 1AD9A 1FAIL 5E2TL 2XV6B 3V6OE 3HMWL 1FNLA 1G9NC 3D69A 5TDOB 3QULA 3GB7B 4GRLC 4NZJA 3KXFA 4P9HL 3MGTB 4Y19A 4ZTPH 3LS4L 2OZ4L 3WJLA 3MRFB 5IVXA 1S7WB 1IZKA 1NBVH 4ZYKB 3THML 2C3HA 1FV1B 3WDHA 3CXHK 2AI0L 3QUMB 4OCYH 4Z5RB 1MFBL 2C7UA 2YPLB 4WHTA 3TJHC 4P23D 1BM3L 1W0YT 4Z7WF 3MRJB 1KCSL 2CQVA 1KT2A 2VH5L 1C12B 1PG7W 4LCCB 3TT1L 1R5IA 4H20H 2OTWA 3RWEA 2KQMA 4I2XE 4L8BB 5BVPL 3I50H 2GFBA 1JHLH 4KZDL 3MUHL 5D5MF 1I8IA 5FGRA 5INCA 4KUZH 1NH6A 2A6JA 3EOBA 1P1ZA 4LCWA 2CXGA 3B4NA 5HYSB 3LZFL 2FSEB 5FOJA 2APFA 3GJEB 2ORBH 4K7FB 2NW3A 4QXTB 3GMLA 2LFGA 4MQSB 2B4CC 5HVFB 4WY7L 1A7OL 3VFTA 3EJJX 1KBGH 4R7NA 1E27A 3LV3B 1FNSH 2P8PA 5GISL 1TNMA 3CMOL 1EFXD 3MRLB 3N06B 5EO9A 5DC4B 2BSSB 1X5JA 4OLEA 2ZKHH 2HT4D 3VWJB 3UCRA 1HQRB 4WUUE 4M4PA 5BW7C 3JUYA 1CFSA 1FNEB 3SDCD 1M6OA 2FGWH 1RUAL 2LU7A 4WNQB 3D0VA 3MQIA 4JFFE 4O5LH 4I0PA 5BZDA 1IGTB 2GCYB 5D7KD 5ICZA 1UZ6F 2P5EA 1KNOA 3UEZA 4FN0A 3UTTB 1O5DT 2NLJA 2NY6C 4JREC 3QZWB 1F97A 1UJTA 4F7TB 4PGDA 2G2RB 2HFEA 4I5BB 4YBLC 3TN0C 3ZLQC 3EHBD 1J86A 4K94L 5I75B 3O0RL 5KN5B 3GUTA 5F96H 2ENSA 3NFNB 4JO1L 4LVHC 2J12B 1M7DA 4DFIA 3BP7B 3MA9H 2X4PB 4P9MH 5C09A 1ZWIB 4IIQB 4M5YL 4KVNH 1U3JA 3R8QA 3QAZC 4PRNA 5EU3A 3NIGF 2QEJA 4HJGB 1FCGA 3QWRD 1Q9OA 1QSFE 3MV11 4L4TD 2CDGA 3GJFK 4X7SL 3CU7A 1EVUA 3BT2L 4C56E 2JB6A 2JF1A 1NBZA 4HUMB 1MELA 1A6UL 4M9OA 7FABH 3FQWA 3GBNL 3MJ9L 2ZSWB 4GG8B 5E5RB 4KHXL 4O2FA 2BSTB 1ZHLB 4ZQKB 2D2OA 4L4VD 3LQMA 2O5XH 3PABA 1OCWL 3ILPA 3UTZA 2XKUA 2FEDC 4P23B 2GI7A 1YEEH 3NN8A 5F7EL 4HUUB 4YC2C 5D6DA 3VGEA 1MJUH 3TYFA 3WNPA 1UZ8A 1HINH 1WC7B 1BQHA 4GRMB 4YHIA 4G7VH 4U1LB 3VCLB 1LE9B 1X6NA 4ZODA 5H94B 1XGYL 1Z6JT 2ZSVB 5I16A 4H88H 4H5SA 3DRTA 5ANMB 1LO2H 2OL3B 4UTAL 3R06B 1C1EL 3B2UC 4H1LG 4XC1L 3X14A 3RPKA 2BHUA 4RBPK 5GS2H 3OMZA 1G7JB 2DMKA 2EECA 4NN5B 4Y5YA 2VLLA 2CDFA 4JFQA 5DQ9B 5FGBC 5EULV 4R2GC 5GXBB 1OP3H 3EYFB 3MRIA 3O2DA 1KIQB 4XBGB 5GGUB 3HE7D 3MACL 4TVPH 2UWEF 1ED3B 1KLUB 1AR1D 1UT9A 4WFHE 5D96B 3U2SA 1KB5B 1A1MA 4O51A 2YZ1A 3C5ZD 5DO2D 1UWXH 4JPKH 1NUDA 1U6AL 3DXAE 1SVZA 1HHKB 4XTRC 1BD2D 3WFZA 1DL7H 4CL7A 4LASH 2IQAA 5SX4H 2O93L 3GSQA 1UM4H 5FCUL 4F37F 3WO3B 2MWCA 4XWGH 1MHPH 5CBEA 1FZJB 3GMPA 2HJLA 5F3HB 3FONB 1F4XL 3CLEH 3QHTC 2J6EA 3QXTA 4GW5A 4JHWL 5DA4A 5I1EH 1AXTH 4MGXA 3MLVH 1HSBA 3PHOB 4Q2ZA 4HWBH 3BVNA 3WNMA 3L3IB 3VI4F 3VXRE 1PY4A 3TBWB 3E3QE 5EPMB 5SWQB 4ZTOL 3IXAB 4Z78B 1CFQB 4Y2OA 1EGJH 1YMMD 2PYEA 1YNKL 2ERJB 5C8JA 2CKBA 5JQHC 1UH2A 3GRWH 3IDXH 4L3EA 3PWPA 2X40A 1A47A 1D5IH 4RFOL 1ZVSA 2A6KB 4JFEA 1ZLUK 3CVHA 5A2LH 1NFDB 3MLWH 1K4DB 5DEGA 3FO0L 4ODTH 3ZT5A 4N90D 5F7DA 1S7QB 4ZTPL 3QI9D 1GAFH 3V6ZB 4G6JH 2A0LC 2JJSA 3OB0H 1U8PA 1NBVL 4XHQA 1ZVYA 3BDYH 1M7IA 4RAHA 1S5IL 3KJ6L 4OCYL 2Q20A 2D7QA 3AREA 4EDXA 2J8OA 4PJDB 3VXUD 5HHMD 2VLKB 4LNRA 2CUMA 3GSXB 4YPJA 4WWKB 3DLQR 4H20L 1WF5A 2UYLA 3LPFA 3RA7H 5IMLA 4OGYH 4FS0A 3WBDA 3WLWC 1MH5A 4MNGE 3C08H 2V7NA 1BLNB 3KWWA 4KUZL 2ESVE 2EH7H 3IU3A 2V2WB 4OV5B 1ZANH 2VABB 5DHXB 3VXOA 1YN6B 2DJSA 5I76A 2ORBL 4GBXC 5LGHH 1LO0L 3BH9B 5C7XL 2YHGA 4L8SC 5I17B 3BGAA 3VA6A 3QHZL 4IHOA 1NFIA 1XIWD 5E56A 5C3LD 1INEL 3E8UL 1VADB 4TUJA 4PLKC 2NXYC 3HR6A 4XB8A 5DJ0A 3RY5A 5L6YL 1GZQB 1K8DA 1T1ZA 3LKOB 5IQ9A 2GK0B 4FFYL 4JANA 4NN7B 4JKPH 2BVPA 2YS4A 3C5ZB 4DKDC 3SY0A 4HF5L 4QF1B 3FT2B 1T5XA 1UKTA 1YECL 2JJVA 3H3KA 3T08A 5FUCC 4QTIH 4Z7WB 2AQ3A 4L9LC 5TH2A 5D1XD 4U1MB 1J18A 1BVLA 3ULVC 3BXNB 1YEHL 2CMRH 1SQ2N 4EI5B 1SYSB 5EIQA 4MDJB 2ADIA 4F9PA 5IWLA 1GGTA 5D5MB 3DVGB 4PRHE 2A77H 3ULUE 3KJ4B 1RIHL 5F96L 5GIRA 4KK6D 1IM9D 4H1LB 4CJ0A 2OQJA 5D7LA 5I30H 4UDUA 4OF3A 3C2SA 3QQ9C 3MA9L 1DUZA 2FO4B 3EO1A 4P9ML 3ULSB 1CGXA 4FQXD 5GSVB 1J0KA 4MJIA 5FM5M 1AIFA 1Q9WB 4JGJA 1KIPB 5J11C 4ZFZB 2DKUA 1XF2B 1DR9A 4QOKA 3NA9L 3UJIH 1KJ2H 4BFIB 1NFKA 1Z9LA 1CD8A 2YEZA 4EKXA 4KPHH 1IL1A 2W38A 5E4IA 4DW2L 2ATPB 4XC3H 1GGCH 4G7YH 4LPYA 1QR1A 2XWTB 4HS6B 2JELL 2ICWA 3MRKA 3TWCH 4DZBA 3P4OA 3QI9B 2XZAL 1AP2B 2X4QB 5B39A 1BQLH 4R96B 1NDMB 3OHXA 4ODVL 2WUBL 1AXSB 4RAUA 3QRFM 1A5FH 3TPUB 4WHYG 4MD5A 4QWWC 2L0DA 1CXKA 2V7HB 2O5XL 4ZO6A 3D3VE 2WM0A 3QYCA 3IU4L 1P6FA 1EO7A 1T66C 3FCTA 4TRPH 5DJCA 4KC3B 3ALPA 4JZNB 5C0RH 1HINL 1AJ7L 4G7VL 1RJLA 4OZ4A 1FVEA 1D3CA 1TITA 3ELAT 3L3DA 5GGTH 5ID0B 1U8KB 1N6UA 1I9JL 4L8DA 3WIHA 3HZKA 4OD3H 1QSEB 2LVCA 1VGKA 2YD8A 4KAQH 5I1JL 3UPRB 5HHPB 2A74B 5FGCB 4OF8A 1TETH 1RJYB 3MV7D 1RU9L 2DQCH 5TJWK 4I13B 4LPVA 3ZHDA 5IV2A 4KV5F 2ZCKH 3O9WA 4GRWE 1E6JL 2VAJA 4MAYC 4ODXB 5ID1A 5J7CC 4AT6A 1XIWB 5KVGH 3G5ZB 4WV1B 5FV1L 3TJEH 2XN9B 4TVPL 3VXSE 1NC2B 1A3LH 3K1KC 4JO4L 4IDJH 2GTZA 3MCG1 3QO1A 1TJGL 1V5JA 3TEUA 1XGQB 3ARRA 4JKMA 3CSGA 2OP4H 3HA0A 4J6RL 3WS6A 4DUWA 1DQJB 2Y25A 4PJEF 1XGUB 4BFBD 1UM4L 1TPXB 1IEBA 3O8XA 4XX1G 5I1DA 3KPNB 1EK3A 2CK0L 4JY4B 1KIUA 3T0XA 1IILE 1I9RH 4FFWC 4P3DA 4UT7L 4K3EL 4OFDA 3MCKB 3RGVB 5A3IC 5ISZB 1FO0H 4TTGA 4HWBL 4P3CH 1LEKB 5HYJA 1P4IH 1CGWA 4MYWB 4KDVA 2XT1B 1SJEA 2YPKA 4UT9H 5FHAH 4POYA 5IHUL 1E4JA 1EGJL 1QPXA 1YUHB 1T0NA 3GRWL 2Y7QB 3IDXL 1Q0YL 3ARBC 3WFHA 3U0PB 2Z8VC 1JPST 1NGWB 3MLYH 5SWZE 4LMQI 4J1UA 3RWCA 4FXGA 3N1FC 2B1HH 4NO5A 1BBDH 2PUQT 3MLWL 4FQXB 3HC3L 4OLUL 3BWUC 1CLYL 1T21B 2ICWI 3JUZA 1A6WH 4U6YA 4G6JL 1BVKA 5L88H 4HGKC 1T0MB 1EMTH 4P59H 3R4DA 2UWEB 5DXWA 1X5XA 1H3VA 3QXDB 1A3RL 4X6EB 1H8NA 3MRFA 1FV1A 5JW3L 1PGRB 1T4KA 3HHRB 4XCNB 1MEXL 1GC1H 2XPGA 4Z5RA 2VR9A 1SEBB 1KGCD 3HUJA 4OGYL 1AI1L 1GIGH 3QIBC 5JXEC 4P2RA 5H37G 2Y4SA 3JVGC 1YY8A 5D6CB 4NQEE 2EH7L 1KCUL 4HEPG 2HLFD 4BFEA 1ZANL 2DICA 4L8BA 1LGVA 1VB9A 1CR9H 5C0BE 4Y5VA 5E9DA 4X7TB 1T5WB 4LSPH 4LHUD 4S1RL 2K1MA 2LTQC 3MRCB 4Z77B 5D72H 3KPRD 4YNYB 3OGCB 4ONFL 2RJMA 4POZD 2OR7A 5GS1A 2FSEA 3K4AA 4OTXL 1VDGA 3GJEA 2GITA 1MAKA 4Q9QH 1KULA 2XFXA 3WLBA 4CU6A 4UBDC 1MCHA 3MV7B 2HTKD 4CVXA 4MD0A 1JGVH 2PW1A 3EO9H 5IW3A 2RFXB 4G8GB 1T7VA 2BCKA 1H5BC 2EKSB 5FUZH 4KRNA 5HVHB 1XFPA 4YO0B 2WBJB 5IK3B 3VRIB 4Y4HC 1CD1B 4G6FD 2H45A 1DVFB 1TNNA 4TQEL 5DURD 4JO3H 4JFYA 5FYLH 2YSSA 3VWJA 4GMTL 5AAWA 3PL6B 1U93B 3LEVH 4QGYA 1FVCA 1IAOB 4MDIB 1OSZA 4OFVA 3MJGX 4I18B 5IBLD 3EKCA 1U3ZA 2M2DA 4LEXL 2YUWA 4K3HA 3SDAB 3F7YB 1FFOA 2CMRL 4CMHB 2Z35A 2AJ3A 2BRQA 4NZTL 4K55A 3GO1H 5JIKA 3UTTA 4HXBH 1ZT1A 4ZO8A 4NWTL 4CN4A 1TZIB 4FQIL 4C54A 2R4RH 2PYED 4U1NB 3QZWA 3GSNH 4YLQT 3PWPD 4F7TA 2G2RA 4I5BA 4OZFB 4WEBL 5I73C 1DSFH 3BN9D 3DI2B 4KY1H 4NFDA 2WINA 4QTHA 5F7FA 2FATH 3G6AB 3HZMB 1JZ5A 1NKOA 4KDWA 4R7DB 5I1LA 1QNZH 5JOEA 3OAYK 5TE7H 3EDKA 2YZ8A 3OKLA 2R29L 1F00I 4JGUA 3HRZA 2X4PA 4X7DC 1RZJH 3V4PL 3IVKB 5FYKE 4G7YL 4Z95H 2R9HD 4XVUD 2V6HA 2X4NA 4RA0C 3LS5H 2VXQL 2Z31A 5DVMA 1H3XA 4WI6A 4S1SL 1A5FL 2COQA 2BNRB 2X10A 4TRPL 3Q5OA 2PW2B 2EO1A 4GG8A 1ZHLA 1C16B 4X6DF 5C0RL 4XI5D 1X7QA 3B3IB 2LABA 4B53A 5JDJA 1KYOJ 1HSAB 3WFEL 5GGTL 4FABH 4XMKH 4HUUA 2UZIL 4OD3L 1WLHA 4KK8C 4EN3C 1XR8B 3BISA 4HJ0C 5I1KL 4GRMA 2YKLH 2AV1A 4KRPC 3D39B 5H94A 1FIEA 3MLSH 4KJYA 5DHYB 2IJ0C 5ANMA 2BHZA 4YHNA 1HDMB 5EZLA 3RHWF 3V0VA 1FNAA 3R06A 4XP9L 4LHUB 5BXFB 4LDLB 4KROD 2OLDA 3KPRB 3ZE0E 1F02I 5ALBH 2KDGA 2ZG2A 5CSZA 5GRXG 3VMOA 3RL1A 1XF1A 4KKLC 1QQDB 5BV7L 4E41A 3RUGF 1YYLH 5AZEL 2AJXH 2VLJD 1A3LL 5DHVH 1U58B 1F5WA 5IOPB 1RHFA 4IDJL 3NCYS 5BQ7A 4XPHL 4XBGA 3SGDI 1U3YA 1ED3A 2NY5H 4J3OC 3I84A 4G6MH 1MWAL 4JRWA 2XQBL 3ALWA 2VAAB 1I3RA 2MNUA 3PGDA 2VQUA 4S0SD 2DQHL 2Y23A 1HHKA 1QBMH 1I9RL 4HDIB 1KC5H 5HHQA 2H2PD 3NCJL 3OKNA 2YN3A 4HFWB 4QKXB 4ESKA 2NY3C 4UIKH 1QG3A 4YDVB 1LO4H 1ND0B 3MODH 2VISB 4P3CL 4V1DB 4Y4FD 4ELKB 5I0DA 5HHOB 5IP4A 5F3HA 4LEOB 1VKXB 1P4IL 1MLCB 4DWHA 4BQ8A 3AU1B 5CIPA 2C1PB 2DRUA 1IAMA 3MUGB 4H0IA 4N9GB 3MV9E 1OAXH 4LDOB 5HD8C 3EYOA 1EEYB 4FQPA 1EHAA 5DRZA 1NEZG 1YMHA 4QOKD 3MLYL 2OMNA 4C56A 3IXAA 1CFVH 2B1HL 4IRSB 2P47B 3QUKB 3QPQC 2E7LC 1OSPH 2E3VA 2CRIA 3VXMB 4K8RL 1KF9B 4PRAB 3QUXD 4GKNB 2C3GA 5C9KA 4Q9RH 3FQNB 1OQXA 1NFDA 3OBAA 1K4DA 3DRQA 5EA0H 1H3TA 1K85A 4CW1A 1OTUD 5I8EA 4NOBA 1HILB 2VC2H 1X5ZA 1DN0B 1JHTB 4QHKI 3U4EB 2A83B 3P9MB 3VGGA 1XF3A 1KB9J 2P7TA 2QQQA 1FL6B 1GIGL 5F71A 4HC1L 4LU5L 3ARDC 2ZZUT 4P99A 3GSXA 3W0WD 4YK4B 2BVUA 5D2NB 3CH1B 4MZ3A 4U6VH 2M26A 1MFEH 2YD3A 3SKMB 1CR9L 3U46A 3ROOB 2VITB 3S9DB 1CN4A 3DV6A 4APQD 4LSPL 5JPMB 5D72L 1G6VK 3Q5YA 1U2CA 4XPAH 4OV5A 4EUPH 3INUH 1JRHI 1U92A 3EZJB 5FO7B 1J05B 3TFKC 4QRRE 1KTDB 1J0HA 1WAAA 1AO7D 1LK2B 3SE9H 3DXAA 5I17A 2GAZB 5FUZL 1A9EB 4RFNC 4Z7OE 5BO1H 1LK3L 1P4BL 4NQXB 3HC4H 1YQVH 2VLJB 4JFZH 3ZO0A 5C1MB 4WEUD 5FYLL 4E9LA 3B9DA 1T2JA 5I66A 1TZHA 3ZKQD 5HI3C 3MLZH 1U3HA 1QA9A 3O8XD 1GZQA 4AH2B 1MCJA 3NTCH 3F7VA 2GK0A 2AJVH 1YEGH 1ZHKB 4PJAE 3QCTH 1NGYB 3FT2A 4G6KL 1AQDB 3ZYOA 5GRVK 4HLJA 3GO1L 5DMIL 1NAML 4MSWA 5CILH 3RIAF 3BUTA 2J5LB 4JZOB 2BP3A 4BSWB 1FL3A 3BXNA 4IRJD 4D2NA 1XGTB 2QSQA 5KSAD 1HHHA 3SCMC 1H3WM 4EI5A 4P2QD 3H0TB 1AKJB 3QFJD 3GSNL 3NCFB 4ZOBA 4GXUN 4OCSL 5D5MA 1ZK9A 3M45A 4LSDA 4XCYB 4JFDD 3L1OH 2X1XR 4WEMB 2FATL 2WBWB 1S5HB 1EERB 2JJTA 1KV3A 3OXSA 4LCCC 5TE7L 1WISA 2GEEA 5AWNL 3O6FA 4G9FA 1I7UA 3C60A 3ULSA 1QFPA 1ZAGA 4Z95L 4NN6B 2MCPH 4CKVX 1Q9WA 1F8TL 4ZFZA 1NMAH 2NXZB 2MFNA 1XF2A 5E4EB 2LE9A 5JR1H 5HGGS 1ZXQA 3DYMA 4BFIA 2YOCA 3QUXB 5I8KH 1FP5A 2V2XB 4WI2A 5DJYB 4ZUWA 2ATPA 5TPWH 3PWJB 3BPOB 4MNGA 4OFIA 1UH3A 4LDEB 3S3SA 2QQNH 5LGJB 4TUKH 4R96A 5DD6A 2Y07H 5HY9A 5DFVD 3TPUA 5K9KB 2V7HA 3MOQA 5C0FB 2QQLH 2IPTH 1NGPH 1G6RH 5DGQA 5GS0H 5IF0B 4FABL 5E9DD 4XMKL 4JZNA 1GOGA 4UILH 2OMBA 2Y36H 4Y1AD 4Z76A 2P48B 3NH7L 2G60L 3L9RA 2R2HB 5E6ZA 4RZCB 4M7ZB 3ORJA 4BZYA 4HG4K 4JAMA 4MQXC 2P5WE 4XZUA 5BVJA 1MJ8L 1NEZB 1T1XB 2D7OA 1RJYA 5F88B 5K9OA 5IIEA 2ADGB 4IJ3B 3RWIB 3WXWL 5C0GB 2C3WA 1N4XH 4U1GC 3BPCB 2Z4QB 4ODXA 5C0AD 3QDGE 3VFUB 4NUGH 3S8WA 1D7FA 3G5ZA 4WV1A 3O45A 4JPVH 2W65B 3QDMA 2VXTH 1NC2A 4QO1A 1IBGL 4U2ZA 3KPSE 3QQNA 3V4UH 3LDBB 3NGBC 2IWGA 5FEBA 2HJFA 1BAFH 1C5CH 4N8PA 4R3SB 3U36A 4XVSH 2B0SH 4PRHA 1D5BB 1KC5L 1DQJA 3QCUL 5E8NA 2OXHA 1JN6B 4DKEH 4KKAC 4Z7UE 4X6DB 3C6LD 3C8KA 5IVNA 4UIKL 4LK4A 4LVOC 1CVRA 2CJUL 1MFDH 4UTBH 1K8IB 1JPFB 3HS0B 2ID5A 3RGVA 1LE5B 2AEPH 3T4YB 1YPZF 3H7BB 4P4KA 5D71H 3OKDA 4AM0A 2E9BA 4E0RB 3BDBA 4HXAL 1C5BH 2AEQH 1JK8B 4Z8FL 4YHOH 2E7MA 1MCDA 5E8OB 4M7KL 5IGXL 1YUHA 1RZGB 4LGSB 4P23C 5KS9E 1OSPL 2VN4A 3BW9B 3OX8B 5ACZA 3ZYIA 3SDDA 3U0PA 4NPYA 4U49A 3MV8B 4IS6B 4PJXF 4F7CA 3D3VA 1I1FB 1NCCL 3RUGB 4ELME 4NKOB 1IEAB 2XTJE 4LLQB 3I3EA 2DLTA 4RAVA 4Q74A 4OLWH 5D1QD 5C0CE 1T21A 5I8OH 3PIQB 2DQGH 1N64L 2EIBA 1HEZA 4LSQL 1XGPB 1QKZH 1BX2B 3P0GB 1JYVA 3A6BH 1ETZB 1AHWC 3BSZH 3F7QA 1JTPA 5BS0D 4X6EA 4NN5C 4OFKA 5D7IE 4O9HH 5MEOA 5EBMB 2OZ4A 4WJ5B 3MA7A 4XCNA 1IGYB 1T89C 2I60L 4PJIF 2I9TA 2QSCL 4U6VL 1VGEL 3KS0J 5EUOF 5GZND 4KZEH 1CD0A 1MUJB 2DI8A 4OJFH 4XPBH 2PCPB 4GUPA 1IGJA 2C9AA 4ETYA 3VG9B 2HT4C 4P2YA 4CNIB 2X05A 4WUUD 2NW2A 3KNBA 5DD1L 4K7PL 2XRAL 3INUL 3FN3A 4O2CA 4QHMB 1T5WA 2V5SA 3SDCC 1WBZA 3MRCA 1CVSC 4Z77A 2APXA 3P11H 1S7RA 2W0FA 4JFFD 1J8HB 3HC0B 3H9HB 5D4QA 4MCYB 3T2OA 3PNWB 5CD3A 4AEIL 1WZMA 1FZOB 3SO5A 1CL7I 1I8LC 1YQVL 2N56A 1U8JA 4NSKB 1TIUA 3RP1A 4FQHA 4U6TA 3U4AA 4G8GA 5IW6B 2EKSA 5DFTA 5TE6H 1WT5A 3BPLB 2WBJA 1R24A 5GRJL 4MD4B 4NUJA 3WNLA 2EDNA 1BZ7B 1YEGL 3EHBC 2HN7B 4LAJH 1LNUA 3QCTL 3PL6A 1U93A 5L9DH 1CXHA 4U33A 3LY6A 3QIWB 1IAOA 4JY6B 4MDIA 3VI3F 3CFDB 12E8L 5CILL 1WUNT 2GYSA 4RMVA 2V17L 1YJDH 4PRPD 4DN4L 3REWA 1RURH 2BSED 3SDAA 2Q1EA 4H8WC 3MREB 1MRFL 4CDGC 1MIEL 2MJWA 2EXYD 3TIDA 1JNHB 5FO8B 4OZIE 1QSFD 3GDBA 4XP4H 1I1AB 3TZVD 3TBSA 4P2OD 4WWID 5DJ6B 1I9EA 4K9EH 4YXHH 4P5TB 1HN1A 3HPJA 3SE3C 5IJVA 5I19L 5J57B 5TFSL 1FN4B 4QRQB 3BKJH 4G8EB 2J8HA 1MQ8A 1IEHA 4Z7VE 3BGMA 3QT2A 5IHBA 2BX5A 5CCKL 1V8HA 2MCPL 1RV6X 3HZMA 4R7DA 4K3DH 1RSFA 3QEHA 4K8RD 3QNXA 3U30C 1N0XH 4KI5E 2N7AA 3IVKA 3K8LA 5I18H 4YR6B 5TPWL 4I77H 2YUXA 5C0DB 2LU3A 1B0GA 2H3NB 4BQ9A 4TUKL 2YN5A 2G5BA 2GSGA 2X1PA 2Y07L 2VDQH 1CICC 3QHFH 4X4YB 5C0BA 1DQLL 3D48R 5BS0B 3RL2A 2IPTL 2Z93B 1NGPL 4F57H 1G6RL 3CFKB 1QLFB 4XPFH 3O4OB 4XCEB 2GIYA 3HTLX 3EOYG 4QEGA 2OR8A 4P46D 4CJ1A 3HE7C 5MEQB 4WFHD 6CGTA 2FHBA 3ZE2E 3AB0C 4NN7C 5EORL 3ARFD 2W9EH 1YNLH 1T03H 3C5ZC 1MNUL 4YBQD 5DHYA 5DO2C 1U8IA 4XB7A 3JWNC 3ZDZF 1HDMA 5DMGD 3RZCD 1KXVC 5BXFA 5SX5K 5IB5A 2ITCB 5T1KA 1KACB 5F1SA 3B6SB 5FB8B 3QH3A 4HWZB 4MVBD 4X6CE 1AE6L 5LXGH 2SEBB 5DD0L 3ARUA 5I2IB 1X5AA 5BV7B 2VXTL 2VDOL 2DL9A 3WXVL 1XH3B 2R56H 3VGFA 1FDLH 1IGCH 4LSSL 1G9NL 5JUEL 4LBEB 1C5CL 3VXRD 1G9MC 4XVSL 1B0RB 2B0SL 3JTSB 1LP9F 3ETBF 1R5VA 2P45B 3MRHA 2GT9B 4J3WA 4YQXH 4DKEL 3B9EA 1MWAB 4YHKH 1NLBH 4PTUB 1VHPA 2UY6A 2H32A 4PG2A 4UIMA 4RGNB 1GGIH 2FX9H 3ZE1E 5BMFH 4RA3A 3H3PH 2ADJB 3SKNB 1S9VB 1CDBA 4UTBL 1IKNC 1MFDL 1CGUA 3ARXA 4HFWA 5JNYA 4LLUA 4PRPB 3FRUA 3MRDB 1EEZB 3PHSA 4Y8DC 5D71L 3QI9C 4R0LC 4YDVA 5B38G 3LPWA 1K4CB 2VISA 4ELKA 2APVA 4WO4A 5HHOA 4N0FB 4LEOA 3MV01 1C5BL 2AEQL 4XAKE 3L3JB 1MLCA 1NANH 4YHOL 3FZUD 1QSFB 1VFMA 2QSTA 4AEHH 2C1PA 4IMLB 1KJVA 1C5DB 4P2OB 1CE6B 3EAKA 3MUGA 5IT2H 1NBYA 2B39A 3CFJB 2Z92B 1DQTA 3T0VA 1Y6NR 3SO3C 4ZXBD 5HBBA 4QT5A 5I1CL 2B4CL 4IRSA 3MMEB 3WKMH 4WCYH 1INDH 4KTEL 4OI9A 5BRZB 4OLWL 5EUKB 4RSVA 5T3ZE 2ESVD 2DQGL 3OJDA 2X89D 3GMOA 4GKNA 3TO4A 3FQNA 3A6BL 3JTTB 1D9KD 5JOFB 3BSZL 4X7CC 1EZVX 4OLZL 3F8UB 4XP6L 2OI9B 1MJJB 3RY6C 5E00A 2EE2A 3FB5A 2LU4A 3RX7A 1JHTA 5HGHB 2NY4B 2A83A 5JQ6L 1BIIB 2F8OA 1XIWC 1E6OH 4PJEA 3TNNB 4KZEL 4WW2F 4MA8H 2H1PL 3BP6B 4PFEA 1A7PH 5D2NA 4PJGE 2NY1B 3SKMA 4Q9BA 1HKLH 5DC0A 1C7SA 3RU8L 2C4FU 3HCVB 3MOAH 4PJCF 1OAQH 2A1WH 1Z3GL 1YPZB 3P11L 3RNQB 3MRQB 1AC6A 1TPXC 4ZOCA 4KMQA 1J05A 1ZA3B 3SJVE 3ARSA 3EDDA 4LLDA 4R90H 5E8DH 1LK2A 4HKBB 4KQ3H 2X4SB 5D1XC 4E5XB 2EDDA 4PJXB 4DZ8B 4JVWA 1G7PB 2NTFA 4L3CA 1CDUA 1JMXA 2EXWD 2VKWA 3UDWC 3RAJH 4QHNA 3X3FH 3ULUD 3BFOA 1KTRL 4QNPF 2AAVA 2ZCHH 4KK6C 1WK0A 3A6OA 1A02N 5D2LF 4RGOH 2DQJH 3WE6B 2D7TH 4PGZA 3EOAB 1ZHKA 4FQXC 1S9WB 4U6HA 1UCBL 5IMMB 4NBYB 3TT3H 1AQDA 3C9NB 3ZKXB 4ZFGL 4PJIB 3QB7C 4N0UA 4NNXB 5EO1B 1ZLSH 3WJLC 5EUOB 4BUGA 2BNQB 1MI5A 4RMTA 1RZ7L 1NAMB 2GSIB 5I1HH 4YXHL 4JM2A 5MERB 1AKJA 5J3HD 2N1KA 1FNGA 3OG4B 3LKQB 2IBBA 1K2DB 1CCZA 1IAII 3OAUH 2F54E 1S5HA 4PJ8B 5INDB 1CFNB 1BFOB 2BOBB 1N0XL 3BKYH 1OVZA 3UPCA 5ESAB 1V3JA 4ZXBB 5F9JB 3W11D 4PV8B 1F6AB 1OWWA 2R1XA 4M8QB 4DVRL 4I77L 1ZT4B 1TFHA 3GHEL 2FB4H 5GGSB 2AXGA 3B9KA 2ESVB 4X98B 2YPVH 5ADPH 5DJYA 1BHGA 2BVEA 4X8XA 3QHFL 5T33L 2ARJB 3KYKH 1D9KB 1II4E 3PWJA 1S7SB 1YDPB 2DTMH 4JE4B 5CEYA 4BH7B 3D5OF 1U9KA 1BFSA 4XPFL 1S7XA 3BH8A 3R8BB 3WIIL 2PO6B 2XZZA 1UM6L 3VXPB 3ARYA 4UAOB 2BSRA