1IGCH

Igg1 fab fragment (mopc21) complex with domain iii of protein g from streptococcus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
222
structure length
222
Chain Sequence
DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTLHYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTGMYYCARWGNYPYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The third IgG-binding domain from streptococcal protein G. An analysis by X-ray crystallography of the structure alone and in a complex with Fab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (antibody/binding protein)
molecule keywords IGG1-KAPPA MOPC21 FAB (LIGHT CHAIN)
total genus 38
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1994-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igcH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igcH01
1OVZA 5FDWB 5KSBF 3RHWK 1HHKB 5IHUH 2FL5A 1M7XA 3HZMB 5C0BE 3KPMB 4LARH 1KCUH 2E6QA 4LSVH 1DE4B 1RZKL 5CKAA 1NGPH 3MX0A 3S4SG 4JAMA 2YZ8A 1VEOA 1I9IL 4NHCL 4TSCH 4I18C 3CUPA 3JUZA 2W59A 4ZDHB 1G9NL 2FGZA 2BDNL 1KIQB 3FQTB 4PRDA 4MNGE 4P9HH 2BNUB 5J56B 4F7MB 3V0WH 4PJ9D 1JTTA 1T1ZB 1UXWA 3KPLA 2VXTL 2W9EL 3QEQE 4DVRH 4MS8D 3QIWA 4WW2A 4OCYL 1M7IA 3E2HB 3LD8B 2W1NA 4C59B 2QSVA 1UM5H 2P42B 4HH8A 4HFWA 2E7MA 3QUYD 3WJLA 2X4OA 4IRZH 1G7HA 2C5DC 1W2KT 5I1HL 1FGNH 2RR3A 4GUPB 4CKVX 4YHPA 4NQCA 5K9KB 1NBYA 5D9SA 3K46A 3QIBA 5D1ZB 1NFDA 4XNXH 1JGLL 5BS0E 5J9PB 4M1DL 5FYLE 2WBJC 2FSEA 5AWNL 4LOUD 4ZTOL 2GY5A 1KENH 4PV9A 3L7EB 3RA7H 3OPZH 2CIIA 4XNZC 1C5BL 4XVSH 1XZ0B 4NO5B 4K7FA 3NPSB 3UTPD 4Q9RH 2NX5B 4NQSA 4XX1G 2RIKA 1BX2A 2NY6C 3MODH 5ISZD 3H9SB 5IMMA 1ZS8A 3UEZA 1YA5A 2BVUA 3C5ZD 3INUL 1WAAA 2UYLB 2ADIA 4WHYG 3ZT7A 1NJ9A 2YBRA 1QFUH 3EHBC 1J1PL 4NQTA 1KC5L 2L7JA 1INQB 5FOBA 2WWMD 5JR1H 1Q8MA 1KIRB 1MHCA 4M7JL 3U36A 2MQCA 4BQ6A 4H1LA 2FBOJ 3QUMA 4POYA 2NY1D 4PJCF 4BSVB 4CVWA 2AABH 2D3VA 1T2XA 3EYSH 3KXFA 3L6FB 1KJVA 3VFPB 4UBDC 4NZRL 2HFFB 3SEPA 3BDYL 1F4WH 4QGTA 2D31A 4ODXA 1B9ZA 4G6FB 1YMMA 4EZMA 5C9KA 1MHHA 2PO6B 3GSUA 5DTFB 2FJFB 5C09B 3IDMA 3VFOB 3I02A 4Y19E 3ZYJA 4F7MA 1IGMH 2P8PA 3MCG1 4BSVA 4DUXA 5TE6L 1RUQH 3HLAA 4F15C 1TPXC 2QADB 3GJFK 3MRLB 4D9QE 4GKZA 4S1SH 3OB0K 5DJ0B 4JPIB 1K4CB 4DZBA 3CUPB 2OL3B 3D69B 4OSUL 1FPTL 3T04D 8FABA 5F6HI 1WWWX 5SX4I 2X40A 1P4IH 1A3LH 1DCLA 4OF7A 2A6IA 3GK8L 5TF1L 2NR6D 4JE4B 3O4LD 1IGIH 4HS6B 4QHUA 5IIEB 1IL1B 4JKLA 3B6SA 4YHKL 1BMGA 4Y2DC 3ZE0E 3KWWA 4Q2ZB 1UJ3C 2VDLL 2YD4A 3P9MB 4R96A 4Z77B 5GRVK 4F7PA 4PGEB 2R0KH 4XNUH 3P77A 5F1NB 5CD5C 1ZOXA 3RHWF 2QSTA 3LKNA 4GO6B 3SCMC 4K7PX 1Z9MA 5J6HB 3NPZB 3QIBB 3ZDYF 1OF2A 3FT3B 4G6JL 1M7DB 3P4OB 5DI8A 2WLZA 3QULB 3QCTL 3MACL 3BP7A 1MFBL 5DJ0A 3O9WC 2XIDA 1R5IB 3Q3GA 2MCG1 1P7KA 1XT5A 4QHLB 1XGPA 4FQ2H 3VDBA 5CP3H 3IAPA 2AJVH 4IRJB 4MCYA 1K2DB 1NC4D 1R3HB 4KI5D 3TO4D 5BZDA 3GIZL 4HKXB 5J1AA 5E0QA 4DTGH 4ZUSA 1IGJA 1T4KB 3H2WA 2C26A 1LP9E 2HT3D 5DMIH 2X9XA 1BLNB 2R0ZH 3U2SB 4XCEB 4JKKA 1IKFL 1G6RH 5KVFL 2VLRA 4OM0L 4Z7NE 3VWJC 2P8MB 2R2CA 3HG1D 2I5YL 1KBGL 5FCSH 3PV6B 1CD9B 3TJHC 2PR4H 5HHVL 4WNQA 1A6PA 4JO2L 4M61A 2DQCL 3OJVC 5HYJD 5IVOA 5FV2A 4LFHD 1F42A 1K3IA 5GS2D 2QQLL 2F53A 1QRNE 4GSDL 1QR4A 2ZNXA 3BT2L 3MYJB 1QSED 4ZODA 3QDME 1NDGA 3LKPA 2WUCL 5E6YA 4NO0D 2CDFB 1P6FA 1TMCB 3HNTL 3HPLA 4YHZL 3D2UA 2OQJA 1EFXA 1QBML 2UWEA 4A2LA 4ZTPH 2DL9A 4U7SA 3EO0B 2XZQL 3FO1A 3LRGA 4O9HH 4U1GB 3BGFB 5KW9L 3OAUL 2D7MA 5T5NF 4FQJL 4AIZB 1CVSC 3RNKA 3TBSA 2MPAL 1NFIA 3VXMB 4OUUB 1K8IB 3GMQA 4X5XB 4X8JB 3A6OA 1DBKH 1A3RH 5CLTA 4JREB 1FGNL 4LPVA 1NLDH 2CK2A 3LHPH 4FQXD 1KEML 4RA0C 2H41A 3M1BA 5MEND 4N1HB 4YH6A 5EU7C 3BH8B 4O5LH 1T2QH 3B8YA 2GITB 2VL5A 1NGXA 1I4FB 4AJ0A 5I1LA 3OF6A 3O3AA 5JDSA 1JUFB 2J4WL 4KWUA 1PFCA 1HHHA 1X5AA 3PWNA 1AGFB 1E4WH 3DYOA 1EAJA 1OWWA 4WUKL 2VSDA 4DGYH 5I15L 2ZUQB 1EUTA 4Z7VB 5IMMB 4HFUH 1BVLA 4MCYB 1T6VN 2VLKD 4ZUUB 1OLZA 4LSRL 4MAYA 1ADQL 4BQ8A 1S5IH 3QCVL 1KG0A 1YQ2A 4CBPA 4TSBH 5DLMH 1INEL 3TH2T 1HWGB 4QRPE 4RGMB 4CADB 1JRHI 3BVNA 2HKFH 1CG9A 4MA7H 5E6IC 1MFEL 1OW0C 1VFBB 2BSSB 2JJSC 2UWEF 1FIGH 1NMBL 1W72L 5IMOA 5T3XH 4I77L 1RULL 3DBXB 2OTWA 4NO2B 3ARBA 1AXSB 1HKLL 3MLRL 3K8MA 4EXKA 5E8EA 1BQHG 3GSRB 4UTAL 4KJWC 1LE5A 1EHNA 3RWIB 4Z76A 3AM8A 4J3UA 3KLHD 1TVHB 1P4LB 4G3YH 3SGDI 1FCCA 1J8KA 2R0WH 3U46B 3C9NA 1JHLL 3OR6B 5EOQL 4UAOC 3H9HA 5JO5B 4DN4L 3NACL 3UBXB 2FEEL 2VR9A 4LSVL 1LO0H 3TPKA 5CEXA 4MJ2A 4E41A 4E9LA 3GMPB 43C9B 5AZ2H 3C5JB 4L8SB 3GMLB 5FYKH 2IBBA 1ACZA 4CVZA 1CLZH 1CL7I 2C3XA 1JGEB 4GOSA 4F7EA 1Y18A 3MPCA 3RDTD 3AAZA 1BHGA 1DUZA 2VQ1A 4UIMB 4RMVA 3C6SA 4F57L 3TA3B 5I8CA 2IAMA 3LH2L 3KJ6H 4JREC 4QRPB 3QSKB 5DQDL 1RJLB 4X6FB 1EJOH 4P3WA 5ALCH 3BUYA 5FV1L 5DEGA 1R3HA 4AH2A 3PWUA 4HPYL 3HZVA 1Z2KA 1AGDB 2FL5B 3GM8A 4RAUA 4D0DB 1QHOA 4U1GC 1S9KC 4JHWL 3PIQA 3N9GL 4PY8J 3KPSA 4A6YB 1ZLVK 4RNRA 2V2XB 1QFWH 4YX2H 4ONFL 4V1DD 4GKSB 1J87A 5IEKB 5LQBH 5EU4A 3ARDA 3L3DA 5MI0C 1WT5A 1GGCL 5FOBB 1INQA 1A9EA 3MJGX 4PPTA 4N9OB 3FOLB 2EYSB 3WHXA 4NRXB 5I1CH 3QEQA 4QRPA 4PJCE 3ILPB 2H9GA 3O11A 3CLEH 1F13A 4NZRH 4NNPH 3MLPA 2H2SC 4EOWH 1C16B 4XP1H 4X7DC 2PR4L 4WFED 1J8HE 2EZ0D 4BFIA 25C8H 3VWJB 2HKHL 4NM4L 4XP5H 4N8VA 4K94L 5DD5H 3IS0X 4P2CG 1G7PA 4LEXL 5FYKD 4LCIL 4RQQA 1DLHA 2A83A 4XMPH 4UUJB 1IKNA 1NQBA 1YNTA 2X1PA 1MI5A 1DQDL 5A2LH 1AFVL 2NY7L 1SVZA 3MUGB 4LIQL 2BRRL 3LY6A 3QO1B 4I0PB 4QHKI 4RBPK 2R1WA 4NZDA 3QJFB 4JO4L 3HLAB 4M6AA 4RAVA 4W4OC 5GJSL 1G7IB 3T8XB 4Q6IA 5C09D 1CXLA 1SEBA 1MRFH 1G7QA 1KPRA 3MBEA 3QIWB 2DI8A 5EU6B 3PDOB 4GAYB 1Q9OA 1UB5A 1F11B 4L4VA 1RU9L 4HH9B 3DTXB 1QRNA 4JFPB 3TIDB 3GB7A 4WY7H 5I8EB 2BNRD 2UV3A 2PTUA 4ZUVB 3MJ9H 3GGWB 1AO7A 4XAKE 4PBVC 5C0ND 1C08B 2BERA 4MXVE 3IKCA 4YQXL 3B9EA 1JIBA 5FUZH 5TDNA 5HGBA 4ZFOL 5INDB 4C4KT 1ZHLB 3BWAA 5C0AD 4GFTB 4U1SA 5LBSH 5LGHL 5C2UB 2EDBA 3W39A 4JVUA 1D5ZA 5AZ2L 5DFTA 4QRRD 1NUDA 2HTKC 3O4LA 4XP9L 2GITA 1WK0A 5L8JB 1Q9OB 1UB5B 3RP1A 5FYLL 3LCYA 5K9OB 3MR9B 3FO9A 4UIKH 2DJ4A 4IRZL 1ZANL 2ATKB 4YBLC 5BJTB 5JMOC 3VXQA 3UC0H 4F15B 3I6GA 2H6PA 4PLJC 1GIGL 1NBVL 1A9BA 3DO7A 4M6NL 3SKOB 3VGBA 4OZFH 5DHYA 1J0JA 4IS6A 2PO6C 4YDJA 4DZ8B 2EC9T 4JQVA 4TNVF 1BQHB 5CJBA 4DOHB 5E1HB 4KROB 3Q6FB 2DD8L 1FSKC 1MCSA 2QSQA 5FUOH 1UB6B 3GSVA 1YNTB 1FNFA 1MCBA 1IC4H 4PJBA 2DQGH 5ACLA 3U9PH 3CFCH 4PJ5D 1EFXB 2UWEB 4KI5C 4L8BB 4UZGA 4XT1C 2LTQC 3TO4C 2MCPH 4Y16A 4XBPB 1QSEB 1GOFA 1TDQA 2G60H 2VLJD 5DEZA 3CSGA 2VDOL 2DDQH 1MH5A 3WXWH 1QNZH 3STLA 2JF1A 1CYGA 2VN4A 1A7PL 4K9EH 4X98B 3EDDA 1KB5L 2BOBB 1ZXQA 5J06A 5FYLD 4NNPL 1A7NL 1ZLWH 4Q9RL 1VA9A 5IVXA 4JLRA 2ADFL 2YSSA 3OB8A 4H5SB 1C12B 4C54A 4K94H 5HHNB 3BEVA 3LPWA 1FO0H 4YUEL 1RUML 3OAUH 3TJEH 2VDRH 4GJTB 3DTXA 4JFPA 3TIDA 4XH2B 1WFOA 1UENA 1LP9A 1QD0A 3M1BB 4V2CB 2W92A 3A67L 4RA3A 4S1SL 4LMQI 4I2XE 4Y0GA 3L3HA 4P9HC 1LE9B 5L9DL 5C0RH 4L29A 3RIAK 3X17A 1RZFH 2OS7A 5KTEH 4YEFA 1HIMH 2XQBH 2HWZH 1RUAL 2IADB 4QHNA 3UTSB 3FMGL 2NNAA 4YNYB 2HG5B 5IJVA 4JDVB 4H26B 4N9GB 3BJ91 2IAMB 2JE8A 1J18A 1GPOH 3LD8C 3OKEB 3SDDD 4A6YL 4FTVB 1PLGL 5E00A 4NUJA 1M6OA 1RQ5A 2KL6A 3MC0A 3IXTB 5DGRA 1OF2B 3SKOA 1EEZB 5EC2A 1XGQA 3JV6B 3T0XA 5KVDH 3EHBD 2VB5A 1Q94B 1I3RA 3GFUA 4I18B 4LVOC 15C8H 1IQWL 5GGTL 4TSCL 3GJEA 3D3VA 1A02N 4H0IA 2WAHA 5LAXA 3T3PE 5D7LD 3ILPA 1E27A 5SWSE 5DHVB 5JW3L 2X89A 5GS0D 3NTCL 5HJ3B 4MQ7B 1U8LA 1QA9B 4FA8A 1XGUA 4JFEA 4Z76B 1OPGH 4ELME 5CSGA 5CEYA 3ARED 3D48R 5ICYA 1H3PL 1YY8A 1F8TL 1H5BA 1YQVH 4ORGA 1OAZL 3CSBA 2HRPL 5A2JH 4IDJH 1BBDL 2BSRA 4Y89A 2F8OA 3BKMH 2C3VA 3QO0B 4CRPA 1NMCC 3PWVA 4JRYE 2R69L 5T3XL 3RGVC 4HWEL 3MV8D 4X7TB 2ZUVA 4JFXB 4PP1D 3UCRA 2AEWA 3RUGB 2V2TB 3MRDA 3DX7A 3GHBL 3CC5A 3PXJA 5DR5H 2HMID 3T8XA 4JFFB 4O2FB 4RZCA 1HHHB 3PABB 3MOQA 4YDVB 2IH1B 3HCVA 2AQ1A 4RAVB 2AXGA 1E27B 1M71A 4HWEH 1LO0L 4BZ1L 5K93A 5T1MB 1M7DA 4OF5A 4FG6C 5F89A 1YYMH 4XVTL 5I17A 4DJMA 4OLEA 4OZ4B 5EIIB 1ULVA 4PJGE 5ESAA 1BIIB 1PKQE 2FZ3A 4WWID 4XTRD 3ZE2E 3DJ9A 1T1XB 3INUH 2FR4B 1UCTA 1CIUA 1QOKA 1MCOH 1OL0A 3QDJD 3S3SA 1OARL 5CBEB 2VXVH 4OD2B 4YFEA 1A14L 1SJEA 3TESA 3RVXC 3SDYH 1JWMA 2VTFA 1BREA 1AP2A 1VPOH 4WW2F 2NY0C 1IGFH 2P24A 4ERSH 4LQFL 4BH8B 4TN9A 5D6DC 1L6XA 1NCAH 3SBWA 1JMZA 2APTA 5C0FB 1J0KA 3ZKXB 1D9KD 1S7TB 3NH7H 3KPRE 3VWJD 3ZDXF 1A7BA 4KVNL 5HHNA 4PTUA 3BJLA 1AFVH 1IEAB 5L2JA 4KTDH 5GGRB 3FFDA 3LSOA 3MJ8B 3ULUD 2Q8BL 4W68A 2PW2A 3X14A 1X4ZA 3QEQD 5EBMB 5F7DA 3RRQA 1NEZG 5F72S 1ONQB 3V79C 4HT1H 4ODUB 1MCFA 1OTTC 4PJAE 4JFDE 3C09B 4FNLL 1SEQL 1DEDA 3OZ9H 3AREC 4R6UA 2J2ZA 1XGPB 1Z9LA 4GW5B 3PWPE 1C5CL 1XIWB 4EJ1C 3UTQB 3QUXB 1AI1L 4G7YH 5DK3A 2X1XR 3RVTC 2DMKA 2Q7YA 2AK4B 4U1MA 1QYGL 4HJ0C 4JM2A 2D0FA 1MF2H 2PUQT 4RRPG 1JWSA 4QNPF 4Q9QH 3EFFB 4WUUA 4DKFL 3L7EA 1FYHB 3IDYC 2GW5A 4GQ9L 5DZOA 5IGXH 4LGSB 2MMXA 1ZEAL 2R69H 3MRJA 1J8HA 4K71B 5JHDE 3DI2B 3VXQB 2OZ4A 3L3HB 1LDSA 1RIUL 1MVFA 1P2CB 5EO9A 4MB4A 1OWRM 2NY0B 4G8IB 3MLZL 3QEHA 1BQUA 1HHIA 2AJXH 3B5HA 3UTQA 4S1RH 3NBNA 3IU3B 2BNRA 2CRMA 1FIGL 1KACB 3IFLH 4CU7A 4P49A 5IBLC 3C6LB 3DV4A 2VITB 4Z7WA 3QNZB 4M5YL 2XT1B 4OGAD 2E9JA 3MLXH 3KPRA 2RAMA 5BV7C 2V2WA 4R4FH 3MJ7B 4ODBD 5M7QA 5GRXG 4EVNB 2QL1A 1T4KA 3KR3H 4EUPH 2VZ1A 5HVHB 2IG2L 4X9HA 4FFWC 5BV7L 2VQUA 2B20A 4AG4H 4MQXD 1JNLH 1BD2E 1ZLSL 3HI5H 3B5GA 3NFSH 1QRNB 1UH3A 4KRNA 3BXNA 2D7QA 2AJSH 4AEIL 4M4PA 4L9LC 3NCBB 3QEUB 4WO4A 2VQTA 4JG1L 3TBYA 5MEOA 5B38G 1S7QB 3GSNH 3KLHC 3H9HB 3SO5A 5JO5A 4P5TA 4EBQL 1RVFL 2LU3A 4PJAA 1ORQB 4OLWL 3UTTE 2YD6A 1I7UA 1MY7A 1S8DB 4QOKB 1S3KL 5AG9A 3V7AG 3VW3H 3TZVC 4WUKH 5C6PB 4D0BB 2JJTA 1NMCB 4XNMB 5BZWA 3MLUL 3TJEL 4NC2B 4LRNH 1IGYA 4YZFF 1QLEH 5TF1H 5ESQA 1TVBB 1Q0YL 4Z0XA 5TDPA 4G9FB 2FB4L 2IFFH 1FZJB 1U6AH 1H3TA 3HFML 5GISL 1S78C 4JPVL 5C08D 4OLYH 4ODSH 5E03A 1FYTA 4XP1L 3VI4E 5J9PA 4NRXA 4QCIB 3CFKB 2R0LL 2A6JB 1Q0YH 4WJ5B 4LSQL 5DJ8B 4U6HA 3CK0H 4B7LA 1FL3B 3VXRE 4JPWL 4TVPD 2X4UB 4X80H 3EBAA 1F45A 4PJAB 4Y1AA 4QF1A 2VL5B 5CZVH 1I7RA 1RFDL 2ZJSH 2YD8A 1UEYA 5DC4B 1XCTA 8CGTA 3LOWA 1BJ1J 2XTJE 5I76B 1RY7B 1JNJA 2UY6A 5FM4A 4ZPTB 3TVMB 4IIQB 4LSQH 1XMWA 1T0PB 2E8ZA 2H3NA 5GSVA 1VPOL 4PS4H 1LDPL 3HUJF 1FAIH 4U2ZA 5IFJA 4Z18A 1U8HA 4IHOB 1I1YA 1QO3B 3DX6B 1MCJA 3TV3L 5C0NC 1ZVSA 1ZANH 3AC0A 3L9RB 1EJOL 4XWOD 2M8XA 4GSDH 4EDXB 3OKLB 1CD0A 1KBGH 4KFZC 3MROB 3T1FA 3MO1B 3DETC 3S37X 2IPKA 2BSTA 2I24N 2GSGA 5DSCA 5E5UB 3PUCA 4NKOA 3VFMB 4X9BA 5MEQB 5ICXA 5ACMA 3PGDB 3IXAA 5H35B 4HWBA 3GMRB 5IIEA 1EGJA 1F58L 3C87A 3UYPA 1T04A 4DN4H 4PBXA 5F1KC 3VGAB 3B9KB 4ELKA 2OX5A 4OIBA 5FYJD 3GBNL 5K9KA 3F12B 4UNUA 5I6XC 3Q2CA 3RL1B 4PJ9A 5TQ2L 5E8PA 3QI9C 1HDMB 2QV2A 1VB9A 1YUHB 1UWXK 4DVRL 3VWKD 2MKWA 5D1ZD 4IRJD 1FYTE 3OR7B 2BOCB 3DGGA 4DKEL 4YIQA 1OAQL 3S36L 3MLTB 4KROC 5HHOD 1MHHB 2CH8A 5JXED 3SDXF 4Z7VA 2EC9U 4JQXC 2HMIC 3A6CH 1ZK9A 5D7SL 2NYYD 5CBAA 4TUJA 4DWHA 4LIQH 2APXA 3D0LA 4RGND 4LEOA 4XH2A 2OYPA 1NCWL 3QNXB 4U6XA 4J8RA 3VGEA 3BP7B 1H8NA 2H26B 4XCNA 2X4UA 2ICWA 5J8OA 3SN6N 4FG6D 5HD8D 1DUYA 2GTZA 5DHXB 3IRPX 3X3GL 4CGTA 3WNMA 3DWTA 5BS0B 5L2JB 2C1OB 3LS4L 5IQ7H 2HFGL 1KIPB 1ZT4B 1GPOL 3VH8A 1IAMA 4M62L 5J89A 2R9HD 2VAAA 2DQEH 3CDGB 4OIIH 4X7EC 3L3KB 4OKDA 4AL8L 5CD3B 3B9VA 1RJZB 1HIML 1CLCA 3KPNA 3AB0C 3D5OF 2VXUH 5E08H 5GQBA 3FHAA 1ZTXH 3IAGC 2HP4A 1AGCB 1KT2A 3SDCD 1QSEA 3KGRA 4Y5YC 5JW4M 4YR6A 5DJ2B 3V6BR 2EH8H 4GAJL 3D2UD 5MHSD 3WCYA 3CVIH 3BRDA 3QQ4B 4OZFB 2CLZB 1JNNL 4FQQB 3BZ4B 2OQJB 4XRCA 2UVEA 5C07B 1NSNL 2ICWI 3UJJH 5KSUB 2VUOA 3S97C 2ZKHL 3BDYH 4R2GC 3SDDC 35C8L 5HHXH 2C4XA 2A77H 5FM5M 2NPLX 5DTFA 2OK0L 1V5JA 1I1AD 1D9KA 2YA1A 4Q9CA 1GC1L 4GRLA 5KSAC 4S1QL 3WFBH 2XNAB 4JY6A 4M1CD 5FO7B 4QYOA 3PHSA 5HHMD 5T1LB 1D5XB 3SO3B 3O0RL 5FO9A 2FCBA 5HDQH 4YO0A 1Q72H 5H94B 3OF6D 5I9QC 4G8GE 2NXZB 1X5KA 3NGBB 2OJEB 1N8ZB 5K9JH 3WS3A 1H3GA 4FN0A 4N1CA 4LDOB 1G9NH 1MCPL 1X5HA 3SGJC 3S96A 4HIXL 2DLFH 4R97B 3PDGA 3LN9A 4N0RA 4M7LH 1CDIA 4FQIL 1J05A 5SWSD 1WWCA 2PXYC 4MAYD 4OM0H 4YC2B 3HE6D 3MSPA 1NC2A 1B0GA 2IH3B 1N3NA 3BQUB 4RMTA 5F96L 3VFTA 2IPTH 4WEMB 3BYTA 3CFIC 1LD9B 3DVFA 4CU8A 2BVTA 4N5UA 1HQ4B 3JZ7A 1MFBH 2CO6B 4N0UA 3IDNB 2IG2H 4U05A 3ZSTA 1X5FA 4CDGC 1ZSDA 5CJ8A 3DVGA 4ZQKB 4AMKH 3GBMH 5GIRB 3MLXL 1PW3A 5I1EH 1OHQA 1X6LA 5KVGH 4TVPE 5HI3C 5CGTA 3CD4A 4U1IB 1UXSA 1KFAH 2Y36L 3U30C 2IMMA 2I07A 2J5LC 1I3VA 4QGYA 3MLYL 5TE7H 1H8OA 5HI5D 2E7LC 1H0DB 1G7JB 3WFZA 1TQBC 4KTYA 1OAUH 5INCB 5D5MF 5E8OA 1P53A 4I8DA 3EW3B 1KIQA 2ILLA 4OBRA 1PG7X 2CIKA 4KV5E 3RDTA 1FZKA 4YXLL 2WBWB 2NNAB 2XTJB 4YNYA 5SWQA 4JAMB 1U8IA 2UUDH 2QKIA 4OAWB 3BWAB 3X13B 4HSQA 1CIDA 4K07A 3ULVF 3LKOB 4K8RD 3V6OC 1KV3A 4KGJA 1MFCL 1KJ2B 3HNVL 4JR9L 3P9LA 5C0RL 2AEPL 2A0LC 1HDMA 3PHQB 5KTEL 4R7NA 4H1LB 1A4KA 4PY7A 3V5HB 4RAUB 1A0QH 1Q1JL 5CFHA 5J12B 3QISA 1C5CH 4OCSH 5JW4R 4RRPA 4OTXH 1D5MB 3PE9A 1AI1H 1XGUB 4G7YL 1VGEH 5T3XE 5SWQB 1K6QL 4U6VH 1T83A 3QNYB 3VFVA 4XCFH 4O02L 5CBEA 2Z8RA 1VDGA 4NJAL 3W2DH 1HSBA 5D7KD 1Q9KA 3DXAA 4YGVB 5EBWB 5GRUH 3RL2A 1U91A 1J10A 4JPVH 4GH7B 3BW9A 5D1XA 3E6HA 3U4BL 3B43A 2P8LB 4L8BA 5SV3A 1EEZA 5EC2B 5FGRA 3CH8A 3BIKB 3QBTB 5DD3H 2Q1EA 1J1PH 4JRXD 1YEGL 4GW4A 4HBCH 2A6DA 4WU5B 1ZVSB 1P9MC 2CR3A 3L9RA 4BQ9A 1FJ1A 5KZCD 3CFCL 4Q74A 2DMBA 4RGNE 4LSDA 4GXUM 2HJKB 2FYYB 3DVGB 4ZQKA 3C60A 1YYML 1D6EB 4YDVA 4KXZI 5JPMB 3WNNA 1XEDA 3QIUC 1J1OL 3QXAB 5D96C 3QWQB 4MXWL 5FKPA 2VZVA 3U4EA 1FL5A 3OKKA 4K2UH 2ATPA 4MVBC 4NM8L 4WI2A 3QI9B 4K7PH 3CVIL 5I1KH 5KG9A 3ORJA 5HI4D 4A6YA 4N90D 1UWGL 1JL8A 1A7NH 2P5WA 4QHMA 4Y4FC 1JYVA 1QRND 2CJUL 5EWIL 3TO2A 1MLCB 3VXRA 1FHGA 2VXVL 5LXGH 1CFBA 5DJ8A 4WDIB 3SKMB 2P46B 4BSJA 3O6ML 2ZNWA 5D1QB 5DEGB 1AP2B 2ITDA 3LMJH 3CSPA 1U8IB 3WDJA 4GT7A 4OGAC 3TNMB 1ETZB 1QLRA 4GMSL 2UUDK 5FEBA 2GKIA 1MIMH 5C0CE 3GSNB 4HIEB 3IFNH 3K81A 4E41D 4ZUVA 2OJZL 1T5WA 3BH8A 3TH3T 1XF5B 4LLQB 3AY4C 5B39B 5IB1B 4X4YB 4GRLB 1I1CA 3WFEL 5T1DL 4R4BA 3OJ2C 4Z78B 4Z95L 4NCDA 4JJHA 1HYRC 3AS2A 4HV8A 2ZUTA 4P2OD 5BO1L 3TNNA 1IBGH 5GIRA 4JG1H 2FHFA 5I73B 2M1KA 3HMXH 2LVCA 4G8GA 4MJ5B 4YDKH 3OV6A 3HPJB 1MJ7L 4WFHD 4RQQB 4M7KL 1CZ8L 2NY2B 4PJEE 3VD3A 2AEQL 4LLMB 3WJLC 3VDAA 1MIEL 4L3CB 4OV5A 1QVOB 1WBZA 1B90A 4HMEA 4EN3D 3CXDL 4Y16D 3QIBC 4PRPB 1BECA 2XQYG 4AIOA 3G6JB 5JOFA 5FGBC 2Y5TB 3QRFM 1Z9SA 1NLDL 1G1YA 4HZLA 2OLDA 3E8UH 4PJ8A 5IK3A 3RWCA 4UT7L 2DLEA 3IDJA 3BPOB 2Y7QA 1F6AA 4Y2DB 5JPNA 3HC0B 2JJWA 1QSFD 3UP1A 4EOWL 2EC8A 3KS0J 2VLRB 2V2XA 4QRUA 1JNNH 3ZKMC 3GSOB 4D9LL 4NZUH 5BRZB 2X44D 4GAYA 4XNYH 4TSAL 1I7TB 3ZT6A 2R29L 1EV2E 2IBGA 3LKRA 4JO3H 2EDKA 5TE6H 2RCSH 4H20L 4KQ4L 2BRRH 4ZFOA 4C56D 3U6RA 3L95A 2J8UE 4OAWA 5KSVB 1UM4H 1T5XA 3H7BB 2V9QA 2QSCH 2CIKB 3DO3A 5DD6A 1Q1JH 4D2NA 4KZEH 2ICCA 3C6SB 5DURD 5I19L 4Q9BA 1SMAA 4F2MB 1DLFH 3GRWL 2Q7YB 4L3ED 4FZEL 2PYFA 4XZUA 2P45B 4POZC 3FCTA 4Y4FD 4GW4B 4YDJB 3EOTH 1S78D 3ZTNL 2FZ3B 1G7LB 5IW6B 3IFPA 2Y9RT 3NCFB 5EBLA 2P8LA 5JORA 3WD5L 2PW1B 3HNSL 2CKBB 4KJYB 2VRAA 2CO7B 2PYEA 5IHLB 3NA9H 1ZVYA 4JANA 4M1CC 3V95A 3NIDF 4GRLD 1KLFA 3QWRA 3P73A 3D3VD 4I3GA 5HYJB 3C6LC 3ABZA 2EIZB 4LARL 4MD0A 3B9DA 3MA9L 2HTKD 5DUMH 3IDNA 2X70B 4N0UB 43CAB 2DQGL 4XAKD 5E8EB 1C5BH 4XVSL 1OSPL 3T1FB 1S7WB 1DUYB 2GTZB 3N1GC 4HS3A 2BCKA 5LWYH 2P8MA 3IDIA 4P46A 3O3BB 4JM4L 4LQFH 3IJSA 3TYGL 2D0GA 4GMTL 1FZMA 1JNHA 3E3QC 4P57B 1KG0B 3SCMA 3F6IA 3D9AH 3DXAE 3FL7A 5C0BD 4P2QA 2E6PA 5D1ZC 1LVEA 4N5EC 3MGOB 4O2EA 5SWSA 2P24B 3QCUL 4IRSC 1HI6B 2WK2A 3X13A 2ZWLT 1YY8B 5AG8A 4P48A 3U9UA 3RDTB 4U49A 3IDGA 3TA3A 4HZAA 5L6YL 2AV1B 1TZIA 4NRZB 5AEAA 2R1WB 2K7QA 5MENB 3S34H 1SY6A 1T0MB 1S7SB 3IDUA 2GT9B 3DX8B 2OTUA 4GMSH 4HQQH 4M4RA 3HAEB 3O6KL 1HZHL 2R1YA 3ARWA 1OLLA 1L9NA 4KTEL 4OZIA 4U1IA 2HT3C 1U8PA 3LMJL 4LRIC 5DUBA 4IMKC 5ISZA 1J9CT 1A21A 2NW3B 4MJIE 4Q2ZA 3ZDZF 5CZKA 4R0LB 4K23L 3VWKC 1HSBB 1D5BB 2BNRE 3RX8A 3BZEB 4H8WH 3LQAC 5DD6B 4G43A 5DJZA 4MNQD 1QPPA 4GG8B 3VFVB 2DI7A 3MO1A 1RZJL 2Q86B 2B7DT 3CVHA 2FIKA 3UTSD 2EYRA 5EU3A 3RTQA 3UBXI 4H25B 2DLIA 1SY6H 2ZG2A 2HLAB 3MFFA 5I15H 3WV0A 3PWLB 1WAAE 4NQVB 5I8OL 2V6HA 3NABL 3NIFE 4Y4HC 3QA3A 1BVKA 4PRBB 1RZJH 3VH8B 5F9JA 1BJ1H 3MBEB 1A1MA 1P4BL 4NWUL 3QFJB 5HPMB 1XCTB 5HVWA 3CGTA 3WDHA 1IC1A 4ZOEA 2ZPKL 1U3HD 1X4XA 2AEIT 3GI9L 2FGWH 1MRCH 3QXVA 4PRHD 3V9FA 3WD5H 4HWZA 4KRPC 1FVCB 1BF8A 2ZUSA 1BFTA 4RAHA 3LQAH 3G6AA 3R06A 3G6JF 3U0TB 5GJTL 4X4XB 4Y19B 4ZNEE 4IMLA 3LQZB 4G8FB 4U1KA 4WFFD 4FXLA 3V5KA 1OGTA 2I07B 2Y06H 5H2BB 3IJYA 5CEXB 5GGSA 4NQUA 5HHME 5C0EA 2I5YH 2IAND 4ODVL 1KPUB 3MUZ1 3WYRA 5E9DA 3OR6A 1IM3A 2ICEA 1L7IH 5IQ9B 3WFHA 2DQJH 3NAAL 1IGYB 4PFEA 1OGAA 5CWSA 4MJ6A 2O5YH 3OKMA 3RGVB 3FT3A 2ZCHH 3QDHA 1CVRA 3U0WL 3P11L 3QXDA 1KLUA 3REVA 1IGCL 4MAUH 1RURL 3UTPE 1PBYA 4YXKH 3QRGH 1E6OL 1OW0A 2CK0H 2ICEB 2XN9B 5IEHA 1EIBA 1JZ2A 3ARBC 3SY0A 1FNGA 4P5TB 5K9QG 4J3SA 1JWUB 3P4LA 1BOGA 3HE6B 3W81A 4PLKC 4PR5A 1A7OL 3ZYOA 1MNUH 3VXRD 4UQ2A 5GSRA 4CMMB 4NKQB 4U1SB 3G04A 3VFWA 1U9KA 4HG4J 4JFFE 2BFVL 3QPXL 2CK0L 5T1DH 1U36A 2V7HA 5TPWH 1M4KA 3DX9B 4C55A 3RUGE 3O3AB 5ADOH 4XCYA 3G6JA 1P4IL 1CZ8H 5D7JA 2PO6D 1LHZA 5LGKA 4QYOB 1CWVA 2CRIA 5FB8A 2F53D 4NGHL 2AXJA 2VAJA 4CMMA 3VFUB 5E2VL 5HYFA 5GGRA 1MWAB 2N7AA 4AM0B 3BESR 1ZHKA 2IAMC 4KJWD 3TV3H 5BO1H 1OT2A 3FT2B 4LCCA 2CLVA 1CGSL 5IEHB 1T20A 2VDPH 2DF3A 4NUGH 5DVOA 1BQHA 4LSTL 4MA7L 3D0VB 1CGUA 5D71H 5I1IL 4HV8B 1W72H 3IETA 3MUGA 2EIBA 3D9AL 1J8HB 3RKDC 2YHGA 4ELKB 2DB8A 1U8OB 5E94B 1YEIL 2OM5A 2A83B 3RBSA 1KTLA 2NY7H 1U58A 4NQDA 4P9ML 5DD3L 3MXWL 2AW2A 3CFBA 1EO5A 2ZOKB 4KC3B 5C08B 2G5RA 4TTDD 4GW5A 1FNEB 3SJVE 1OB1A 4JFQB 2NXZD 3O6FD 4ODTL 3ETBF 3MNVA 3AUVA 3GMOB 5KN5A 4YHYC 4LPXA 1VACB 2HTLD 1U8MB 5F3BB 2X09A 4MXQC 3AU1B 1XR8A 3W9EA 3CFEB 1Q9LA 3MRMB 1MLCA 1QSFA 1QEWB 2XV6B 3X14B 5FK9B 1D5XA 4JKPH 3RVTD 1IC5L 3M17A 3L5IA 3JUYA 1QP1A 4KAQL 1DLFL 3GRWH 3D0LB 1JGVL 1GXEA 3GMNB 4H0HB 4Q6IB 2XQBL 2NXYD 1AXIB 4WUUD 2A73B 1EAPB 4X4MA 3TVMD 4FABH 1QEWA 2VERN 2HA1A 1QFWM 4U2YA 4FP8H 1JGUH 4HKJA 2YD1A 4ODHH 4JDZA 1G7MA 1S7UA 3LVEA 5DD0L 3IDIB 2FIKB 5EOCH 7FABH 4KVCH 3TYGH 4WI7A 3JTSB 2EDTA 5IQ7L 3L3OA 2LU4A 4PRAB 3P4MB 1KT2B 3IDXL 3ME0A 1QFPA 4OCNC 4ZNCD 3P4NA 4Y5XB 3WFDL 1XZ0A 3QUML 1GYAA 1JF5A 4G7VH 4WWKB 3SDXE 4G80A 3F6LA 5DT1L 5EUOE 1LMKA 1ZT4A 1QNZL 4F37K 1CD8A 4KMTL 1GZQA 1L9MA 5DFVD 5DA4A 3QHZL 4P3DA 2EO1A 1AKJD 4PG2C 4OGXL 3WEXA 3MLYH 5TE7L 1YPZB 1S5HA 4UV7H 3QIWC 3QUZA 4KGLA 5J11B 2NY2C 4X7CC 2R4SH 4G5ZH 3FONB 1LILA 5ALCL 4ACPA 3ILQD 5MENE 1M7IB 4S1DD 4ZUUA 1R3JB 5EO1A 2ZCKH 1CICD 5L2KA 3Q5YA 3M07A 2D31B 4ODXB 5DMGC 1EHAA 1UXWB 1RJLA 4X6FA 3SE9L 5E4EC 3W0WB 1B2WL 5J4MA 1R5IA 1PAMA 4G6JH 1HNFA 2WBJA 2YN3A 3OXRA 1I7RB 4I77H 5LCVH 1ZA3B 4JHAL 4XNUL 1D6VL 1A7OH 4FHBD 3MRBB 3X3FL 1KCSH 3S4SA 5D2LE 2FEDD 3RQ3A 1NGZB 3GKWL 2AV7A 3U4BH 3OX8B 1EBPA 2YA0A 5EA0L 1FFPB 4Z7QF 1MJ8H 4HT1L 3GIVA 4WGWB 3SQBA 1FL6A 4FNLH 4U1LA 1LQSR 1T89A 3NIFF 4P2OC 3WSQL 4XBGA 3CSYA 4KKLD 4ALAL 3KHOA 3ZKMD 2X4SB 3SKNA 1FZJA 2GSGB 3GJFH 2WINB 3D39B 1EXUA 2KDGA 3FQWB 3ZLQC 4WU7A 5I19H 3RAJH 3ARGA 4JZJC 4EI6A 4QTHB 3DRTA 2NY3B 5BW7A 5E2UH 2AK4D 3TN0A 4G9DB 2HJLA 3ET9F 3QDGD 1JWSB 3QIBD 1NCAL 5EUOA 1OQOA 3K2UL 3KPOB 2IQ9L 3TT1L 3KPNB 1OSZB 2P8PB 3GHEL 1WAAF 5DUBB 3T65A 5H2BA 3MV9B 1Z9OA 3MRNB 4GG6E 4LCYB 1U41A 1SMOA 4WO4B 1AO7D 4JO1H 2FGWL 1UEMA 2ED7A 5B39A 4GBXD 2AQ3A 1DBAH 2G2RA 1YDPA 1T0NA 4ODTH 3BAEL 3R1GL 3HG1B 4HK3J 5DEFB 4M9PA 3JTTA 3BP6A 3QNXA 3MXWH 4UT6L 1V05A 3QPQD 3GSQB 4E42B 2QQKL 1L6ZA 4LCWE 1JNLL 5JZ7D 2V5SA 3IFNL 4M7ZB 3Q6GL 1D9KB 3UYRH 2FDBP 5D72L 4I3SH 5DWUL 3WKMH 4PRBA 5EO1B 4FQXB 3MLTA 4XCCL 2D7OA 1T7YA 1X7QA 1UWXH 5DRZA 1LK2A 2BSRB 7CGTA 2W65B 3V4PH 1SJHB 1XGRA 3OJMB 4EI5A 4ZAKA 5L6YH 4KK6D 5GS0L 3K3QA 1T21B 1E28B 5E6IB 4PJIA 3UZVB 1OAKH 2NY1B 5BCAA 5ID1B 5B3NA 2WP3T 4MB3A 3B9KA 5IBLD 2AS5M 5ELIA 5J0BA 3I6KB 5I0DA 2DTMH 3C5ZB 2ZUQC 5HHOA 3S7GA 3MRRB 1LGVA 3UJTH 4NBXB 2XWBB 2W38A 3LN5A 1IGTB 4OFKA 5MEOB 4LAQH 5CSZA 4XHJC 3CXHJ 4LOUC 2EO9A 3BUTA 1DVFD 4D94A 1DJSA 3O4OB 3RL2B 1JPFA 2ZOLB 4KI5E 4XMPL 5FHBH 2F54D 4JGMA 2AV1A 3DSFL 5JW3H 3MRLA 3QUYC 4KQ3H 1TJIL 1N2RB 1JYXA 3C5SB 1G6RB 3ESUF 2WIIB 1L4IA 4MXVF 4GRWH 1BQLL 4L8DA 4L4JA 4BKLA 4MLSA 4OZGA 1PY9A 2HFFA 3WFCH 4WGVB 3PGFH 4XVJL 5GRVL 5AAWA 3FMGH 1RK0A 2CRZA 2Z91A 5CGYC 2B4CC 3MUJA 4HIIB 4CVUA 4MD4A 5MERA 4PJ9B 3WIHA 3I85A 2ZUWA 4MDIA 1JK8A 2Q3ZA 1XR8B 3ZYIA 1N5YH 3LN4A 1K5NA 5AUMA 4HUNB 3V0VA 1S9XB 1BFSA 1N2RA 4X99B 2EE3A 1QKZH 3IGAB 3VXSB 5SV4A 3DPBA 3MV9E 5F6IC 1MCHA 2EYTA 4OF0A 4NO5A 2NXZC 1IL1A 3EDJA 4NKIL 4XBPA 3VXME 1TVBA 4IOFD 5ETUA 1MCLA 4PV9B 3K4ZA 4LLMA 1QSVA 1R3KA 4EDXA 3BZFB 1AD0B 4F8TA 5HGAA 3QFDB 2BMKB 5E4EB 2PYFB 3F7QA 2XWBA 4JDZB 1QR1A 1QO3A 1VKXA 1I8IA 1EFXD 4WFHE 1P7QA 4FMFA 4MA3A 3WJJA 4PJ5E 4YDLB 3FB5B 2EDXA 3IDGB 1UH2A 5DS8A 3CMOH 4MAYC 4NOFA 4HFWB 5KANI 4HGMA 1RZIB 1KB5B 2Z92B 1DFBH 1IEBA 2G60L 4H8WC 3O9WB 1QQDB 4ZXBD 5J11C 4WFGD 4NKDB 3MOAL 4MGXA 4OM1L 3GBLA 3BXNB 2MNUA 3P0VL 4H8WL 1JV5B 4P57A 3SCMB 1JNHB 2ADGA 4HWUA 2QJDA 3IFOA 4F3FB 5E99L 3L3GA 4WV1A 3PG2A 4IOIB 2FBJH 5CS7A 1L7TH 4U3XA 2Q7NA 3C5SA 3KR3L 4HD9A 4K8RH 4TNVK 2C3WA 5C8JB 4GG8A 3CH1B 3KPMA 4RMRA 5A3ID 3VRJA 5EUKA 1OM3H 4D3CH 4G6KH 1JPSL 1CDCA 5CHNA 1RK1B 4QRQB 3ZE2F 1KFAL 2Y36H 4K7FB 4QHMB 4UTAH 5D5ME 2P5ED 1FNGB 3TYFB 3ARQA 3ZTJG 4TTGA 1TJHH 1EVUA 2G2RB 3JXAA 1WFUA 5TDPB 5I66B 3NIGE 2VLKA 4JEGB 1AHWA 1L7TL 4YGAB 5C92A 4L8SA 3C5JA 2C3HA 3WIIL 3SE4C 2HT2D 2PW1A 1FNSL 5D7IE 3DX8A 1A6TB 4EUPB 2VXQH 3UBXA 3RZCD 4KDTA 2XYCA 3VXPA 2QQNL 4IM8A 1IGML 1FFOB 3L3JB 1EA9C 1T22B 1CLOH 3ESVF 3QO1A 4I0PA 4JFZL 3K0WA 4L3AA 4HEME 1CBVH 3LKSB 2FLBT 4Z78A 2AVGA 2E7CA 2JIXB 2DQHL 5IGXL 3JSSA 3I6GB 3BZFA 3SKJH 3ZDYE 4J12A 4YFLF 4LCWD 1MFDL 4QRSA 3G9AB 5ETUB 1B0GB 1NC2B 4LNVA 4CU6A 1U8KA 5I6XB 4CADA 4KJQD 3VG0L 2WNGA 3TZVA 4I1NB 3W9DB 5CHNB 4M48H 4XXDB 2JKXA 4HMDA 3QH3A 4YHYB 4EN3A 4QXGL 2EDHA 4NN6C 4PP2A 5C0AB 2FATL 4N8CL 1Q72L 2EDLA 5H8DA 5BQ7B 3O6FC 2WBJD 3HN3A 2E7HA 2KZWA 1ZHLA 4IJ3B 5INDA 2Z35A 3DV4B 3SDCC 4NJAH 4IOFC 3T77B 1FV1A 1U92B 2BNRB 2ICWB 3RIAF 1T1YB 5D2NC 3PHQA 4ETYA 1BLNA 3U2SA 4JGJA 1BVKB 3F62A 4KPHL 1U8NB 4LLWA 4U6XB 5JOFB 2JELL 3RAJL 2O5YL 1AGDA 4D0DA 3RGHA 3UDWC 4NDMB 2BVPA 5A16A 5CMAB 4Z7NF 1NEUA 3BPCB 1GZPA 3FFCD 3LS5L 1JF1B 1JWMB 4W4OA 1P1ZA 5CINL 4DTGL 1F4XL 3O2DH 1JTOA 4EBQH 1MRDH 2CGRH 3PP4L 5DK0A 2RQ8A 5CSBA 2EDRA 1D5BA 1KPUA 3VGDA 3LQMA 2X1WL 2HJLB 4KY1L 2NLJA 4NN5C 4OZFA 3BD5A 2OR9H 3EFDL 1LK3H 3NFSL 1JMXA 4MQTB 1JF1A 4RISH 2ENSA 4ZFZA 5IFAL 5F44A 2H1PH 1FVEA 2FD6H 1OAUL 3C9NB 4HS8H 3B2UD 4DAGH 1FC1A 4ZFGH 1I3UA 3QNYA 1ACYL 1C12A 4Y7MA 4M7KH 1K5NB 3HE6C 1DQQB 3CFDA 4KU1A 3PV6A 4UT9L 2XWTA 5CEZH 5HY9B 5EOTB 5JA8B 4N8PA 1XCQA 5TDNB 2ARJQ 4WV1B 3ZHLA 1AJ7L 4J8RB 3CX2A 2Y5TA 1OP5K 1KGCE 1J05B 4WW1A 3RWFA 5IHBA 3KDMA 3TZVB 2YPKA 3L3IA 3NCJL 4NQEA 5IHZB 4MNGB 3S96B 4OGYL 4H25A 5AYUL 3I9GL 4UQ3A 4PJDA 5EOTA 3KYMB 4HS3B 1M05B 4Z7OF 5IWLC 2Z92A 1DQLL 4QT5B 1JJUA 4Q7DA 2F54B 1CDBA 5FK9A 1BD2D 1OAZH 5E1AA 2MWCA 3O45A 1F5WA 3WKNA 2HVKB 1AQDB 1RFDH 4JZNB 1FGVH 4QHKJ 5GJTH 3EOYG 1TZGH 5HVHC 2ADIB 1KN2L 2ED9A 4XHJD 5E99H 4PJHE 2ERJC 4LCYA 3BIAX 5IW6A 5L0QB 1R24A 4WFGE 4ENEC 1OSZA 1CCZA 1GC1H 4OT1H 2PNDA 3B6SB 4XZUB 5F9WC 2VWEE 3VXSA 1A6VL 2H8PA 2A77L 2F54A 1TVDA 2OMBA 1GSMA 1A64A 2PETA 1KTLB 4NWTL 1MCNA 4XC1H 5CEZE 2CD0A 5JXEC 1NKRA 1I7ZB 2FWOB 4TNWK 1UG9A 3NA9L 1ZLUK 1R0AH 35C8H 3QDGB 4X7TA 5D2NE 3N0PB 2VLRE 3S5LG 2AJ3A 1KN4H 5GGUB 3MRKA 2MSPA 3G6JE 4OCMC 2BSED 3HUJE 1I8MA 5CUSL 5IBTH 3ARXA 3QYCA 2HAZA 1JGLH 1YPZF 1YEJH 3MV9D 4HH9A 1UM6L 4LHUG 1T1YA 1Y0LB 1EFQA 3O3DA 3VWKB 4OD1L 4HC1L 3QXAA 2APBA 3CFDB 3HUJB 2GAZA 4J1UA 1BZ9B 5C3TA 1DZBA 4XWGH 3T4AA 3NA4A 4XPTH 4DUVA 4HJJL 3RA7L 3RKPA 1CD1A 4JZOA 4DQOH 2B1AL 2ZSWA 3PJSA 1I9EA 4MMXC 3MBXL 5F1IA 3D85A 4HIHA 1Y6KR 4L4VE 4TUJB 4P5KB 5KVFH 3C6LD 3QPQC 1EX0A 5IOPB 4PJ7E 4HX1B 5JIPA 2FB4H 5J6GA 3ISWA 3GMLA 3IFPB 3G9VA 3WXWL 4U1HB 2DQCH 1UXSB 5FUCE 3BW9B 2VABB 3ZKND 1KB5H 4YZFE 3FTGA 1LEIB 4L5FH 4YX2L 4PJHB 4OZHB 3I6LD 4MD5A 1UQSB 1CK0L 4OLWH 2IBZX 1AGBA 4QOKD 1XGYH 1YEEH 5I1EL 1GZQB 3DUSA 4HAFA 2VZUA 1IBGL 4OFPA 1NCNA 2D7TL 2O5XL 5IEKA 1IARB 3QXUA 1QSFE 3VA6A 4BJLA 4WWKA 2VLKB 2C1PA 4PB0L 1LO4L 5DJAB 2OTPA 5T33L 2B4CH 5GRYA 1TJIH 1NANH 2P5EE 4F7TB 4G9FE 4CVXB 3DSFH 5D7IF 4Q9QL 1ND0A 5J6GB 1INEH 4YHIA 1F3JB 5L0QC 4PIRF 3VGGA 1RMFH 1OP9A 2GJZB 4PG9A 2BRQA 2D7PA 4QTIH 4DGVH 1IJ9A 4MB5A 1VESA 1CQKA 4HKJB 5EBMA 1WIOA 2OL3H 4JVPA 2E7LA 1Y18B 2QEJA 2VDLH 1KPVA 1U8KB 1LEGA 5T1LD 4L3CA 3CVHL 4OV5B 5CSZB 4ZSOE 3DIFB 1TITA 1J12A 5FA4A 5J3HD 1DBAL 4OQTL 5HVGB 3L6FA 5JHLH 4HDIA 4MNQA 4NT6A 1YUHA 2JIXD 3QUMB 1DEEA 2XKUA 5EORH 5IT2L 1Q9LB 3MRMA 3PWPD 1I8IB 5FECB 3L3JA 3S5LB 4JCLA 5IBTL 4FXKA 2VLKE 2IQ9H 2VLME 2Q86A 3ARGB 1QFHA 4B50A 4YR6B 3DUUB 5DMKA 1N3NB 2W9DL 2FX9L 9CGTA 3RY6C 2NCMA 3GM0A 4BFBD 4KKCD 1DQMH 5J13C 2RBLA 3BPOC 2OZ4H 2BXZA 2I25N 5FF6A 2RHEA 2FECL 3UAJD 3JTSA 1OAYH 5CGMA 4X5WB 3AFLA 2B2XL 2FSEB 3BAEH 5E94A 5AUMB 4LF3A 3BT2H 3QDJA 1IAKA 5C0JA 3S5LA 2DL2A 4PJFF 2OL3A 3D69A 1ZLVH 4KK8D 3VFNB 3EYVB 3MLUH 2FJHB 4XAWH 4CJ0A 3QXWA 1LK3L 1KYOK 1TZIB 2XOTA 2GJ6E 4M1DH 5F8RC 3ZKSD 1YEHL 5D2LA 3HCVB 3F5WA 2E3VA 4JN1L 1U93A 1RUKL 4M7LT 3MRHB 3FQUA 5I73C 1I3GH 3KS0H 4YHZH 1D6VH 1MRDL 1Q38A 2CGRL 2EDFA 1CLYH 5IMLA 1IVLA 1UM4L 5EZJA 4ZTPL 4QHLA 1TFHA 4WFFE 3GMQB 3VXOB 5HGHB 3QJFA 4HWBL 4OZFG 1NCDH 1FIEA 5GGRY 1P7QB 1A14H 1HXYA 2EH8L 2VZSA 4GAJH 3RNKB 4IOSD 3QUZB 3VE0B 3LS4H 4XPAL 2GCYB 1RI8A 4P3CH 2CLZA 5AYQA 1B4JH 1NMAL 1T7WA 2YPLE 5JNYB 4L4TA 2AK1H 2X1OA 2EDOA 1K4DA 4NZTL 4O02H 5L8LB 3KPPB 5IM7A 4LBEA 5TDOB 5JHDD 4PJXA 3OGCB 2AJZB 3SDCB 1Q9KB 3WIHH 2RFXA 4OCSL 3WBDA 1MNUL 2VIRA 2Q87A 3ULVD 1ZVHA 5ERWB 1BIIA 5D1QC 3WIFA 4URTB 1RIVL 3MA9H 3RVVD 2OXGA 2PYEB 5IFHH 2OSLB 3NCJH 3MQIA 1C7SA 1QTYT 4XMLL 1HILA 1H15A 1R3IL 5D5MB 2XY1A 3IETB 4D8PA 1JPTL 1JK8B 1VFAA 5LJYH 3AY4A 2JJSA 4NRZA 5D2LF 2LTQB 1KNOB 4LLVB 5SWZB 1HXYB 4GRWE 5GHWL 3KVQA 4ZS6C 3DURA 1UACH 5D96B 1YY9C 1ZHBA 5GGSB 5C0EB 1FSKB 3BP4A 5IW1A 3FOMA 5D70L 5HGDB 2V2TA 5C70A 4M6MH 5CMAA 3Q1SH 3RJDA 4D9RE 4FQIH 4MNGA 4U1JB 3GSQA 4E42A 5IG7A 4DCQB 4KJQC 3TBTB 4YHKH 2IPTL 1T7VA 4WHDA 4YK4C 3WUWA 5K9JL 2FJHA 2EE2A 2R29H 2NMSA 3T09A 3LQAL 3RBGA 5KSBB 1NDMA 1EK3A 1T6WA 4LIQE 4NQDD 4RX4A 1HILB 1H15B 2SEBA 4N0FB 3SGDH 5IESH 1JN6B 1G0YR 2HVJB 4K3EL 4X98A 5FGSA 1U8LB 3W2DL 1U3HB 5DXWA 1Q0XL 2KH2B 3EOBB 1HQRA 1E4WL 2XN9A 5ICXB 5CINH 4ELMB 3S8WA 4O00A 1UCBH 5J12C 4U0QB 3IF1B 4YXHL 1K4DB 1ZHNB 5T3XD 5EBLB 4O4YH 4YHMH 1SYVA 1IC7L 3PDDA 2JELH 4PGCB 5ACZB 1F6FB 1YC7A 4PRIB 3ARDD 4JKPL 1WITA 1VFBA 4G43B 4ZOAA 5DJZB 3FQWA 2WMPA 1QBLH 4HPOH 4KI1A 2AK4A 4GUPA 4U1MB 3GKZA 4HJ0D 5B3JF 1DL7H 4QHNB 1E4KC 1V3JA 4H1LG 1MCDA 3VFOA 4U1HA 4LCCB 3EOBA 3K74B 1FC2D 4X9IA 1PJ9A 4L29B 1PSKH 4P2RB 5DRWA 3TVMA 3BPCA 5CZVL 3S88H 3PQYD 3T2PA 5C0BB 2GIYA 2XXCB 1N26A 2VISB 1A47A 4YWGL 1AHWB 5DO2C 4AL8H 3LRSB 4HKBA 4NM4H 4XP5L 2AXGB 2B2XH 3U9PL 4A2MA 5F8QC 1N6QH 5HHXL 3ZDXE 4ONGH 3EDKA 5BV7H 5IMKB 2BC4B 3ZL4H 4Z7WB 2PN5A 3ZSSA 4WDIA 3SKMA 1C1EH 3FOMB 5C2BL 3Q5OA 4KV5F 1LEKA 3RVUC 3HRZB 4L1HA 3O2WH 3BZ4A 4PJ9C 1CDHA 2AEPH 5I1IH 5CILH 3BFOA 1UA6H 4G9FD 1FCGA 3VFGH 4FTVD 4XI5D 1H5BB 4ORGB 1CDUA 1SJEB 4GRMA 4ZAKD 2J7LA 4PLKD 1ZKAA 2R2HB 2FX7H 2R1XA 1TTFA 3QRGL 3I9GH 4MA1B 4MJ6B 1MRFL 1AJ7H 5CIPA 4MSWA 1GC1C 3VXUA 3GBNH 1T22A 5HHPA 1F6LL 4C56B 4MXWH 1HINH 4J4PA 5E9DB 1DBBH 1KYOJ 2VE6B 3NGBC 4EEEA 3HE7D 2YS4A 3TA3C 3QCTH 5C0DB 3UTTA 2ORBH 3FB8B 4TVPL 1AD9B 4WI4A 3BEWA 5HXMA 5F7KC 3B8SA 2XWJB 1PYWB 1EERB 5LGHH 3ARUA 4OKVB 1P7HL 4LEXH 4KRLB 3O6MH 3S37H 3MV7D 3P3YA 4JY5L 2E7BA 5KVGL 4XPBL 2BVOB 2CUHA 2NY6D 4X6BA 1H3WM 4A6YH 1M1SA 2GAZB 3FAXA 1IQWH 1DE4A 4N90E 1XF2B 5HGDA 4HG4K 4IRJA 3KNBB 4MDJB 3IFOB 2R39A 3OG4B 3MOAH 4CVXA 4LCUA 1BFOB 3SQOL 3VFPA 1KJVB 1WC7B 2H45A 5BRZA 3OAYK 4MYWB 4V1DA 3SOBH 1FFNA 1WGOA 2NY1C 4HUUA 2G9HB 5H37G 3KYOB 5EU6A 4P46B 4KQ4H 4HUWB 1FG2A 3N9GH 4FS0A 4QRPD 4P3DB 2DBLL 3DROA 2QKIB 4S0TD 5I1AB 5JXAH 2DKUA 3EYOB 2WZPD 1QBBA 4LPWA 4Q6YA 3OKOB 4AEEA 1D9KC 3NN8A 1Z0NA 2G5BA 5C9JA 4F7CA 1MHEB 5DFWH 1D5IL 5FCUL 1VFMA 4WTZA 3MRCA 3VD9A 4XPTL 4P4RA 5SX5H 2EXYD 4FXGB 2R1YB 3PP3H 4L4TB 4HWBH 5I74C 4HC1H 5JXAL 4KK8C 4LNRB 1ZT1A 3QUKA 3VI3E 2EDEA 4PJFE 1CXEA 3IGAA 3SKJL 1CD1B 1KEGL 1G84A 3H0TB 5MEPB 1J1XL 1MJ7H 4OLVL 1OTTD 4BK4A 1RUKH 3DRQA 2AEQH 2Z8VC 1HH9A 4UDUA 3VG0H 4HK0A 3VXTA 4HUXA 5EFIB 3QEUA 2UZYB 1QLEL 1MFDH 3V5HA 4AT6A 1NEZB 5FM5O 3UTZB 2XZCL 4ERSL 4OT1L 3EYQC 3RX7A 1I75A 3QDJE 2BXYA 3MZGB 2UY7A 1OARH 5IB5B 4Q0XH 1I1AA 1EJ6A 1QSFB 1X7QB 3VGAC 4LHQB 2QHLA 1RIVH 3PWJB 5D7LA 3FQXB 2DIBA 3PWNB 4P2OB 3UZEA 5GSRB 1SQ2N 3MXVH 1HZHH 3SPVA 2VR5A 1KJ2L 3LEYH 2ID5A 3H42H 3HZMA 4GRWF 2Y23A 1JUFA 4UIMA 1I9JH 2YEZA 5LBSL 5JOPD 1AQKL 2BHZA 5A2FA 2NY4C 5INCA 3W11C 1FQ9C 2XA3A 2A9MH 1QVOA 1ITCA 1WBZB 5LAXB 1U58B 2NY2D 2YR3A 4I3RL 4JRWA 2XPGB 4OZIB 3NTCH 1KOAA 3NCMA 4NRYA 1CXHA 3TCLB 1PG7W 4MLIA 1I1RA 2XICA 1FNAA 1GGIH 1AXTL 4APQD 2Q76B 1NC2D 4DN3L 1U8JB 3DSNA 1K8DB 5FYKE 1IT9H 5C3LD 2R2EB 4IDJL 2IBZY 1UA6L 5IQ9A 3S35H 2V9TA 3VXPB 1E4XL 3GMMA 4YJZL 1A7QL 5KSVA 5AD0B 4PJDF 4X4YA 1B3JA 1RURH 3ALXA 4DK3A 4XAWL 5DJYB 3LDBC 2X05A 4FQLH 3GSXA 4O51B 5IVZA 1I9RL 4PGBB 4UT9H 3WFBL 3B83A 1S9YB 4JGUA 1HQRB 4U1NA 3MNZB 5EBGA 3BRGC 3OG6B 1EVTC 5E5RB 3TNMA 3L5HA 3DOSA 3P0GB 1ACYH 1S9XA 1QYGH 4D0CA 3OAZH 4PRHA 5F7YC 3BHBA 1P5VA 1Q9WA 4Y5XC 3BMWA 4JKMA 5KSAD 3L3GB 5GS1C 3O3DB 1AR1D 2CDEA 3UPRA 2BOBA 1JP5A 3KXFD 3SGEH 4MD4B 4E0RB 3GDBA 1NAMH 4LLYB 4P3CL 2A1WL 4ODHL 4PRPA 2X4NB 4ZFFA 2VISA 2DM7A 4AH2B 4E41E 1KEGH 3WXVL 5D6DA 1NAKH 1IEHA 2ZCLH 1DQJB 3PQYE 4LLUA 5EZLA 4ODVH 4QY8A 5E2UL 4M43H 4YIQB 4F8QA 2CUMA 3GSNL 3WS6C 4U33A 1F90L 2OI9C 5DD5L 2H8PB 2DQTL 3EKCA 2AGJL 1YPZA 3ARRA 1W72B 3F12A 5B3JE 1KTKE 1R24B 3VH8G 5I1DA 3MUHL 1JI2A 2NXYC 4AG4L 1GVIA 4EUPA 4Y8AA 3BN3B 1N0XL 4Z7UB 1CFQB 1JZ3A 4M62H 2R2BA 5FKAA 4HAGA 1K85A 5D1XD 3BPNC 2ZUUA 5F89B 1C16A 1GL4B 2F8VA 4LLYA 5JW5B 4HWZB 4NQXA 4XGZB 5HI3D 4M5ZH 5E1AB 4QHUB 2NY4D 4NZJA 4RFNC 3JV4A 5IHUL 2AXFB 4NFDA 1MCEA 2D03H 5CUSH 3MTRA 1DTUA 1J0ZA 4G5ZL 5E8NB 2I60L 2MQ3A 2B1HL 3WUWB 2FX7L 3NZ8B 2VLLB 4X6EB 2WBJB 3OXRB 3X11A 4PTTB 1I1AB 1GGIL 5CILL 5EN2A 4DVBB 3PWUB 3PGCA 1IT9L 3QQ9D 3ZHKA 2EYRB 3RTQB 2RJMA 1IM9A 1VSCA 2XWTB 3HPJA 1U93B 5D8JL 1JPTH 1EEYA 3QUXC 5TH2B 4QKXB 3DECA 3E2HC 2YRZA 3AREB 3TWCH 3UTOA 1MHPL 4XGZA 4X7SL 2VXTH 1FJ1B 1QSZA 3JVGC 4DK6A 5FGCE 4MWFA 1CICC 2CRYA 4OF6A 3W0WE 1E6JL 1JYNA 3MNWB 1KJMB 3O8XA 3FAWA 1G1CA 4NQEE 2BY1A 4NIKB 3N85H 5JORB 4P2RA 5DRWB 4E5XB 4OZHF 3G6DL 1GHFL 3CX5J 2HVKA 4X7FC 1NBQA 4BFIB 2NQCA 3P9MA 4M93B 2GEEA 5F6HJ 4WO4D 3RWDB 5FDYA 5DSCB 3KLSA 3FO0L 3O45B 2G5BB 2XFXA 5F96H 3RIFK 4JM2F 4N1EA 5EUKB 5TH2A 2XQYK 2OR9L 3EFDH 4MS8C 5IBUG 3FKUS 4JPKL 4G8EA 5I1AA 2DYPD 3NVQA 3O81A 4P2OA 3OXSA 3I50L 4P5TC 1LO4H 3MV7A 3T2NH 3ZKXC 3EO0A 4GLRI 3DBXA 4KK5D 4UTBH 1I8KB 1YEHH 2VKXA 3OPZL 5I2IA 1GGBL 2ESVA 3MGOA 3ARDC 3WNPA 4CNIA 2R8SL 5J1SC 1RSFA 4NPYB 3MOBL 5IFJB 3Q6GH 3FQNB 2P44B 1JGVH 4JZJA 4FQXA 3BKJH 4R90L 4WEBH 5BW7C 3FRPG 5KG9B 3V4VL 2AABL 3SDAD 2E9WA 4X6CE 1MFAL 3MREB 1CGSH 2EE9A 4HLZH 1WV7T 2VNCA 3EAKA 4MVBD 1XR9B 4FQHA 1RUPL 4DFHA 2VJXA 4Z5RA 3REWB 2BVOA 3DRQB 3P30H 5TE4H 1FYTD 1WISA 4NKMA 5JA9A 3WL9B 2PF6A 4HGWB 2XNAA 4JY6B 5GGSY 5T3ZH 5IG7B 5IVZB 2YRLA 3CFKA 4OF3A 3B2UC 3FO2A 4L3EE 1MAKA 1ERNA 5A2KH 3BGMB 4P9MH 3C6LA 5C0IA 4QRSB 1TQCB 2JTDA 1KCSL 5C0DA 12E8H 2VDPL 4NUGL 1A7RH 1W72A 4PRNB 1NGQH 4MA8L 1FLTX 1KCRL 1RJYB 2NLJB 3D1MC 5EBWA 3ALPA 3MLSH 2IALA 3MBEC 2V5MA 3NH7L 1YMHB 5HPOA 3VFRB 1KXTB 5C0CA 5DI8B 2PCPB 5DHYB 4KDWA 4UILL 1VENA 1RVFH 3D87B 3QQ9C 1V7NH 1A9EB 3SE3C 4KQ3L 4PD4J 5KVEL 2ATKA 1E4XI 1UACL 4UNVA 4QOKA 4JB9L 4TRPH 1FLRL 4OI7A 2R4SL 4LSPL 3OJDB 3WFHB 3U7YL 3WIFB 4ELMA 4PUBH 2ZP0T 4LLWB 3P9LB 5CP7A 4CMHC 1H3PH 2FO1A 1WSST 3HE7B 1HH6B 4R7DB 3V2AR 4XNQB 2IPKB 3V6ZA 5JZ7C 2VO5A 4R0LC 5ITBH 2AJXL 1BPVA 4HIJA 2V9RA 1JPGB 4M93C 1XH3A 3KYAA 5FO8B 1MREH 4U6TA 1SYSB 4YPGB 4XCEA 4ZMAT 2J6EH 5CJ5A 5ILTH 3DMMA 3PL6D 4MAUL 4TVPH 5DEFA 1AO7B 1NCBH 2GK0A 4FQ2L 1F3JA 3LRSA 4Y4KD 2DTSA 4IMKA 5EZJB 3GBML 4NN5B 1KLGB 4XI5C 2P48B 4ZS7H 3VWKA 5ADPH 1NKOA 4M03A 4PR5B 5E2WL 4YXKL 2NY5C 1HH6A 1JYWA 4NC1E 3MLRH 1JGUL 5EO0A 1KJ3H 1F4XH 3QZWA 4S1QH 1G9ML 3RTQC 4KMTH 5F7NC 4IRSB 4JFDA 2HJKA 4K2UL 4N0YL 4Y16C 3EYVA 3PHOA 2P7TB 5GS0H 32C2B 3V52L 3PP3K 2A6DB 3BGAA 5EU3B 2K7PA 3TA3D 3VDCA 2DLFL 3ELAT 1R3KB 2D2OA 1SYVB 1NAML 1MLBA 3FB7A 5D72H 4LSUH 4EI5B 2Z9TA 3RWDA 2EDDA 1UZ8A 1KC5H 1PEWA 4Z0XB 3UYOD 4DAGL 1CF8H 1XF4A 1OD9A 5DRXA 4YPJA 3OKLA 4FXKB 4PJ7F 5IFAH 4Y19A 4ZD3L 2GY7B 1AQDA 1KEMH 4Y1AD 4HUWA 1NGZA 3AS0A 2X1QA 3OAYH 2XKNB 5GRZA 2FH8A 4XPFL 3KYNA 3ZKNC 5C09A 3EJJX 4FQHB 5GS0C 3QT2A 2IWGA 1QBMH 2DAVA 1DBJL 3P0YL 3MGTB 4L4VD 4W6YB 1J1XH 1MWAA 5GZOC 4JHBA 4JCMA 3MOBH 1IEBB 1I85C 4P2YA 3MRFA 2WUBL 5GS2H 4Z7QE 1PKQA 1B0WA 3G5ZB 1ZHBB 4Y1AB 4B5EA 4OUUA 5CJQH 3KPOA 1ZTXL 1DN0B 3CMGA 3CFEA 2WV3A 3CCHA 3L1OL 1T7ZA 3HNTH 5E8NA 3F8UB 5HY9A 1EO7A 1MWAL 4YXLH 2FH6A 4OIAA 5ANME 4LVHC 3JV4B 3MJ6A 3WSQH 2Y5EA 3EGSB 5B8CA 4QEGA 2Q20A 1K6QH 4U6VL 1OP3K 5GS1B 5BVPH 5T1KB 2LAAA 3BKYL 3LN5B 1I9IH 4NHCH 4RMQA 5C0GA 3N1PC 3HMWH 1FGVL 2C1PB 1A22B 5HHPB 3SGJA 1T2JA 4PJHF 3HHRB 3MV8E 3H7LA 4JVWA 3IVKB 3GIVB 3MNWA 1QRKA 5BS0A 1XGTA 3C8HA 5A40E 3VD5A 1VEMA 4AEHH 5BVPL 2DQDL 5FYKL 2FNBA 5JOPE 2HLFD 3EYQD 3EFFA 4WUUB 3WLWC 2MKLC 2YWYA 3MACH 1INDL 2X7LA 1RJYA 2HH0L 5DRNB 1YJDL 4P23C 1RULH 4MJIA 4MAYB 1NAMA 1W0WB 5ENWB 3HZVB 4AM0A 5ADOL 3V5DB 4YDLC 4UQ3B 3QQNA 1IAIH 4I0PC 3L7FB 3CU7A 1C7TA 2YPKB 3PWPA 4Z6AT 3STZA 1N7ML 1A4JA 4MX7A 3DMMB 3CZFB 3RVWC 2F19H 3W11D 1OCWH 1A6AB 1X5ZA 4OJFL 1I4FA 3U79A 3BE1H 3GO1H 4XP9H 4UDTB 2A1WH 4NKIH 1S7VB 5CEYB 4BK5A 4X9GA 1IEAA 2DTML 2D9QB 2UYLA 5D7JD 5MP6H 4QOKE 4MD0B 2K1MA 3E6FB 3GMRA 5I71C 3CLFL 5CP7B 5ERWA 2FBJL 4P2RD 5F7UA 4YHNA 4ZPVB 2B8OT 1OAKL 1RPQA 2JB6B 3BPLB 4KJYA 5MI0B 3OKNB 2ZG3A 3V4PL 1PZ5A 3NCYP 3QQ4A 4KK5C 1BEYH 1P6AB 3RWGB 3O2VL 1S7RB 2GCYA 2NTFA 2LFGA 2A0LD 3D2UB 2MCPL 3D39A 1S8DA 4JN1H 1I7UB 3HC3L 2DJSA 1U8HB 1YNLL 3H7BA 1NCUA 2WP3O 1U8JA 3CSYB 4MNQB 2BVYA 5GZNC 4CN6A 3GEWB 4R4BB 2BY0A 3BD3A 5GS3A 3LPFA 5JHDB 4X6CF 3L5XL 5AZEH 3ULUC 2D7NA 2P5EB 3RI5K 3LRHA 4F58H 3GUTA 3WLBB 2OMNA 3U0PA 1RZGA 1T7XA 3GNML 4PGDB 4NN7C 4EKXA 3V7MA 4WUUE 2XKNA 3LHPL 3AREA 1NANI 2DIJA 4NP4H 5I16B 4J1UB 3IYLW 2CPCA 3GHEH 3PWPB 5CJXA 1BM3L 4M48L 3VGFA 5JHDA 3K4DA 3RWCB 1Y0LA 2D4DA 1A3QA 3CXDH 2VLJE 2EKSA 2N4IA 4XCFL 1WVZA 1LO3L 3ZZ1A 2B0SL 2G75B 5HVFB 4XVUD 5IW1B 4PJ7B 3TPUB 1BFVL 3SGKA 1EDQA 4R7DA 4PGBA 1DSFL 1NBZB 3QIUA 5EU5B 4HW6A 2HLFC 1F4YL 4PG2A 4IBLT 1CS6A 1E4XH 3F7YB 4WI3A 1VFAB 1T1WB 4PGCA 1SEBB 5ACZA 2BCKB 3SDXB 3TBVB 5JHLL 1UM5L 4F33B 4Z9KB 4G8EB 4H88L 4PGZA 5ISZE 3HR5A 4TVSa 1ZHNA 3BZEA 3UC0L 5TQ2H 3HS0A 4P59L 3H0TA 2J6EL 5T3ZD 4NKOB 3WN5B 1F8TH 1QBAA 2XTJC 5ITBL 3MLVL 4J4PD 3DHJA 4FMKA 1Q94A 2F5AL 4C4KO 3VXNA 4AK1A 2F19L 5LXGL 1JCKA 1MCIA 3NCCB 2CDGB 4PJEB 1TQBB 1T1ZA 3KPLB 4X4XA 1VERA 3FCTB 1RU9H 3I75A 4MMZC 4D9RD 3MRBA 1QLFA 1WBXB 4WO4C 1AH1A 1REIA 1DDHB 4RX4D 1FVCA 1CT8B 1CFVL 2J8OA 2Q6WB 2YMXH 1T89C 2YPVH 3PL6A 1C5DB 2H1PL 2FJFA 3EUUA 1XR9A 3L95B 3MBXH 3B3IB 2XN9D 4JFXA 1XF3A 2IANB 4MA1C 1HEZA 5F7EL 1E6OH 2VLJB 3IJHB 4NBYB 3PWVB 4CAGA 3BX7C 2C3VB 2DLHA 3QO0A 4FQ1H 5JQ6H 1T3FB 3KXFB 2Z8WC 1FH5H 5GGVY 1NAKL 3IJSB 3GB7B 5I8EA 3HB3C 2YUVA 4YEEA 1I8MB 4ZXBB 1P5UA 3ZO0A 1PKOA 1XCQB 3BQUC 3QDAA 2F5BH 1HHJB 3VA2C 3LKOA 3QDJB 4OFDA 3QXDB 4GAFB 5GZND 5C08E 2LQRA 4NQCD 1FDLH 5HYSG 2XG5A 5C2BH 2ZCLL 3FRUA 3C60B 3B9AA 3N50A 4F9PA 4LPUA 3H3PH 2IGFH 3MUY1 5FAAA 1J7VR 3VU2A 2IPUK 3T0BA 5F88A 1A1OB 2WWKO 5EB9A 1A7PH 4K9EL 2J4WH 1I3RB 4XPFH 1UC6A 1F02I 1H0DA 1OAYL 1TENA 2AGJH 2BSTB 4K3HA 4Y8DC 5DHVH 5CIPH 5AD0A 3CLEL 4ZOCA 1YNKL 3ULUE 5D1XB 4IMLB 3LZFH 4AY0A 1B88A 4QXGH 3N1MC 1ONQA 3LV3B 1NFDF 3WDIA 1MFCH 3C60D 1AIFB 1S9VA 4KVNH 1GOHA 4JJ5B 1JTPA 4JO3L 4DZ8A 3HS0B 2JCCF 4POUB 3IDMB 4WTWA 4M6OL 4YHOL 4P23B 4FQLL 4R2GB 5E6ID 3B4NA 3BWUC 1MEXL 5FFLA 1GAFL 2OTWB 4XP6H 3LKRB 1T21A 2XPGA 3HMXL 3WMSA 4ZAKC 1LEGB 3O4LE 5FB8B 3RX5A 1DQLH 1MI5E 2P49B 4JDTL 1RHHA 2NW2B 5FA3B 3RU8L 1YEKH 4WI6A 4Y5YB 5IVNA 4WI5A 4ZS7L 2CDEB 3UPRB 4GBXA 2G75A 5IW3A 4K23H 4XWOC 1NCCH 4XMKH 3UTSE 4WWKC 1JRHL 3F7VB 3NOIA 4TUOA 2CR6A 1C8PA 4P4KB 3ECBB 1UJ3B 4JQIL 3VCLB 3VXUD 5DYOB 3H9SA 5DFVC 1F00I 3BKYH 4FTVE 2X10A 3DVNB 5H94A 3E0GA 3QH3B 4MNHA 2NW2A 5FA3A 3QAZC 1P84J 5I1LB 4GXVL 4LVHB 3CFBB 1T1XA 2MFNA 4Y88A 1A6UH 1TZGL 4X7SH 1OPGL 4RIRB 3D3VB 3SE8L 5EOQH 5JIIA 4NP4L 4BZ1H 1MLBB 4YK4B 2Z0BA 5C0BA 4L3EB 5BVJB 3VXSD 3O8XB 1KCVL 1KJMA 4S1DC 3TT3H 3MLZH 1G0XA 4B41A 3MRQB 4N0CD 1GOGA 2R9HC 5JW4Q 1FN4A 3WFEH 3F65A 5GGVH 1ORQA 3AVEA 3IFLL 2KPNA 1RZJC 4AIZA 2CJUH 3WNKA 1A9BB 2YPLB 3NFNB 1OSPH 2VABA 2IJ0C 3U9UB 5BVJA 3IJYB 4KUZL 2WBKA 4KY1H 4PJDB 4MJID 1QBLL 4FQJH 2D7TH 2O5XH 4HWNA 1OM3L 5JUEL 1KCRH 2KKQA 3FO2B 4HS8L 4UB0H 3L3IB 3EOAA 3D18B 3W82A 4DGIL 1R3LA 4QLRA 1EGJH 4HCRL 4PJ8D 4I48B 1QSEE 5DJDB 1U42A 2D0HA 2H2SD 3BEVB 1CL7H 4NNYA 4AENA 2PW2B 3R1GH 4OZGF 3QNZA 5EPMB 3EO9L 1VHPA 2HKHH 4J6RH 2SEBB 4N0FA 4ZUTA 1J0IA 2VLRD 5IVXB 1KB9K 3CLFH 4HJJH 3U7YH 4Y5YA 1BOGB 4PP2B 2Q8BH 3FQRB 1RZGB 4PGDA 2F58L 5DK2B 2HWZL 4LHUB 4C57C 4OTXL 3W9DA 2HN7B 4XNXL 1QACA 4PRPD 5FKPB 1S3KH 1KLUB 4GKNA 5IJKC 1QZ1A 4JFOA 4Y4HA 1D6EA 4X5XA 3AROA 1YEGH 4HBCL 1RUAH 2DLGA 4RFOH 4G8GB 4MJ5A 2LU7A 1CT8A 2NY5H 1MCCA 3TBSB 5L9DH 2NTFB 3T3ME 2NX5E 1K8DA 3U7WH 1FH5L 3AMLA 3WEXB 3NABH 1P1ZB 3D25B 1T03H 4PB9L 1A1NB 3U6RB 1JF6A 1J0HA 4QRRB 1Y6MR 4NFBA 5HGGS 1NFKA 5IROC 2W0PA 2CLRA 5F97E 1HSAA 3CU1A 2E9BA 1HHGB 3DXAB 3G6AB 2BP3A 3I50H 3L3KA 1EEUA 1DP0A 3S37L 5L2KE 3V0VB 5CD5D 1BOYA 1ITBB 3JWOH 1A7QH 4UBDD 2R2HA 4S1RL 4H1LH 4P46D 3OBAA 2PXYA 1DQTA 3QWOA 3CXHK 1A6ZB 4N0UE 1N7MH 4GG6F 2DKMA 4JY4B 5GHWH 2O5ZH 1U3YA 1DVFC 3S4SB 2BSSA 2QBWA 4P4KD 4PLJD 4YHLH 3G5YB 2F74B 3QI9D 4Y2OA 1BQLH 5DUPL 1R0AL 3SE4A 4HXAH 4I5BA 4KVCL 3H3KA 3SKUD 3BISA 3VRIA 5IB2B 4IIQA 4ZPTA 2B5IC 4DN3H 1CR9H 5FYLH 3T1WA 2Z4QA 4G7VL 4X6BB 3T0EC 1URLA 2OJZH 4MZ2A 5DUPH 5E2WH 1ZGLM 4WEUD 3DNKA 3IU4H 3QHFH 4RGNC 1GIGH 4ELMF 1B0RB 3RWJA 3I75B 1TIUA 2AKRA 4UIKL 3ZE1E 4CVZB 3RVVC 1NMAH 3JWNC 3JWOC 3PQYB 3ULSB 2C7UA 5E7FA 4JANB 4KUCD 5DD0H 5SWZE 2R2BB 5FKAB 4E41B 4RGOL 5DWUH 4ETQA 3P77B 3O8XD 1T2QL 4FP8L 2VE6A 2VDKH 1W8NA 2YD9A 1N6UA 2ITCA 5I66A 3IXAB 5H35A 5CKGA 5FF6B 1T5WB 3SDCA 2AKRB 3P4NB 3O9WD 1A6WH 1WCBA 1TETL 4R3SA 5AYUH 5KS9B 1DBJH 5C8JA 3FB7B 3UTSA 3MRIB 3FRUB 1F3DH 1PSKL 2IAMD 4EQ2A 5E5MA 4MQSB 4DKAA 4IOIA 1WIPA 4WU7B 5L88L 1KCLA 1AGCA 4NQCB 1K4CA 3L3DB 3ARDB 1YEEL 2CDFA 4ONOA 2VDQL 1FG9C 4WW1B 3BD4A 4HUUB 2CSPA 3RWEA 3F58L 4R2GD 3DHMA 3NZ8A 1T83C 5FA4B 4LCUB 2EKSB 3EIFA 5D71L 5FYJE 5IMKA 4JO4H 1QQDA 1OTSC 3CK0L 4D9LH 3VFSB 1RUMH 1XIWC 1YNKH 3KYNB 4LP4A 2X6MA 3C2AL 2H26A 4XXCC 3BZDA 1YZZA 2ESVE 3BP5B 4L8CB 3C09C 4I13B 1CU4H 1X5YA 4OLZL 5FCUH 5GISH 4LEOB 1FVDB 4Z0BL 3U82B 4U1JA 3ZTNH 1U8MA 2A74B 4Y5VA 1KXVC 3ZKQD 3O6LH 4FXGA 1G9EA 3UJJL 4NO3A 3JV0A 4ZO8A 2LABA 3V6ZB 3VXNB 1NAMB 1W0WA 5ENWA 5F3HB 4LRNL 4JHAH 2ZZUT 2BNQD 1NGYA 3MRCB 3HE6A 3T08A 4AQ1B 1HCVA 2ZG1A 4ORZC 4YXHH 2HG5A 1P2CA 5IJVB 1NH6A 2ARJB 4HUMB 1NL0L 1PX3A 2W9EH 2A9NH 4XP4H 3DO7B 3U1SL 1A6TA 4PP1C 4HPYH 3OKNA 4GRMB 2P43B 5JW4N 4PJIB 1E28A 5E6IA 5ID1A 3VFRA 4BQBA 5F70A 2CKNA 2H32A 4RIRA 4YHNB 2VC2H 4LHUA 3QUXD 1CFTA 2W65A 2YMXL 4LVEA 2MQ0A 2EDQA 4WVRA 1BFOA 4OI9A 3R0MA 4HS6A 3WO3B 5MHSE 3W39B 4NBZB 2BVQA 1PD6A 4W6WB 4HUVB 4I0KA 2X9YA 3V0AC 1S7XA 1ADQH 3CFJA 3BPNB 3FN0L 4R8WH 3A6CL 3VE0A 2ERJB 4P59H 4APQC 3IDXH 3SE8H 2NXYB 5IB5A 2JJVA 1JPFB 2ZOLA 2A9ML 4YAQB 4TUKL 3S34L 3LEXA 3QUMH 3QUZD 1HKLH 2O61A 4UQ2B 4GAGL 5ITFB 1ZGLA 2V5RA 1FRGL 3DV6A 4RGNB 4G3YL 1G7IA 4OUOA 2N1KA 3S35X 1UB6A 1JFQL 4NQED 1HXMB 3GSWB 3O3EB 1CFTB 4OF8A 5D2LB 4AZ8A 2DYPA 1PZUB 1MAMH 1MFNA 1OAXL 2KQMA 3T0AA 2AJ3B 4XC3H 5GGUA 3TGXA 5EWIH 3UYRL 2Q76A 3OAZK 1BIHA 3TM6A 3E1F1 3MRJB 4FABL 1LO2L 5ALBH 5DJ6A 4OLVH 4UT6H 1A7RL 1BFVH 1DVFB 1SY6L 5FYKU 2R23A 4NC1C 2XKSA 1IGFL 1SJHA 5DJXB 2JB6A 1MELA 2XI9A 5KAQG 2DJUA 4EDWH 3NN8B 1JZ7A 2DQUH 3K8KA 3BDBA 4PRAA 5FUZL 3HFMH 4K3JL 3RNQB 3WO4C 4Z7UF 1MJUH 3S3JA 4U1LB 2AK4E 5JR1L 1O0VA 1I8LC 5I17B 1KIPA 3P30L 5TE4L 5T1KD 2IFFL 5GGTH 4WNQB 2R0LH 5C07D 1U6AL 2QADD 5J1TC 2QR0A 5ESVB 4JZOB 5KVDL 3ARGD 5JDSB 1RZKC 3T3MF 4PB9H 4RNRB 2C9AA 2ZUYA 3R8QA 5EA0H 2ZJSL 3TN0C 1WJ3A 2EEDA 4YDKL 3TBYB 1CFNA 3AXLB 4ISVA 4LU5L 5BZDB 4MZ3A 5A43C 5F9JB 1IRAY 4JRXE 5SWZD 4PREA 3RUGA 5CP3A 4FRWA 5D8JH 3K1KC 3V8OA 5HI4C 2GK0B 4MA3B 1Z3GL 4JJ5A 4I5BB 2JK5B 2YOCA 2ESVB 4CNIB 4X0KB 3GI8L 3HI5L 5GRJH 2X4PA 4NNXA 5TQ0H 2AJSL 1WZLA 5C09E 2PKDA 1JHTA 4HF5L 4BH7B 5D2NB 4OCYH 4NQSB 1AC6A 3HE7A 3IT8D 3KPQB 4ESKA 5F1NA 1NDGB 1RZKH 3LKPB 4K3EH 1WTGT 4YGVA 4P2QE 5JW5A 1F2XK 4IJ3C 4NQDB 1E6JH 3AGVA 1FVEB 5CD3A 2OBGA 5ESQB 3UBXG 1N5YL 1CGYA 1UYWH 4XMKL 4WHCA 3VXUE 3WE6B 3DMMD 3WUWG 5DQJB 2VR4A 3VRLE 1F3DJ 5ANMA 5DDHB 4Y4KA 3SJVA 2PXYD 4ENED 5IMOB 3G5XB 1AKJB 5DGQA 4JM2B 1TZHA 2HFTA 4JPIA 4O2CB 1X6NA 5JIKA 3HRZA 1HKFA 5DRZB 4O2FA 4RZCB 4JFFA 1B4JL 4PRNA 1OAQH 3S36H 5DD1L 3S6CA 4K9EC 2A73A 3DIFA 4WWK