1IGJB

26-10 fab:digoxin complex-affinity and specificity due to surface complementarity
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
217
structure length
217
Chain Sequence
VQLQQSGPELVKPGASVRMSCKSSGYIFTDFYMNWVRQSHGKSLDYIGYISPYSGVTGYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCAGSSGNKWAMDYWGHGASVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 26-10 FAB (LIGHT CHAIN)
publication title 26-10 Fab-digoxin complex: affinity and specificity due to surface complementarity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 42
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 1993-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igjB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igjB02
2XWJA 5KSBF 1WIPA 1RK1B 1JTOA 4CMMA 2WSKA 3VH8B 4XXCC 4CN6A 5BZWB 4X7CC 1KC5L 2YA1A 3DIFB 1B4RA 25C8L 4ORGB 2D7MA 3O8XA 3QSKB 3QWOB 3JTSA 1NLBH 1MAML 3STZA 4LLQB 3PQYA 3IU4H 4RIRB 2H32B 2HMIC 1ZSDA 4HMEA 3P0VL 3UO1L 5I6XC 1S9XB 4G6FD 4UQ3B 3TCLA 3RWHB 2BVPA 2C1PB 3TV3L 2V2WB 1NGXB 4E5XA 1KTDB 2FIKB 5AAWA 4PJGF 5B3JE 1B0RB 5J11B 3O11B 3WS3B 4LEOB 2R4RL 3T0AA 2UWEB 3FHAA 3L1OL 1YEKL 2OXGA 4TRPL 2DOCA 5F93C 1N3NA 3CMOH 3SE9L 4HKJB 1G7QA 3C87A 3U0TA 2YEZB 3HNTL 1V3MA 2VRAA 1IC7H 3ZHKA 5FUOH 5ALBH 1N8ZB 5GRXG 1EMTH 4WI2A 5EC2B 1A3LH 3BKJH 4GMTL 4JDTL 3WIHA 1N5YL 3LDBC 2DBLH 2BX5A 2IQ9H 1S7QA 1A1NB 3KG5A 1KLGB 1G0YR 4GS7C 4MJ2A 5DK0B 5HDQL 2ZG3A 3GHBH 1HKLH 3V52H 4OZIE 2NY5L 2I9LA 3GSRA 1NBYB 5FYKU 2YPVL 4IOFD 1J8HA 3UYPA 1IEBA 3OKMA 3VFSA 4PFEA 4PLNC 3LMJL 4O2EA 2OSLB 1NCDH 2X1XR 3LPWA 2OR7A 4JFDB 2I27N 3UBXG 4X7SL 3A6CL 3D85B 5CILH 5LQBL 2MQ3A 4GKZB 1YEHL 4PTTA 4H5SB 3MLYL 5K9JH 3GHEL 4OM0H 1ZLWH 4LQFL 2QHLA 1GAFL 4Z7WB 1LK2B 3IF1A 4NQEE 3L5XH 5T3ZH 1OL0A 1QYGL 2CKNA 3ZSSA 4BQ6A 3SKJL 4UT6H 3T2NL 4HWEL 4K9EH 4R8WH 3A0OA 1WWAX 1GYAA 1KIPB 3N1GC 2ED9A 3H8NA 3QIWC 4M00A 5TFSH 2O26U 1PSKH 4JM2D 1MAKA 1XMWA 5D6DA 4LARH 2ARJQ 3BD4A 3ZHDA 3EYSH 4K2UH 4OD1H 1FG2A 2VLLA 3KYKL 2X7LA 2GY5A 1OARH 1EIBA 4RRPA 1GHFH 1AR1C 2C3XA 4LPCA 3ME0A 3TNMA 3RVXD 5EN2A 4FP8H 5HGDB 3VG9B 4DOHE 1AY1L 3CFBB 1IC1A 2ZWLT 1N2RA 2LTQC 3MXVH 1AP2A 2GHWB 5DURD 5KVFL 3VW3L 2VLJB 3GMMA 4GRLB 1CFBA 3EOBB 1ZE3C 2AEIT 3MLSH 2BFVL 3KS0J 4X80H 3PWPD 1A1OB 2AERT 5FCUH 3THMH 4CVWA 1KNOB 1G9MC 2QV2A 4ONOA 2Z31A 3H0TA 2AK1H 1FHGA 1YEFL 4LAQH 2KBGA 4QXUL 2NNAB 3VFVB 4KK9D 4X6DE 1KELL 3S36L 5JDSB 5DUML 4H88L 2AV1A 1QKZH 1BWMA 1HZHL 1N26A 1KB5H 2BVOA 4NNPH 2Y07H 3CSYB 4X6DA 1EJ6A 3M17A 3DWTA 2PO6B 1XGUB 4KMQA 4XX1E 3QUZD 2FR4B 1BQHG 5HYJE 4H1LB 4NQDB 3HNSL 2IQAB 1FRGH 3BWAB 3MV7B 4XNQB 5IVXA 4NNXB 4ZPVB 4YE4H 4RFOL 3QH3B 1CD9B 3VWJC 5E6IA 3PWLB 5C0CA 2AK4D 1TNMA 3CGTA 2QHRH 5I75B 1EGJH 1T6VN 4YNYB 5IWLA 5HXMA 4FFVD 4LVHC 3UZVB 1JRHI 5L2KD 2CLRB 5E5MB 1VPOH 5JW5B 1J1PL 2DJ4A 5EFIB 3MLXL 4RMQA 3MRRA 3U4BL 5C0DA 4OSUH 4FQJH 4JG1H 3LRGA 4YR6A 2MTPA 4HFUH 1EPFA 4HUXB 4YHNA 1U8JA 5D9SA 4FQ2H 1Q1JH 1QSEA 1XR9B 3O4OB 4NQXA 3DJ9A 2VXVL 5DXWA 4IHOA 2HYMA 2AQ1A 5EIIB 4ACPA 1AD9B 1SY6A 4PR5A 5MHSE 5DHXB 4M1DL 2LAGB 5FYLL 2XZAL 5EA0H 1EA9C 1MCDA 2D03L 3O2WL 5F89B 5DK2A 5KW9H 2XWBA 4M93C 1KSRA 4D9LL 1N64H 3T2QA 2VDRH 1Z6JT 2VR9A 5JHDE 1S5IH 4L3CA 4MXVF 5C7XH 4GKOA 4FFWC 1EUUA 2BCKB 3HG1A 1C5CH 2OL3H 3TJEL 4QT5B 5MEOA 3DX9A 1FNHA 1GXEA 4LSSL 4QRRA 4K8RL 4OF7A 1IAII 3ES6A 4KGLA 1EFXB 2NY6C 3VMOA 2ZJSH 3L6FB 5DJAA 3WO4B 1HQRA 3OXRA 2PR4L 3D3VB 4QOKA 4RFNC 5ICXB 1EVTC 3MBEB 2R1XB 4I0PB 2ILLA 1SJHA 5E24E 2O5YL 4HC1A 3TBTA 4U0RC 3SKNB 4Y19A 4LLUB 2J6EA 1JV5B 5CP3A 3DTXB 1OTTD 4LPXA 1JNLL 5F7NC 4EN3C 1KCRL 2AAVA 1ZHKA 3RWEA 3IS0X 4M9PA 3GRWH 1SEBA 3I50L 4I5BA 1Q9LA 2KUTA 2XQYK 3WS6A 1R0AH 2W92A 1QHPA 3MUJA 1KEGL 4R4BB 3BI9X 4ZFOL 2VXUH 2DM7A 4Y0GA 1ZTXH 3OJDA 2ESVE 3HC0A 2NZ9D 1KIRA 3L5WA 4OB5H 5HYSG 2ESVA 4OLUH 5DTFB 1DLHB 1VFAB 5EBWA 3UJJH 2ERJC 3O2VH 4K07A 3EJZD 2NY5C 5DR5H 15C8L 3MGTB 3GSNH 4MAUH 4HBQA 5B38A 4LASL 3QIWA 2ATPA 3R0NA 4JVUA 2GT9B 2ICEA 4JFZL 4JDVA 5GHWH 4AENB 4DN4H 1KOAA 5FM4A 2VZTA 4PJ5E 5KN5A 4U1LB 4WHTA 4NPYA 3NIGF 2DD8H 1I85C 2YS4A 4JY6B 4WUUE 2LQRA 5BVPH 3X11A 3O9WA 2J88L 2ARJB 4MCZB 4JFYA 4KK8C 4NUJB 5FK9B 4LHJB 2A73A 5E9DA 5ESVB 4DCQA 1UZ6E 3DVNA 3EW3B 4TVPE 1PJ9A 1YMME 4ZO9A 1SYVA 1RIHH 5IKCA 2YA0A 2L4OA 3TNNA 1YMMA 3VFMB 1HI6B 1JF1A 3HPLB 3ZLQC 2NY2C 2ZKHH 3LKSA 4PS4L 2HVJA 3L3GA 4TPRL 5E2TL 1L0QA 12E8L 1A9EB 1J1XL 5CSZB 4M7JL 3N1MC 2OMNA 4XC3L 4OD3L 2DRUA 3CXDH 1B9ZA 1XGTB 4F33B 5I1JH 2VERN 2QKIB 4XCEA 2DTMH 4BUGA 2WAHA 5E0QA 1YY9D 3GSOA 3MFFA 2VIRA 5GS0L 3TBSB 1KEML 5JR1H 1D5BA 2ZOLA 3FRUB 5DJ0A 1PG7L 3AAZB 4JKLA 5F9WB 5E03A 1MQ8A 1N0XH 2L7JA 5DYOA 4WTWA 3PABA 4PJDE 3H3KA 3HI5L 3P9LB 3O45A 5HTSA 2EDFA 5DVMA 4PJDA 3VFRB 5C0ND 3ZT6A 4ELKA 3HMXH 3DV6A 4LSQH 4XB8A 1T1YA 1IGFL 1GC1L 9CGTA 1I3UA 4JFEA 1FNSH 4NQSA 2CH8A 4HS8L 2R4SH 3VWJA 1FYTB 1HHHA 1A6WL 4U2YA 1MCQA 4N8VG 1E6JH 2VDMH 4M6AA 3TO4D 3MGAA 3QG7L 4RAUB 1DQLH 5H94B 3V5KA 1CLZH 2HT4C 3K1DA 2GFBB 2BVYA 4P5KA 5CINH 4D9QE 4M8VA 3F5WA 4GG6A 3K8KA 1M05B 4HWBA 4KK6D 3L7FA 4KTYA 4HX1B 5E1HB 3F65A 3UC0H 4P57B 5A43C 3GMNA 5ERWA 4HUVB 5D1ZD 3SO5A 2PTTA 4A6YL 1I7TA 4UOJA 1A3RL 1HEZA 1QRND 1E4WH 1FSKC 1HSAB 3OL2A 3ESUF 4KUZH 2WP3O 3D0LA 1MRCL 2XG4A 1R3LA 1EAPA 2YPLD 5J13B 1VFMA 3K74B 1EJOH 1HH6B 1JPST 3GSVB 5K9QG 1FFPB 3O3DB 4D9RD 3FN0L 4EVNA 3QULA 4MLSA 2XA8H 3TA3B 5DQ9A 1Q72H 4PRHE 2X4NB 3QIBB 4PG9B 3DETD 3HLAA 2ZNWA 1TVDA 1KT2B 4YHLH 5JUEL 4PRHA 1DDHA 1NJ9A 2AXGB 4NT6A 5KVGL 5I1IH 1INDH 1TQBC 5GQBA 5F8RC 3LSOA 2HRLA 3WFEL 3REWB 5HGAB 3KPSE 4EN3A 2J8UA 3BKCL 4MJIA 4Q9RL 2WUCL 4F57H 3ALWA 1EEYA 1FAIH 1I1YB 1P2CB 1WITA 2QQKL 1LE5B 5DJ8A 1DVFC 2Q7YB 4Z7VF 3QI9C 4JFPA 3MRKB 2WBJB 1UADC 3WCYA 3RUGF 4FQHA 5IMMB 3G6JA 2DF3A 4PJCA 1N6UA 5CJOH 4XP9L 5AZEL 5KVEH 4XMKL 5JA8B 4IRSB 3QIUA 1IBGH 1MCOL 4LRNL 4LIQL 3KYOB 5I1EH 2EDBA 4R3SA 3RWCA 4Y2DC 1F6AB 3ARDD 3FQRA 4NM8H 4U33A 3ARGC 1GGUA 5BZDB 4AM0B 4U1GB 1XT5A 4OGAD 1I1FA 4WHDA 3CLFH 4NYLA 5DSCB 2NY3C 4JDZB 1IC5H 5HHVL 1VCAA 1WWWX 2DLFL 4N8PA 5D7KD 4FQ1L 3W11D 1QBLH 4L29A 2C3GA 3MA9H 5IMLA 3CVHA 5KS9F 4Y5YB 1BEYH 2R2BB 4OCSL 4YGVA 5CUSH 5L8JB 4HJGA 4N0YH 2Q87A 4HW6A 1IT9L 2WINB 5E08H 1S9VB 4JFFD 2VXTH 1E27B 2MMXA 1PY4A 2D7TL 5ALCL 4XTRD 3V6FB 4QF1B 1BQLH 2F8VA 4NZRL 5C8JA 4LHUB 3V5DA 5FM5M 4AH2A 4J1UB 1KFAL 1GOHA 3JWDL 4N5ED 2JCCB 3VU2A 2V17H 3VFOA 4FABH 4GT7A 1FFRA 1RULH 2IADA 4WWKC 4O2CA 2EC9T 2BMKB 3S36X 3B9KC 1OP5K 5JXED 2IWGA 5C08E 3OHXB 5E8NA 2Y4SA 3MLRL 3D2UB 2DI7A 4NP4L 4LDEB 4WUKL 2DLHA 5HHOE 1PDKA 3K80A 2R56L 4Y5XA 3WN5B 2VTFA 3L3OB 5GJSH 4ODVL 3O6FC 4HUKB 3KPQB 5LXGL 1JPGB 1FLTX 3W39B 4UDUA 2BNQA 5C6TH 2QSQA 4GRMB 1OAKL 2ED8A 5GSVA 5TDOB 5DLML 1H8OA 2HFGH 2EC9U 5AWNL 3ZE0E 2ADIB 1BJ1J 1DLFL 1TVBB 4Z7VA 4JREC 4ZUUB 5E8PB 1X5KA 4LVNB 3HAEG 5JNYA 1GGTA 3X3GL 3P4MA 2GKIA 1P84K 5D1QA 1B0GB 3LN5B 5I9QC 2F8XC 1TJIL 4W6YB 3I6KB 3UPAA 2E7BA 3L3DA 1U9KA 3QEQE 4KHXH 4NN6B 4YHZL 5EWIH 5AEAA 2LVEA 3QEQA 3WKML 1IZKA 1A7RL 4KVNH 2XWJB 3OGOE 1FZKA 3CH1A 5DRNA 4CMMB 1FL6A 2V7NB 5DUPH 4J6RH 3BPCA 5TF1L 1DBJL 1GC1C 3O8XB 3PP4L 1BBDH 1U8PA 5E2JA 3JTSB 2Q1EA 3HNVL 1FRGL 3KPNA 1MJUL 3STZB 4TN9A 3PQYB 2VZUA 5DZLA 3KXFA 4J3SA 5A2FA 1ZSDB 4L4TD 3P11L 4JANA 3VA6A 5TE4H 3TCLB 2BNRE 1RZJH 2BVPB 5ID0A 1D9KA 4E5XB 1UB5A 5C09E 4N1CA 1U3HC 3AS0A 3BN3B 2XTJD 3TZVA 3NIFF 4M1CC 1R5WA 2PYEE 2Z93A 5C09A 1N3NB 3TT3H 3QQNA 3DUHA 4KJPC 1G7QB 3U0TB 5KTEL 3E8UL 5DWUH 4GRWB 4R2GB 1CD8A 4NUGH 2J8HA 3T0WA 5I66B 5CJ5A 1QLEL 5MP6H 2R0LL 5M7QA 2J5LC 3FQWA 2OCFD 5L9DL 1S7QB 4PGEA 3ZHLA 3FT3A 5KSUA 1P4BL 1CIUA 1FH5H 2OLDA 2X1PA 4D3CL 5J3HC 3O6LH 3SE8H 4JKPL 4KTEH 4DAGL 4KDVA 5DD1L 2VN4A 3ZKXC 1D5MA 1BD2D 1N64L 4P2OC 1DVFA 1QSFD 3SGEH 1J18A 3QI9A 1R5IA 5EO0A 2R2HB 4EDXA 3OKMB 3VFSB 5K59E 1YEEL 3MCKA 3IDNA 5SX5K 4N0UE 5CIPB 4O2EB 3VD7A 1AGDA 4KQ3L 5HVFB 5F7EH 1TPXC 3ARTA 4ZNEA 4PTTB 4Y2DA 4DUXA 4MNQA 3ARGA 3N1FC 5AYUL 3IF1B 1AI1H 1KB9J 1ADQL 3U1SL 3HRPA 1RUAH 1IAOA 4KJYA 3S8WA 3MV9D 4NQEB 2I5YL 2A83A 1T5XA 2BHYA 4X9IA 3OPZL 3OR7A 1JFQL 3BUYA 4G7YL 3AS2A 3EHBD 4WFHE 4XHJC 5EG6C 3BKMH 1VB9A 1NANI 2ICWA 3VRIA 2ZCKL 3C09C 1KCKA 2EZ0D 1UC6A 5L0QB 3MBXH 5EUOF 1FG2B 3MJ9A 2X7LB 4XAWL 5IB4B 3U6RA 1B2WL 5IBUG 2AJYH 2WANA 1XGYL 4GAJH 3TNMB 5EN2B 5SWQA 4NQCE 4M8QA 2NY7L 1XH3B 1ZVSB 3DXAD 4I18C 3NMEA 4WW1A 4RX4A 3ECBA 5BRZD 4PJXE 4UINL 1N2RB 1AP2B 3B9KA 4DOHB 4RGOH 1MNUH 2CJUL 3GMMB 4HAGA 4KTDH 4NQTA 1F4YL 1OAQL 2B2XH 1F6FB 2VH5H 1CGTA 1PEWA 1X5ZA 2CRIA 2HLFD 4DW2L 1DQQB 1A47A 2V2XA 2V9TA 4PRPD 1BZQK 2Z31B 3H0TB 4IBLT 1RJYA 4PJEE 1MJ8H 3O6FA 4QXGH 2JJUA 2NQCA 1I7ZA 1J1OH 4X6FA 4JRXE 4PJEA 2AV1B 3EFDL 2AJUL 4XHQA 2XI9A 4X6DB 1Q9KA 2F19L 4GFTB 5J56B 3JWDC 3FAWA 3MLVL 2A77H 2B39A 4YAQA 1F8TL 2F58L 3MSPA 3VGAB 3MRHA 4K9EC 4XT1C 5I1DA 5IVXB 4FG6D 3NCBB 3H42L 4I77L 4UB0H 3IU3A 3LPGA 5E6IB 1NKRA 5C0CB 3GB7A 3QG6A 4HZAA 4ZSOE 1S7UA 4NBYB 2VDOH 5HYFA 3RQ3A 4ZSOA 4NQVA 1X7QA 2CRMA 4U1KA 1OAXL 5FECA 3CLEH 3MRRB 3IJYA 1U0QA 5C0DB 3MOQA 3OKLA 1RZIA 3C60C 3LCYA 5I15H 1MCPH 1T1XA 3CFDA 3H9ZA 1U8JB 5D9SB 1QSEB 4NQXB 3IDJA 5EZJA 4PYGA 4QRPE 5IW1A 4QRSA 5DVNA 4PR5B 3SDAC 1K6QH 5IV2A 4HCRH 4ZTPH 2VDLH 2RQ8A 5DK2B 2XWBB 5T1LA 5GRVL 3W9DB 5LCVH 5BO1H 2WBWB 1U3HA 4L3CB 1IM9A 4WW2A 4DKFL 1S8DA 4P2QE 5MEOB 5IEKA 3DX9B 3GMLA 3DYOA 4QRRB 5EUKA 4WGVB 3C2AL 4P2QA 4YK4C 4KMTL 3QDJE 2UZIL 2WLZA 4DN3L 2VAAA 4HLJA 4NJ9L 2IPUK 2BXZA 4Q6YA 5I8CA 5FGCE 1HQRB 3LDBB 3OXRB 1ZS8A 4QOKB 4CUCA 1JGEA 4JFDD 1YA5A 4IOIA 3OB8A 1SJHB 3D85D 4GS7B 3GI8H 4PGDB 4XPBH 4NM4H 4OLYH 5BOPA 2RAMA 3TBTB 2YA2A 4Y19B 5C0EA 5D2LA 1WZMA 4FFYL 3H6JA 5JPMA 1XF4B 1ZHKB 3QCTL 3RWEB 3MRBA 5HHME 4QHMA 3TT1L 4GUPA 5CJQH 1SEBB 3I6LD 1CL7L 1BAFH 2Z0BA 4I5BB 1Q9LB 1QQDA 4I3RL 3S88L 4JKKA 1X5GA 4JN2A 2BSED 4NN7C 2IFGA 4HUWA 5JIPA 3T0VA 3X3FL 1UM5H 3OJDB 3E3QC 1NMBH 2VXQH 3MREB 3SGDI 1KIRB 4ZO8A 3W81A 2HTLD 3L5WB 5MENE 2B0SH 2ESVB 5EBWB 3SOBH 3TH4T 5I1IL 4HV8A 1LO4H 4G80A 3GFUA 1D6VL 3MCLL 1DZBA 2WLYA 5B38B 4CNIA 3QIWB 2ICEB 1ZHNB 4JDVB 1NFDF 4YHOH 1OAZH 3QJHA 4LIQE 3FMGL 4WHTB 5CEZD 2OZ4H 4UZGA 2VLJD 3O0RH 4GRLD 3L5IA 3X11B 3WXWL 5FYJH 4IJ3C 4JFYB 1IAKB 2EO9A 4M7LT 2A73B 5IFAH 5E9DB 4DCQB 4I3GA 2VITB 5I71C 3S3PA 4M7ZC 3RIFK 3T4AA 3DVNB 4CDGC 3HUJE 4XI5D 4OCXH 2W9LA 4PJFF 3AS3A 4OLVL 3W82A 1SYVB 4JN1L 5IKCB 4I18A 3C6SB 2HKFH 3HUJA 1RZKH 3TNNB 1YMMB 3HC4H 1JF1B 3PWVA 2LTQB 4XNYL 2ED7A 3LKSB 2HKHL 2PO6D 3C5ZC 5B39G 4DGVL 3OSKA 2HVJB 3P0YL 3L3GB 4ETYA 5A40E 4YDVA 1HOCA 2YN3A 3AU1A 4XMPH 5D6CA 5IMOA 1HCVA 5DHVA 4H26B 3H9HA 4NQDD 2VISA 3T4YA 3MV7D 4NKQB 1A14L 2VN7A 4FTVE 4AMKH 1KBGH 1PLGH 1MRFH 1ZA6A 4DVRH 4XCEB 5F21B 1S3KL 4HFWA 3GSOB 1LP9A 2VIRB 3MFFB 3BEVA 3B9DA 1DP0A 5T3ZE 5F71A 1D5BB 2ZOLB 5DJ0B 5GGRY 3LRSA 3V6ZA 1BQLL 3QUYC 1HXYA 4I3SH 4XPFH 4Q9QH 3PABB 3PF2A 1T7YA 3RVVD 2DM4A 3O45B 3LKRB 4UT7L 4LVOC 1YYML 4PJDB 3G08B 5L6YH 2CIKA 4ELKB 5FM5O 3DV6B 3VXME 3CPLA 1T1YB 3L3KA 4JAMA 4NCC1 4NQSB 5FM8A 1G6RB 3VWJB 1HHHB 3VXMA 1CDBA 1FZOA 4EBQL 3CXHK 4HIIA 5JTWA 2Y06H 4K3EL 3EIFA 4JQXC 5BJTB 1CLYL 4LVHB 3ARVA 4LLDB 4U1NA 3UAJD 2P8PA 3TH2T 2AP2A 4Z9KB 3V5KB 2ID5A 4XWOD 4HIJB 3GMRA 4P5KB 3F5WB 4GG6B 1IAMA 5GGVY 4G6AC 5KBNC 1A6TA 3HAEH 3QQ3A 4D8PA 3L7FB 1JTTA 1DBML 4MXQD 4KROC 3C60A 4FXKA 4AIZA 2EYRA 3GMNB 1YEJH 5ERWB 4POYA 4WFED 1EFXD 4HMCA 3HFML 5I8EA 2P8MA 1IJ9A 1N4XL 2PTTB 4YXKL 1I7TB 3S35L 1UYWH 3SDAA 1ZEAL 1HEZB 3HR6A 3ZDZE 5FKAA 3H2WA 2GJZA 3D3VD 4P9HH 4M93B 2J7LA 3D0LB 3MBED 4I0PD 2X9XA 1R3LB 5SWSE 3WFDL 1EAPB 4TULL 4WU5B 3QFDA 1OCWL 5IBLC 3ULVD 4XPTL 4U1SA 5SWSA 4EVNB 3QULB 2XTLA 1KB5A 1FBIH 1VGKA 1CGXA 2X4OA 5DQ9B 2NY6B 1UB6A 2OK0H 2AXFA 5HHXH 3T08A 5JOEA 3HLAB 1OAUL 4X6CF 3DI2B 3IS1X 4PRHB 1DDHB 4RFNB 1LDSA 5T3XH 1NJ9B 1JPTL 3Q2CA 1NMAL 4NT6B 3RGVC 2F53A 1ORSB 4QRQA 1GOFA 1WK0A 4Z8FH 4KJQD 2XZCH 1TETH 1L4IA 4U0RB 4JM2F 3LSOB 1IQWH 3PL6C 4PB9L 5SX4H 3RDTC 4EN3B 1QFUL 2J8UB 1D6EA 1U2CA 4MJIB 3MLWL 3EDDA 4HULB 4MZ3A 4X98A 1EEYB 2JK5A 5I17B 3L3IA 5GGQH 1W0YT 4NZUH 3GI9L 3N06B 4JFPB 5DO2D 3U9UA 4O58L 1MFCL 1JGLL 2YD4A 4FRWA 3FB7A 2A6IA 4JHZA 5DRXA 3FB8A 4FQHB 1FLRH 4OM1H 3G6JB 4PJCB 4YBHA 2GUOA 1HILA 4YBQD 4M6ML 3S5LA 4HJJH 1DTUA 1KCVH 1N7ML 4R3SB 8FABB 3RWCB 1D5IL 5JW3L 4AIXA 5CSBA 1FO0L 2IGFH 2B1HL 3FQRB 3JV6B 4FQLH 1KPRA 2Z8SA 1I1FB 4NYLB 4XP6H 2ZP0T 4YDIL 3HC3H 2H2PC 4OIIL 3BDYL 3FO2A 2D0FA 2OL3A 4YQXL 1AC6A 1BM3H 2ZUVA 5BMFL 4L29B 2ZUWA 3T8XA 3GBLA 5IMLB 3CVHB 2H45A 1CI5A 2DJUA 2VDQH 1DSFH 1H3XA 3WHE1 4HJGB 2X89A 1I9RL 3AM8A 2XV6B 1NCAH 1CD1A 4F7CA 1MPAL 3S4SB 3MOAH 4URTB 1KJVB 3BP7A 1QP1A 3ILQC 3C6LC 3QQ9C 2EYSB 3BGFC 3V5DB 2HJKA 1AXTL 1JGVH 4BM7A 3KPMA 3WJLC 3QDME 2NY2B 5ID1A 1UCBL 4R7NA 3VFOB 1MHEA 3N85H 4EQ2A 3C5ZA 5HHQA 2IADB 4U1MA 3QDMA 1GJIA 3GRWA 4EXKA 1YC8A 3DOSA 43CAA 4C4KO 2HFFB 3TFKD 5E8NB 3VGFA 5IF0A 3S34H 2F5AL 1ZLUH 2ZOKA 4X6CA 2YD5A 3RAJL 1IAIM 2AJ3A 1FYTD 1BPVA 3PE9A 3JV5A 5GS1C 2DICA 2PF6A 4TOYL 1B0WA 2QADB 4BZ2L 2FB4L 4DKEL 1Q0XL 2HT3D 2X05A 4KY1L 3QUYA 5IOPA 1MFDL 4FQCL 5GISL 2YZ8A 2XWTA 3HRZA 4PJ9C 4UDUB 2BNQB 1U2HA 3GSQA 5L88L 1MJ7L 5GSVB 3QDHA 3BN9C 5C1MB 5I1HH 3L3HA 3OWEA 4JFHD 5ABDE 3GSNA 2Z4QB 5INDA 2X1WL 5TQ2L 5JW4Q 1IFHL 1DQJB 1HHGA 5JNYB 5C86A 1J05A 3P4MB 4CGTA 1O7VA 3D9AH 2FIRT 3GBMH 3OG4B 4JQXA 2FBJL 2FECL 4JRYE 5IHLB 3HE7C 3ARQA 3U7YH 1TTUA 5GPRA 3L3DB 5IEHA 4JRYA 4KKLD 4YFLF 3EO0A 1F4AA 3RWFA 3QEQB 1P5UA 4M6NL 2Y1VA 3B2UD 1FZKB 3S3JA 4UIKL 5TPWH 3R8QA 3F6LA 3Q1SH 4XWGH 3TA3D 1FL6B 1ZLVK 4V2CB 2X42A 1VHPA 4N68A 4YXHL 3QIBD 4UT9H 5L2JA 3BPCB 4KZDH 1F11A 1TNNA 1IKFL 1FSKB 3ZKND 1U8PB 1V7NL 3Q0HA 7CGTA 3KPNB 2AGJL 3BKYL 1PEZA 2EXWD 3NIDF 1JP5A 3KXFB 4RISH 1S7XA 2D31A 4NRYB 4JANB 1BQSA 4JY5L 4JG0H 4BQ9A 3IDIA 1E0OB 3NFSL 3NCCB 1D9KB 4P49A 2PXYD 3OAZH 5J6GA 5KAQG 1UB5B 3O3UN 2W0KA 2BNRB 1FVCA 4F7MA 1RFDL 5CSGA 2CKBH 2Z93B 4XVUC 5C09B 5I1KL 3JWOL 2DQEL 1DE4A 1KLUA 1NDGB 2W9DH 3W2DL 2WBJD 3VXNA 4PY7B 3QO1A 3CVIH 3RGVA 3HMXA 5IFHH 4I4WB 1TQCC 3LY6A 2EKSB 3FQWB 2AJSL 4IRSD 1TQBB 2IMMA 3TJHD 3PL6A 4AT6A 2CPCA 4PGEB 3RDTA 3FT3B 3H9YA 3A6BH 5KSUB 4WI6A 2FO4A 1BGXH 5IHUH 4LK4A 2A9ML 1UXSA 3UTPD 4A2MA 5JQ6H 1D5MB 1KJ3L 1DVFB 3U83A 3QI9B 1R5IB 5EO0B 1AGEA 4EDXB 5I30L 1P7QA 1U8LA 4RMWA 1FCGA 3MCKB 3IDNB 1G9NL 1MCBA 4TSCL 4Z0BH 1AR2A 5HI3C 2CO6B 4DQOL 4U1IA 4I9WE 2ZCHL 2EE2A 1ZHBA 2FX8L 4Y2DB 5IG7A 4MNQB 3ARGB 5KSVB 4LHUD 1X5JA 1CVRA 2NY3B 4HUNB 1IAOB 5E4IA 4KJYB 3ULUH 2A83B 1T5XB 2YD6A 43C9A 1AH1A 1RZJC 1DQTA 2VOTA 3BUYB 3U2SA 5J1TC 2IBZY 5T1MA 1MIML 5GGSA 3MX0A 3H3PL 4MA8L 2ICWB 2CLZA 1F00I 1UJTA 3Q6GH 3OJMB 3C6LA 3D2UD 1Z9OA 2I60H 5TQ0L 5FEBA 3JUZA 4HWZA 4WHCA 1LD9A 1G7PA 3WJLA 5SWQB 4M8QB 5EIVA 4EUPG 1EO8H 5I8KH 3SOBL 2NXZC 3MJ7A 4WW1B 4Q2ZA 4XNZC 3OZ9H 4J3TA 3ECBB 1MIEH 4WWKB 2I07B 1KIUA 4JPIA 4K7PY 3KJ4C 4PUBL 4BK4A 4DGYH 3B9KB 3SDYH 4PJAE 3FT4A 4ZO7A 2AVGA 3QXWA 3HE6C 3TCXA 1MHCA 2Y7QA 4XNMA 4YX2H 2AQ2A 2C5DC 4OZFH 3RX7A 4QHKI 3NCMA 5FDYA 4CMHC 2EO1A 2V2XB 3B6SA 5GS1A 4KPHH 4Z7QE 3O6FB 4C56E 1I7ZB 5JHLH 4X6FB 3V6OC 4PJEB 3Q5OA 4UBDC 1T1WA 1R3JA 4ELME 4JRXB 4PGCA 1NSNH 4MNGA 4GQ9H 4JVPA 1RUPH 1CR9L 1FZMB 5DGRA 4YAQB 5E7BA 4OAWA 3QDGA 4JREB 3EJYC 4P2CG 2OYPA 4POZD 4F7TA 4OCWH 3IU3B 5I9QB 3O8XD 3J8F7 5EO9A 5SV4A 3FO0H 3HE7A 3GB7B 1MWAH 3N9GH 2XRAH 1CXLA 1HHJA 3QG6B 4HJ0C 3RWJA 4X7EC 1A4KA 4HIXH 1F3DH 1S7UB 4LNRA 3PQYD 5T5NF 3CX2A 2H1PH 3R8BB 3LQAL 3KYMA 2ICCA 1SM3L 4ZSOB 4NQVB 1X7QB 4PJIF 3SEPA 4MJ6A 4LSVH 1KPVA 4LSUH 1UQSA 3UCRA 3S35X 1WISA 4U1KB 3QPXH 1IGYA 2E5EA 5FECB 3IJYB 4F9PC 3WNNA 4TYUA 2PYFA 3VD3A 2CUHA 1XGPB 3KR3L 1F3JA 3DSNA 3CFDB 4IDJH 1G7JA 1KYOJ 2QQNH 3IDJB 5EZJB 4R2GD 4QRSB 5IW1B 5IV2B 1CBVL 5DQDL 4K23H 2Q76A 1UGNA 4H8WL 2MSPA 1U58A 5T1LB 4UTAH 5FUZH 1X9QA 1L6ZA 4D0CB 1EO5A 5F9OH 5TF0A 1U3HB 1IM9B 4WW2B 2YKLL 1S8DB 1UKQA 3ZYOA 1UKSA 4LOUC 5E6YA 4QTIL 3ZZ1A 5IEKB 4KGJA 3GMLB 3TWCL 3WLBB 1A7NL 4P2RE 5EUKB 5C0GA 4P2QB 3EGSA 5DJXA 3U0WL 4PBXA 4YIQA 3QJFA 3I3DA 3EKCA 2VAAB 1I1RA 2NYYD 2PW2A 5I8CB 1X5AA 3QDJB 5E2UL 2J5LB 1ZS8B 1JGEB 1A6AA 4IOIB 5FGCB 4LMQE 3RFZC 4KH2A 3F7YA 1W8NA 4UV4H 2APWA 4RBPH 5C0EB 5D2LB 1ZGLA 3ZKXB 1T2QL 5JPMB 1KTRL 4EIGB 1NCBH 3LS4L 5KAQF 2X1OA 5ACMA 3MRBB 4QHMB 4GUPB 5EULV 3SDDC 4NQED 2R69L 2AV7A 4UILH 1QQDB 4AEEA 3SBWC 2XZQH 4S1RH 1N59A 4OGZA 3G6DH 5HHMB 5HI4D 4JN2B 3BMWA 1C5BH 3UTQA 3B9EA 4NHUA 3G04A 3ULSA 1OW0C 2EH8L 4N0RA 1TPXB 4HUWB 5HHXL 1S7RB 5FB8A 2NX5E 4LCWE 1KENH 3RZWA 4B5EA 4M43L 3WLWD 4WTZG 3RIAK 5DVLA 3VH8G 1H9VA 2NX5A 1LNUA 4MA7L 4N8CH 5I1CH 4NWTL 1EO7A 4JGUA 4HV8B 3MUHL 3ZYIA 4G80B 4AG4H 4PBVC 1JHLH 3JSSA 1L7TL 1KIQA 2OQJA 3EYQD 2P49B 2VZ1A 4CNIB 4J3OC 4BUHA 1HYSD 2ZUSA 4CADA 5HGHA 3O3EA 3QJHB 3HCVA 1DBAL 3C2SA 1SBSH 1JMZA 1RV6X 3WMSA 2W9EL 4QNPE 3WEXB 4JJHA 2Z31D 1ZLVH 1TZGH 3T4AB 2UUDH 1BQUA 4HJJL 4JM4L 3ARYA 3PUCA 4I18B 3QCVH 3HUJB 1UH4A 3V8OA 2AQ3A 3PWVB 3FJTA 3QO0A 2EXYD 3TBYA 5DD0H 5FCSH 1MCIA 4YDVB 2O5XL 1HOCB 3AU1B 4MS8C 5D6CB 4TQEH 2K7QA 1RUMH 3H9HB 2VISB 5C9JB 3T04D 3T4YB 2VL4A 1KG0A 2P48B 3V6OE 1OGAE 2ZUYA 1ZA6B 2CXKA 5E6ID 4V1DE 4HFWB 4HF5L 5C0CD 1LP9B 2L7UA 3BEVB 5DK3A 4O5LL 1OGAA 2HRPH 5EORL 5JPNA 3MV8E 3CX5K 4M5ZH 4FXGA 3LRSB 3V6ZB 1LGVA 2R0KH 4J3VA 2R8SL 4TUKH 3RA7L 1HXYB 3MV8A 1ROWA 4GXUN 2R23A 3JVGC 1JPFB 1MI5E 3IXTA 5GRZA 1JHKH 1NGPH 3WIIH 2CIKB 2VO5A 1XCTA 1L6XA 4RMSA 3L3KB 4JAMB 4KKCC 3K4AA 2EE9A 1L9NA 3VXMB 1WFUA 3PGFL 1QSED 1FDLL 1GSMA 5HYSA 4HIIB 3N0PB 4XP1H 3VFUA 2HMID 1YZZA 3NH7L 4JZJC 4U1NB 4XCCH 4J4PC 3GUTA 2P8PB 4Z77A 3BYYA 2FEEI 2VR5A 3GMRB 1KJ2L 5F96H 2XQBH 1A6TB 4L9LC 3QQ3B 4D8PB 1K85A 5FAAA 2JIXA 3C60B 4AIZB 4QRRD 3AMLA 2EYRB 2X4UA 4AL8L 1RZKC 1EHLL 1P7HL 3NGBC 1HXMA 2ICWI 2P8MB 1QPXA 1A0QH 3SDAB 2A1WL 1X5IA 5FKAB 1QFWI 3KYNA 4QOKD 2KZWA 4ZS6C 2IPKA 1DN2A 1G7LA 5CJBA 1T66C 3ZDYF 2RCSL 2JTDA 3NTCL 3QEUB 3QFDB 3BP5A 1UM4H 3BO8A 4MDIA 2OJZH 4Y19D 3VGDA 4U1SB 5SWSB 1E28A 3GJFH 4YK4B 1VGKB 2E8YA 3J7HA 4K94L 3BPOC 4U1HA 3RNKA 2X4OB 4X7FC 1S7SA 1UB6B 2AXFB 5JW4M 1MCEA 4U05A 4WHYH 3DSFH 4U6HB 1RHFA 5HYQA 1TDQA 2V6HA 5D4QA 2Z92A 3G5VA 1WTGT 3B83A 3ZE2E 2F53B 1E4XH 4QRQB 4YZFF 1MREH 2CLVA 3QXUA 2DQIL 4H1LG 5C2BH 4HUUA 4R97C 4R4FL 3UJIL 4P59H 4WCYL 3WL9A 1IE5A 2ESVD 1D6EB 4L8CA 3L5HA 1A7PL 3M1BA 3PXJA 3SDDA 3MRQA 2GITB 2MWCA 3K46A 2JK5B 5E8OB 1CWVA 1NAKL 3L3IB 1A1MA 2FH8A 3CDCA 2BRRH 3OAYK 3U9UB 4BZ1L 1ACZA 4NN7B 1DBKL 3V4VL 5GGTL 1YNKH 3QIWD 2A6IB 1YDPA 2XICA 5EOCL 3FB8B 2DBJA 3C9NA 4APQC 3FOLB 4G6JL 4ONFH 2GUOB 1HILB 4XXDA 3IFOA 2OR9L 1OAYL 2GYSA 5E8DH 4OLXL 4L4JA 4P9ML 1JK8A 4N90E 4OQTH 5E9DD 4HCRA 1HCFX 1AR1D 1KPRB 4P9HC 5KSAC 3GZKA 2B4CL 4OD2B 2CQVA 3O3BB 4TVPD 2FHBA 1YMMD 2OL3B 4QYOA 1V8HA 4NGHH 4K3JH 1R3IH 3WXVL 1FORH 1ZLSH 3T8XB 3ARBA 2CO7B 4G9DA 4ZTOL 1FC1A 1J86A 2YMXL 5I18H 1KCSL 2EYTA 1CD1B 5I71B 3BP7B 4TUOA 3GNMH 3KWWB 4M7ZB 4YXLH 1B4JL 1CFSA 4XPHH 3B2VH 5FO7B 3IETA 1OM3H 3NCEB 4S1QL 3KPMB 5ID1B 4BFGA 3C5ZB 5HHQB 4U1MB 3QDMB 5C0IA 5IK3A 4UV7L 43CAB 2AABH 4L3EE 2OMBA 3O6ML 1BOGA 4LQ1A 4JHAL 4XNXL 5IF0B 2UWEF 2X4RB 1VFUA 2ZOKB 4QXTA 4L3EA 3VWJD 4EUPH 2E6PA 3CCHA 3D39E 2VMFA 1IGMH 3QUYB 5IOPB 1Z2KA 2XWTB 3HRZB 3JVGA 5I19L 5CHNA 1NLDL 1AFVH 4LVOB 5A2KH 2YXMA 2DQTL 3BIKA 5EUOE 4L5FH 3L3HB 3GSNB 3ZE1F 4YHIA 5INDB 4D9QD 3K4DA 3AC0A 4JFQA 1J0JA 1SQ2N 4D0BA 1HHGB 1JGUH 4RA3A 3GM0A 4MVBC 1OB1B 3MGOA 2P7TA 3VDAA 1DQDL 3VI4F 5DJZA 2OZ4A 1U6AL 3JV4A 4P48A 1K3ZA 4ALAH 2XY2A 3V4PH 1F58H 3IFNH 4N9GA 4E42A 1F4WH 4GKSA 4QKXB 5IEHB 4IRJC 5IBTH 4DFIA 4JRYB 3BT2H 3BH8A 4MDJA 3U9PH 3UTTE 2HWZL 2BHZA 1NMCC 2DQFA 3CFEA 3EO0B 4FFWD 4L9LA 3MJ6A 3WFCH 1S9KC 3WFBH 4PRPA 4ONGH 4Z7WF 1W0VA 1RY7B 4MQ7A 2YWZA 2XFXA 2NY6D 4JKWA 1PAMA 2F8OA 4MHHI 1ED3A 3RPIA 1YEDA 3MODH 1F11B 3VXRA 1H3GA 3V0AC 4L4VE 1A5FH 1MELA 4PRHD 3CFCH 1I7RB 4OZ4A 5EDXA 1I8MA 1BWWA 1S7XB 4XCYB 4FQPA 1NCCL 5I1GL 2B20A 4NWUL 4EN3D 5BZWA 1U8NA 4MJID 3ARFC 1FVCB 4F7MB 2X09A 3OF6A 2BJMH 3I2CH 1DE4B 1KLUB 3VD9A 1FQ9C 1JNNL 1T5WA 1HSBB 1LK3L 3OJ2C 1LO0H 3QO1B 1HIML 3RGVB 1H3WM 2VSDA 1NGXA 4Z18A 1NUGA 4JE4B 2FIKA 4AEFA 1L0XA 1CZ8H 3O11A 3O3AA 5DC9B 4AT6B 2UWEA 3PL6B 5T5FH 5LGJA 3DLQR 4NZTH 3RDTB 5CCKH 2FO4B 4FNLL 1A7OH 1LMKA 1A21A 1U42A 1OGTB 1UXSB 2YEZA 1M7DA 1BX2A 4MJ5A 3IDUA 2AJXH 4LSDA 4MD4A 4HKZA 1GL4B 4JEGB 2B7DT 5EC2A 2O93L 1P7QB 2E9BA 2CGRL 1U8LB 4IOFC 5E8EA 3HAEA 3IDYC 1A1NA 1W72L 2G5RA 1MRDL 4APQA 4WY7L 3SN6N 3TIDA 2IANA 3NAAH 4U1IB 2W59A 2Z8WC 4U7MA 1UWEH 1ZHBB 4KK8D 3SDXA 1J7VR 4YJZL 4X5LA 1QG3A 4WI7A 3TO2A 2W0LA 3QCUH 5KSAA 5D2NC 3UJTL 1GGIH 2JJSA 1SEQL 3REVA 1WZLA 2RGSA 4S2SB 3EFFA 1ACYL 3I9GH 4JFDA 2YPKA 4MLIA 43C9B 1MCRA 3BDXA 4AEHH 2NY2D 3QUML 1IGIL 1EHAA 3MRJA 4GAGH 5J12B 3QRFM 3U2SB 1ZT7A 1CXEA 5T1MB 5GGSB 1NCWH 2I26N 3L3JA 4ODBD 1F45A 2XZQL 3GSUA 5T3XE 1LK2A 3T0EC 3MLUH 1CCZA 2MQCA 3A6OA 3C6LB 3BJLA 2QQLL 2DMBA 1NH6A 1NKOA 1KTKE 3BGFB 2J4WL 4HWZB 3UMTA 2BSSA 3VGGA 1WQVT 4G3YL 1JMXA 2QADD 5DUBA 4RDQG 2V9RA 4ODSL 3GK8H 4LEXH 4MXWL 2H26A 2B4CC 2AXHA 4F7PA 3MJ7B 4Q2ZB 2UVEA 4DTGH 5D72L 2BNQD 1YQVL 3FL7A 2XACC 1J0IA 3FT4B 3PWJA 4WNQA 1MHCB 2Y7QB 1T04B 4XNMB 5C3TA 3FAXA 4PJAB 2R0ZL 2IH1B 4Q58C 3I3EA 2FATH 3EYUH 4QY8A 3B6SB 5GS1B 3DV4A 1VGEH 2Z35B 3MLZL 5BV7L 2R0WL 5E2WH 1CE6B 4C54A 3TBVA 4FFZL 3U30C 1X5YA 1NFDE 2HT4D 1T1WB 1R3JB 1NPUA 4PJ9B 3VFGL 2MKLC 4PGCB 3TVMC 1QZ1A 5J06A 5JXAH 2G60H 2CDGA 4Y8DC 3VXUA 4HGMA 4JR9H 4S1SL 2D2OA 1XF5A 3QEQD 1T0PB 5GJTL 4ELMB 1KNOA 3HR5A 4OAWB 3QRGH 3QDGB 3ULUC 1YEGL 3ULVF 1VKXA 3UBXB 5IW3A 4MA3A 3BGMA 5FO8A 2NY4C 3NFPA 1U36A 5C0BE 4F7TB 5CZXC 5CD3A 5IHZA 4RAHA 1RURL 5EO9B 3HE7B 4WI4A 5C0BA 1HHJB 3RWJB 2GK2A 3OAYH 1A4KB 2CXGA 4LNRB 1XGUA 5FYKL 3QEGL 1KC5H 5H37G 3KYMB 25C8H 3KXFD 2Q8AL 3R06A 3DVGB 3UXFA 4NQDA 1MAMH 1KPVB 1D9KD 1UQSB 3BWAA 4XNQA 3VXSE 5IW6A 1YNTA 4ZPVA 4PY8I 3LKQA 2ZNXA 2BNRD 4AY0A 4Z7OF 3UO1H 3P0VH 3GMPA 3EO1A 5C09D 3TV3H 1F3JB 3RIFF 4DZ8A 3RVUC 4YH6A 1MFEL 2R4RH 2X44D 3L1OH 1BF8A 1YEKH 1G7JB 2CDEA 4TRPH 2CLRA 4RA0C 3HI1A 3SE9H 4ZUSB 1CE1L 1RVFL 5IT2L 3HNTH 5I0ZA 1U58B 4Q9BA 5JLZB 5KVMC 3EDEA 4NC1C 2H3NB 4FHBD 2R1WA 1AD0A 3ARFA 4GMTH 1QEWA 4OGYL 5ELIA 4JDTH 1N5YH 2YXFA 4DVBA 3BD5A 5EOTA 1HNGA 1JI2A 1DVFD 5HDOA 5EIIA 5HDQH 3EGSB 5DJXB 3QI9D 4YIQB 1I9IL 3LZFL 3U7WL 2NY5H 3QJFB 4XPAL 5C0FB 5C6WH 2PW2B 2JJWA 1XZ0A 2YPVH 1TQCB 2H6PA 3CSGA 1A6AB 1M6OA 1MY7A 2QQQA 3KHOA 5HVHC 1WWCA 3I3BA 4QT5A 2W60A 3F7YB 3HHRB 4RFEA 3LMJH 4Y2DD 4MNQD 3ARGD 5CP7A 1ZGLB 4AQ1B 1CGUA 4LPYA 4X7SH 3A6CH 1AHWC 5LQBH 1PZUB 4RGMC 1YEHH 2CSPA 2NY3D 3BXNA 2YUZA 3MLYH 3GHEH 3VG0L 1BZ7A 4LQFH 2AV7B 1GAFH 3RTQA 5CLWA 1TVHA 1FL3A 4Z0XB 1N59B 4PPTA 1PG7W 5IQ7L 3I02A 1QYGH 5IJVB 3UTQB 4LL9A 5HJ3A 3SKJH 3G04B 3T2NH 2EDEA 2GJ6A 3ULSB 4HWEH 2ADFL 2FYYA 5FB8B 4M5YL 1NCUA 3NN8A 3MJ8A 1UWXH 1EVUA 1H3UA 5ENWA 2NX5B 2J1KA 5D2NA 1LNUB 2UZYB 4Y4HC 2Q7NA 3FOMA 3IJHB 5F70A 1TMCB 3LH2L 2DJSA 3LN4A 4WEUD 3V5HA 1UKTA 3KYKH 1AC0A 2Y5TA 2OQJB 3T0EE 4RX4D 2VAJA 3RL2A 4WWKD 4CADB 5HGHB 2CKBA 5C71A 3IFLL 2E7MA 3B9KD 3HCVB 1Z0MA 2R2EA 1LO2L 2HLAA 5DJYA 4MCYA 2W38A 4LGSB 3BUTA 1NFKA 1AY1H 1IMHC 3BRFA 1KLFA 1O7SA 3LHPL 1NAML 4LFHG 5ECJE 5KVFH 3VW3H 3O6FD 4XC1L 4X4ZA 3MNWA 3E6FB 3W9EA 2CMRL 2BFVH 3D69A 2X1QA 2NXZB 4XNZB 1YPZE 2XZZA 2DLEA 1T3FB 1JUFA 3I84A 3OKOB 2OBGA 1YEFH 2YK1L 3VGHA 2DQGL 4JRXD 3KJ4B 3QO0B 1CLCA 4QXUH 3S36H 1KELH 1YPZA 3WD5L 5DUMH 4H88H 2DI8A 2ARJA 4MCZA 3HE6B 4NUJA 1HZHH 5EBLA 3IVKA 5HPMA 3RBSA 5ILTL 4CMHB 1HK6A 1KG0B 4NN5C 3JBG7 2EDDA 2OP4L 4F2MA 2NW3A 2EDXA 3O4LA 4LKXA 4EI5C 3NZ8A 1HQ4A 3HNSH 5IVOA 1OGAB 5F6IC 5JPNB 1I3VA 4V1DB 4RFOH 4FXGB 3UX9B 3SO3B 4GO6B 4HK3J 3MV8B 1ZT1A 2R23B 4KXZH 5DC0A 3IAGC 4JRWA 2Y23A 4P46C 1XGTA 3EDJA 4HS3A 1Z9MA 3ZT5A 1XCTB 3F8UB 3PIQA 4IS6A 1BJ8A 1E4JA 1J1PH 4W68A 3KS0H 3JV0A 3MLXH 5C0NC 3AAZA 2AK4E 4XVSH 5HYSB 3U4BH 5D5ME 5FHAL 3MXWL 2EC8A 4WFGD 3VFUB 2BDNL 3DBXA 4X4YA 1LE9B 2LU7A 5D5MA 3GUTB 1QA9A 1ZLWK 3G5ZA 4MNHA 5T1LD 3VFRA 2VXVH 1GGCL 1T83C 4YFDB 3TO4C 3IDXL 1U3HD 1IM9D 1QO3A 4M1DH 4K7PL 5FYLH 2XZAH 4M1CD 2D03H 2AW2A 3O2WH 2JIXB 4D9LH 2PN5A 4KJPD 2X4UB 4P2QD 1FJ1B 1RZ8A 3D0VA 1MJJA 5F88A 1HXMB 3TJEH 4WVRA 4OZHE 1IL1A 4LSSH 2DQDL 4ZS7L 3QDJD 4K8RH 2GFBA 1FPTL 5CEXA 3KYNB 4OZHA 4OZFA 4F7EA 1Z5LB 2WQ8A 1NBZA 4XBEL 1AKJA 5J3HD 1NQBA 3BP5B 3BO8B 4MDIB 1INEL 1LILA 1CQYA 2YRPA 5DMYA 2PR4H 4GXVL 1QOKA 1JTPA 4KKNA 5B39A 1E28B 3EYFA 4CU6A 2P8LA 2O5YH 4U1HB 3RNKB 2PUQT 1L7IL 5C92A 4R4ND 2V5RA 1UXWA 4GG8A 5HD8C 4M7KL 1HSAA 1JRHL 5DJCA 3OJVC 4NC2B 1S9YA 3LV3A 5HYQB 1JNLH 1P9MC 3WFBL 1P84J 5HHMD 1F90L 2BY3A 1KCRH 2YUXA 2D7QA 4Y1AE 2Z92B 3G5VB 1NL0L 1FE8L 1WJ3A 2JCCF 4NSKA 3I50H 1HH6A 2IALA 1ND0A 5JQHC 1TLKA 4Y1AA 1FFPA 2AEPL 5IP4A 5F1IB 2CLVB 4X0KA 7FABL 3M8OL 4HUUB 1KEGH 4X8XA 2R1YA 1MWAA 1NEZG 3WL9B 4XVTL 1AHWA 3QIBA 4L8CB 3V4UL 5C07E 1GPOL 3M1BB 2DMCA 2X40A 3SDDB 3MRQB 4D94A 4Z7UE 1QRKA 5C07A 1A1MB 1AO7A 5IROC 3UBXI 3NIDE 4XHJD 3PV7A 1YDPB 1NUNB 4CVXA 15C8H 2PXYA 3C9NB 4P5TC 1ZK9A 1IAIL 4WO4C 5IB3A 3IFOB 4LASH 3BSZL 4LP5A 4JFZH 4NFDA 1P2CA 1JK8B 2Q7YA 2P5EE 2RR3A 1N6QL 2WBJA 2MPAL 2QR0B 3MRMA 4NO2B 1G1CA 3AROA 2J88H 3WFHB 1CS6A 2P5EA 2XXCB 3OKEA 4J3WA 4QYOB 4NIKB 2DYPA 4LF3A 3ARBB 3P3YA 3PHOA 4G9DB 3QDAA 1CIDA 4P3DA 3DVFA 4EXPX 2EYTB 1H5BC 1F6LL 1RUKL 4XH2A 4KAQL 4PS4H 4JO2L 4TUOB 4Y88A 4O02L 5D7LE 4TPRH 4RGNC 4OCMC 5E2TH 5C3LD 1CFSB 12E8H 1K8IA 2IG2L 5EZLA 1J1XH 4M7JH 3IETB 5D7LA 2DQUH 4XC3H 4OD3H 4MMZC 5CJ8A 4Y5YA 4RMRA 5T3ZD 1J9CT 1I3GL 5GS0H 5JZ7C 3P40A 5C0IB 3P4OA 1KEMH 1Z0NA 4FQXC 4BQ8A 1PG7H 3IDMA 5EU3A 4OF5A 4J2XA 1BOGB 3ARPA 4X6BA 5DMGC 2EIZB 3HI5H 3NFNA 4OKDA 1QLFA 4QXTB 4L3EB 4Q7DA 4EI5A 5B3JF 3VXMD 4JPKL 5F1NA 3SQOH 1P6FA 1IGCL 3MRNA 4OCRL 1CTOA 1K2DB 1ZKAA 1IGFH 1GC1H 3CCHB 4LMQI 3GMOA 4GRWF 2JELL 5JMRA 4HS8H 5FA3A 1A6WH 2BMKA 2GTWA 3D39B 3MZGB 5CHNB 4P46A 5SWZE 5EZIH 3QG7H 3H9SE 3ALPA 4HHAA 1VADB 3CMGA 4HPOL 4XZUA 4YHIB 1UG9A 3C60D 5SWZA 2CD0A 4JFQB 5LAXA 3WN5A 3LEVL 4D0BB 4UTBL 5EUOB 1JI1A 2BVQA 3DRQA 3DARA 4U6XB 4YDLB 4OCYL 3MGOB 5HDLA 2P7TB 5LGKA 1TTFA 5DJZB 3SDAD 5D70L 5A3IC 3JV4B 4KQ4L 1JPSL 4JZJB 4WRLA 4ZODA 4E42B 4GKSB 4M4PA 4PLJD 1T83A 4Y16C 1R3HA 2HTKC 4A6YH 3GO1L 3BH8B 1T89C 1JWUA 4NDMA 4OFKA 2DQFB 1JJUA 1A3RH 3CFEB 3NBNA 2Y5EA 4L9LB 1URLA 3PHQA 2HFEA 1JNHA 2HVKA 4LPTA 1GZQA 5SWSD 5F7YC 4WI5A 1NUDA 4WU7A 1W0VB 1MRCH 4MQ7B 3IAPA 5K33A 2XFXB 1B0GA 3NGBB 4GW4B 35C8L 1OSPL 1ED3B 4WFFE 3RPIB 4FQIL 4NCC2 1YEDB 3VXRB 5H37H 3FN0H 5ITBL 1QRNE 3L95A 5FYKE 3BISA 3UDWC 3T0DA 1WZ1L 4TUJA 1KCUL 4OZ4B 4KWUA 1I8LC 2F53D 1I8MB 3D87B 4S1DC 4XNUL 5JUEH 1FVEB 3CFJA 3RJQB 2V7NA 3CD4A 3IKKA 4MAYC 4D9RE 5KVGH 1U8NB 3BPOB 3JUYA 1U8KA 2IMNA 1QR1A 3MOBL 4P99A 3DI3B 4U6VL 3SGEI 3SHSA 1VACA 3WFEH 1QFHA 1P9MA 3GSWA 2AJVL 4MQXD 1T5WB 5AYQA 3WUWA 3BKCH 4Q9RH 2LU3A 2FRGP 1P7KA 2WUCH 4JKMA 4HWUA 2V5TA 2QQKH 4FN0A 1SHMA 3O3AB 1RD6A 2VZ3A 4R97B 5LGJB 2XG5A 2PETA 5DD6A 1KF9B 2YRZA 3LB6C 1YYLL 3HS0A 1OT1A 2ADGA 4XP9H 5AZEH 3RVTC 4XMKH 1U91A 1M7DB 1BX2B 3PHSA 4MJ5B 4S10A 2ZUQC 5HVWA 1YNLL 1MCOH 4LRNH 4LIQH 4J7RA 4XMLL 5I66A 4MD4B 4HKZB 4J3UA 5IROA 5H35B 3HZVA 5E8EB 3HAEB 3OGCA 4YHKL 3LKNB 1J8KA 1EUTA 4P5TA 4APQB 1MVUA 3ESVF 4X6DF 3TIDB 3V9FA 2IANB 3PGCA 1EK3A 5HHVH 2X89D 5CEZL 4CU7A 5JOPE 2DLFH 2DN7A 3P77A 1CDGA 4FQ1H 3SDXB 4NKIL 4OZIA 2R2HA 1F2XK 3TO2B 3VI3E 4CL7A 5IVXF 3EOTL 4OCSH 5KSAB 3SGJC 1IT9H 1TFHA 3REVB 4P3WA 5CIPA 4WV1C 3EFFB 2D7TH 3QBTB 2YPKB 5ALCH 5D7KE 4CVZA 3MRJB 4NZRH 3LPFA 1U8HA 4M02A 3C5ZD 1ZT7B 3GJFA 3UROR 3VFWA 4N0FA 3ZYZA 3QDMD 1KFAH 3L3JB 2YUVA 3GSUB 3JWDH 2N4IA 4U49A 4RGNE 1H5BA 3EHBC 4OUUA 3UTOA 2C4FT 2NPLX 4NKMA 3WNPA 3OR6A 4NQEA 5DZNA 3DROA 3H3BC 1A6UL 4PRAA 5DI8A 2BSSB 1NGQL 3QUXC 3PJSB 5J8OA 5DUBB 3MLRH 2ZCLL 4NP4H 2H26B 3QUYD 4F7PB 4WUKH 4Z7NE 5K9OB 2R56H 1LO3L 4FQXA 4ODVH 1AQKL 5IESL 5D71L 2VLME 4ZXBC 5D7SL 1P4LA 3PWJB 5LXGH 4WNQB 5CD5C 1Q9WA 4KMLB 5IB4A 1OTUC 2C4FU 1OAKH 1HYRC 4QY8B 5DLMH 2GIYA 4QWWC 3DV4B 4MMXC 5AWNH 1XH3A 1DLFH 1ZVSA 5F72S 2EICA 3TBVB 2E9JA 2BP3A 2YD3A 5HHNA 2E27L 3X3GH 2H8PA 1H8NA 2A6JB 4JRYD 4OQTA 1CLOL 4X9HA 5EOQL 4HH8A 4OV5A 1TJIH 2CDGB 3VXUB 4G6AD 1N5AA 1XF3B 1XF5B 3RIAF 4MSWA 3W5MA 1DQQA 3HR5B 4QHUA 4QEGA 1VKXB 4YHZH 2ZG1A 5FUCC 1H3VA 3BMVA 4MA3B 3BGMB 3WE6A 3CJJA 4R90L 5FO8B 1KGCE 3NFPB 3WKMH 4OBSA 3IJSA 1A7RH 4BSWA 3NPSB 5CD3B 1HHIA 1MQKL 5IHZB 1T0MA 3HPJB 5GRJL 5C0BB 4HKXA 4KFZC 4N0CD 4IRJB 4Y16A 2X9WA 3QHZL 4R9HA 5C0AE 1JZ2A 4Z95L 1T89A 3FFCE 5TF1H 1DBJH 1WV7T 3IFPA 1JE6A 1NMCB 4P3CL 3PP4H 3WV0A 3R06B 1AJ7L 3WNKA 5IBLD 3HNVH 3CFIC 1MJUH 5IW6B 1YNTB 4X4XA 5CFHA 3AVEA 3FO1A 3LKQB 5HYJA 3ULVL 3GMPB 3P11H 3VXSB 3EO1B 1BJ1H 4GLRI 4EOWL 3O2DA 4NKOA 3EZ8A 1MCSA 4DZ8B 2MCG1 4YLQT 1A4JA 1S5HB 3ARZA 1UZ8A 3UDWA 1Z9LA 2CDEB 5FFLA 3RGVD 3HI1B 1C1EL 1I8LA 5JW4R 5IBUB 5LBSL 1OWRM 5KTEH 4HXAL 5K9QI 3LKPA 3E8UH 4XVSL 4EUPA 3PL6D 3RDTD 2FJGA 4U7SA 4XXCA 4MAYA 1QLEH 2R0LH 2R1WB 1AD0B 3ARFB 1QEWB 2YUWA 4MD0A 2ZSWA 4DVBB 3RU8L 5L9DH 3WYRA 5EOTB 4OLEA 1P4BH 4D3CH 4PBWD 2W07A 4JKPH 1P7QD 1A9BA 3AUVA 3G5XA 1MCJA 2QSCL 5IB1A 4DAGH 5DD1H 1UZ6F 3CXHJ 2G2RB 3NZHL 1XZ0B 4OQ1A 3W9DA 2H6PB 1R3KA 1M6OB 1FGNL 4H0GA 3R1GL 3ARRA 1G7IA 1YEEH 2W60B 4M61A 5JHDA 3T0XA 4RFEB 2W0FB 3MUGB 2OM5A 4I9WD 4KQ3H 5CP7B 5EBMA 3QUKA 5ACLA 1QSFE 2E9IA 1WFNA 3BXNB 3RZCC 5D7IE 3IAQA 1BZ7B 1QNZL 3RTQB 2H2PD 1TVHB 1FL3B 4U6TA 5AYUH 3I02B 5D7IA 1ADQH 3GKZA 4PGDA 3U1SH 5HJ3B 1ZVHA 1IGTA 2GJ6B 2I5YH 4PP2B 1ZANL 2FYYB 4ODHL 3WHE0 3OPZH 1JFQH 4IOSD 3NN8B 1XF4A 3MJ8B 1YJDL 4G7YH 4PJDF 3T1WA 2VZVA 3C08L 3C6LD 3ILQD 3QQ9D 4X5XA 4ZAKC 5ENWB 5KJRL 5D2NB 3SGJA 5I8OL 2WV3A 3FOMB 2ZCKH 3MV9E 3LN4B 4WV1A 1U8MB 3DRTA 2GTZA 4OF6A 4OT1L 3V5HB 4XAWH 2Y5TB 2F74B 1CFVL 3EO9L 3NACL 3ZMRA 1B2WH 3MREA 3PP3H 3RL2B 1XGYH 2CKBB 3T0EB 2NY1C 2R2EB 4RNRA 2NY7H 4LCUB 2HLAB 5DJYB 4GG6F 1XIWC 4MCYB 3NABL 1UM6L 4UINH 1O5DT 4HZLA 1YMHA 5CZVL 5I1LA 1T7XA 3QUXA 2CJUH 2RBLA 3MNWB 1F4YH 1OAQH 3ISWA 3W9EB 4AIOA 1NC4A 3D69B 1ZHNA 4OCLC 4DW2H 1F3DJ 3KLSA 1JUFB 4PJ9D 4PRIE 4XI5C 2OI9C 1TENA 3N50A 3NCYP 3BN9D 4ZXBA 5LGHL 4PJ5A 1YPZB 1MFBL 3LRHA 1IAKA 2AJUH 3EFDH 1RIUL 1WAAE 1G0XA 5EBLB 4WUUA 2P45B 2VITA 3QDGD 3IVKB 5HPMB 2F19H 3AXLA 1WAAA 3MLVH 5T33L 4JO4L 2PTVA 5HDBF 1YECL 4F2MB 2NW3B 3O4LB 1JNJA 2D7NA 3C6SA 2E6QA 4LKXB 1F8TH 2F58H 3U30B 2APXA 3BE1L 3NZ8B 1HQ4B 3HE7D 4X9GA 4HC1H 2GSIA 4HD9A 3H42H 4NHCL 4I77H 3TVMB 4UI2A 1T03L 1A02N 5FUCE 1ZT1B 4H26A 5EZOL 1Q0YL 5DEGA 2DQUL 4M1GL 2ZUTA 3PWNA 4HS3B 3JZ7A 2J8UF 3PIQB 2NY4B 4IS6B 1BFTA 1BVLB 3BAEL 5CWSA 1S78C 2DQHL 1OAXH 4EI6A 1WEJL 4YDKL 1DQML 2VXSL 3IKCB 2EH7L 4X4YB 3DBXB 2DQJL 4XCNA 1HNFA 5D5MB 3LKRA 3MRLA 4R0LC 1FN4A 1QA9B 4CU8A 3WO3B 3G5ZB 3G6JF 1J0KA 3INUL 1AQDB 4MNHB 3G08A 4PJCF 3SQOL 5GS2H 1BVKB 4WEBL 3AS1A 1VDGA 3OXSB 3ZSTA 5DJDA 1QO3B 1BP3B 1O0VA 1G6RA 4XWOC 1FVDA 2VDKL 4XVUD 4GW5A 3RI5K 2OR8A 5FYJU 3FQNB 1RZ8B 3D0VB 1MJJB 2P1YA 3B5TA 1B88A 5DMIL 5F88B 4DKFH 5BJTA 5KANG 2WIIA 5EZIL 4LLDA 5E4EC 1IL1B 2XN9E 5DT1L 4HIJA 3C2AH 5CEXB 3NCJL 4KMTH 5L8LB 4OZHB 4OZFB 4F7EB 1ZHLA 2UZIH 4DN3H 1NBZB 1AKJB 4M62L 4NJ9H 2UYLB 3ZE1E 2YWYA 5SX4I 4LRIC 3QXTA 2YRLA 4KZEL 3H7LA 5B39B 1RZFL 1S7TA 3EYFB 2P8LB 1ZT4A 2BVUA 4BKLB 1P6AB 1KN4L 1UXWB 4GG8B 5HHPB 4BQBA 4ZUVA 5DJCB 4ZUTA 3RRQA 1S9YB 4FFYH 3LV3B 5JORA 5SV3A 1DBBL 1T7WA 5HI3D 3QCTH 4WU5A 3TT1H 1NEUA 5HVHB 1CL7H 4NSKB 2FWOA 4I3RH 4ZNCD 2IALB 1ND0B 4Y1AB 4Q97A 5IB5A 3S88H 1BIIA 3T2PA 1T20A 4X0KB 4WI9A 4MB5A 2VLKE 4Z7WE 2R1YB 1Z9SA 1MWAB 4YFEA 2NX5D 5I76A 1AHWB 3S96A 4RGMB 3G9VA 3X3FH 2VLKA 5ADOH 3RZCA 5TE7L 4LLMA 2FJFA 3ZTJG 2E3VA 2BSTA 1RZ7L 4JHWL 5C07B 4WI3A 4ZYKB 2BK8A 1AO7B 3TF7C 1ORSA 4Z7UB 1EH9A 4CVXB 3K81A 2PXYB 4M7LL 4OF8A 1D6VH 3NPZB 3MCLH 5F9AC 2FEDC 1HH9A 1IM3A 5IB3B 1DCLA 4ZAKA 5A2JH 1EEQA 3KPSA 4Y4HB 5I17A 3VCLA 3FMGH 4K8RC 5DEFA 3ZE0F 3MRMB 4H25A 3WXWH 1IRAY 2P5EB 2NXZD 2PNDA 3OKEB 1J0ZA 2G9HB 4HKBB 2NY0C 2HN7A 1LEGA 2DYPB 2FD6L 2DI9A 1DFBL 4IM8A 4LF3B 4OLVH 8FABA 4JN1H 3PHOB 3HE6D 1XIWA 2VLJE 2KZ1B 3JV6A 4P3DB 5D1XC 1RUQL 4XNYH 4XH2B 2I9TA 2HKHH 3SE3C 4DGVH 4ONHA 3P0YH 2BNUB 1YJDC 2ATKB 1K8IB 3UTSE 4X8JA 2K3TA 5EZLB 4NNYA 1OGAD 5D7LB 1A14H 4UBDD 3UTSA 4V1DD 1I85A 4LLVA 5FHBL 2AI0L 1S3KH 4RWYL 3MV8D 1WCBA 1NFIA 3H7BA 2F54E 3P4OB 2ICES 3S4SA 5J89A 1KJVA 3EJYD 4I13B 3IDMB 5EU3B 2BRQA 4I48A 4R7DB 1TJGL 3MV7E 1MI5D 4FZEL 4X6BB 4NN5B 2EYSA 2V9QA 3NFNB 1QLFB 4UT7H 4EI5B 1YYMH 4MQTB 3KDMB 4HJ0D 5F1NB 5DVKA 3MRNB 5F6IB 4RMTA 1FNEB 1FIGL 4Y4KC 3GMOB 4WGWB 1CICC 5FA3B 5F7HA 4FXLA 2GTWB 4EBQH 3T3MF 2HFFA 1AXSA 1M7XA 4K3EH 3FT2A 4P46B 1CLYH 4JLRA 4HHAB 5C08A 1T2JA 2JIXD 3K8MA 3WSQL 4XZUB 3BP6B 5SWZB 1X4YA 4JO1L 5LAXB 3H9SB 4X6EB 3GIZL 2BVQB 3DRQB 5HHOA 4EDWL 1ZMYA 4G5ZL 1DBMH 1QD0A 4FS0A 3MUY1 2AEQL 5DD5L 4CDHA 4R0LA 3HFMH 3MRFA 1N4XH 4YXKH 1R3HB 3WIHL 4JQIL 4F58L 3S35H 1JWUB 4NDMB 4X4ME 2Z4QA 1ZEAH 3MRPA 3V8CA 2KQNA 4LOUD 1EERB 3PHQB 2HFEB 1JNHB 1DQJA 2HVKB 1GZQB 4X4MA 4ODWA 3GM8A 4WU7B 2EDYA 3TYFA 3QPQC 3WFDH 4TULH 4LCYA 3GJEA 3MYZA 5CBAA 1OCWH 1MHPL 4XPTH 1IC4L 5GS0C 3ELAT 3L95B 4N1HB 4JCLA 1C08A 3L5JA 4UNTA 2RJMA 4TUJB 3P73A 5EU6E 1MLCA 5F7FA 4OFYA 4MGXA 1OAUH 1B6DA 4HT1L 5GS3A 3VWKC 1U3JA 4KK5C 1NBVL 4NOFA 4LRIA 5EU6A 3W0WE 3CFJB 3C8KB 1LDPL 2FX9L 3V7MA 1JPTH 2EIDA 3P9MA 4O9HL 5E99L 1NMAH 4JPVL 3ULVE 2YN5A 2DWEA 3W0WA 3Q3GA 1U8KB 5D7JC 4ZFFA 1QR1B 4OI9A 3SDDD 3RPKA 4PB9H 1VACB 1BF2A 5IQ9A 3GSWB 1QFUH 2DLTA 3WUWB 3MLWH 1P7KB 1MY5A 4NRYA 1JZ6A 5HVGB 2DWDA 4J23A 5GGUA 3GI9H 2BNRA 4O58H 1JYXA 1MFCH 1JGLH 5DD6B 3BQUC 3IRPX 4R26L 3U36A 3HS0B 2ADGB 2Q86B 3TJHC 5B8CC 1U91B 1NDGA 2PYEA 2M2DA 3WIFA 4M6MH 4P4RA 1F4XL 4PY7A 5FYLE 1N7MH 4N90D 5IB2A 4O4YL 1D5IH 1ZWIA 5JW3H 2X5PA 4I4WA 4LLAA 1FO0H 4G9FE 2B1HH 5FGRA 3TGXA 3HZVB 4M03A 2EKSA 1JCKA 1J0HA 3OGCB 4PJEF 4P5TB 3KPLA 4ERSL 3ARUA 4G9FA 1MVUB 4YDIH 3ARBD 1V7ML 5J1AB 3PGCB 3BRGC 4OIIH 1EHXA 3BDYH 5A2IH 4YQXH 3P77B 1U8QA 5BMFH 1BMGA 4OZIB 1RAMA 5HPOA 1I9RH 4KJWC 4JO3L 1U92B 1ITBB 3FONA 1MPAH 4U7KA 4CVZB 4LSRL 4N0UA 1I4FB 1B90A 1U8HB 2FLRT 3GJFB 1IQDA 3VFWB 1I8IB 4N0FB 1BFVL 4MS8D 4U3HA 1AXTH 4PD4K 5KSVA 5D1XA 1AGBB 2P44B 3KPOA 1H5BB 1UCBH 4QGTA 4OUUB 3SE3A 1R24A 4NKMB 3OR6B 4NFBA 4RGNB 1C16A 1FNGA 4L3ED 4XP5L 3DROB 4PRAB 5DI8B 5KVDL 2FZ3A 4M4RA 2XY1A 2GCYA 2VLRE 3KLHC 3O2DL 2F5AH 5GRUL 3RAJH 6FABL 3UP1A 5E5UB 4ZFOA 2VLRA 3D39D 3BPLC 4FQXB 4XCFL 4TOYH 5L7XL 3V2AR 2VR4A 4BZ2H 2FB4H 4DKEH 2JKXA 2WNGA 1Q0XH 3BFOA 2VDPL 3F58L 4MD5A 4KY1H 1AGFA 1MFDH 1P4LB 4FQCH 4WW2F 5GISH 1Q9WB 2Q8BL 4KKCD 3MO1A 3MZTA 3GEWB 5L88H 4BH7B 1MJ7H 5CGTA 4Y4KA 1P53A 5TQ2H 4NQCA 1BFSA 1FZJA 1IFHH 4WWKA 4J4PD 4QTHA 2I07A 1SY6L 5HHNB 2R29L 5KG9A 5FYJD 3RL1A 2H8PB 4D0DA 4JJ5A 4PJXA 3S5LG 3QA3A 2FBJH 3DX7B 4OV5B 1PG7X 4B50A 1N5AB 5K93A 4MSWB 1P69B 4F9LC 4QHUB 5D2LF 3K2UL 3WE6B 3VFPB 4LBEA 4Y4FC 4M6NH 3G5YA 3IJSB 1WIUA 4BSWB 3VXRD 1HHIB 1VSCA 1T0MB 4UIKH 2C3VA 2MNUA 4HKXB 4JRXA 3D18A 4ZS6D 2BY0A 4YXHH 4Y16B 2HAZA 5AG9A 1FZMA 4XPGL 1A7QL 1T66D 3IFPB 1IKFH 2PKDA 4YHML 5FGBC 1V7NH 5E5RB 4KKAC 3VRLE 5C0AB 1YEIL 3FFCB 2AGJH 4HC1L 3BKYH 2FX7L 4X4XB 2CK2A 3AB0C 3DHJA 3FO1B 1SJEA 1U8IA 5HYJB 2J6EL 4TNVF 5C6PB 4JY5H 1T0NA 3OF6D 3NFSH 4NKOB 2YHGA 2JE8A 1A4JB 3PNWB 4F8TA 1UZ8B 3OAUL 2M26A 5FOBA 1RFDH 1S7VA 4ZD3L 5I1KH 3JWOH 2DQEH 3VWKA 3CX5J 3DUUA 5ITFA 2IBGA 5E1AA 3OQ3B 3LKPB 4EUPB 3W2DH 4BFIB 2FJGB 5FV1L 4E9LA 4LPWA 3OBAA 4MAYB 1XGPA 3RVWC 5LJYH 3ET9F 4LSPL 4MD0B 5D7JA 1X6LA 1QBML 2ZSWB 3QWRA 1OPGL 2Q3ZA 2AJSH 3LS5L 2D3VA 2D0GA 1MVFA 2W65A 4W6WB 4K7FA 4G8IA 3X14A 2A9MH 1A9BB 3G5XB 5I6XB 5IB1B 2GAZA 4QRPA 2OXHA 4XP4L 1KJ3H 3DO7A 3HUJF 4D0CA 4APQD 1LEKA 2BC4A 4PB0L 1R3KB 2IAND 5ESQA 1HHKA 5I30H 1ZLUK 2FJHA 1G7IB 3BQUA 4M61B 1G9NH 3RKDC 4TSCH 4GLRH 5JHDB 3WLBA 4B41A 3TIEA 2ZUQB 4DQOH 4I2XE 5EBMB 3QUKB 5KSAD 2ZCHH 4A6YA 2FX8H 3QDJA 2O61A 1MEXL 4JZOA 2CUMA 5FGSA 4DKAA 1LP9F 3CDGA 5JW4N 1CTNA 5D7IB 1UWGL 2VNCA 4BH8A 1LHZA 1IEAA 1P5VA 4TVPL 1T22A 1IGTB 5CJXC 3A67L 5FXCH 1I75A 4ZOCA 4OZGE 1S7WA 4P2OA 4QCIA 4JY4B 4X5XB 5D6DC 1BIHA 3B3IA 5T3XD 1MIMH 1G9ML 3M45A 3H3PH 4MA8H 4PJBE 4XRCA 2VJXA 5DFTA 4WV1B 4OLWL 1NGYA 3DRTB 2GTZB 3B4NA 1G7MA 1S7RA 5F7DB 5TQ0H 4P5MA 5ADOL 1ES0A 3SGKC 4GXUM 4DK6A 3D25A 4JQVC 2QSVA 2FL5A 1E4KC 2JB5L 4L8SC 4RNRB 4Y7MA 4YUEL 1CXKA 4KUCD 5MENA 3G6AA 4Q6IC 4HZLB 1YMHB 4Y5VC 4PUBH 3ZKQD 1RMFL 5I1LB 1G6RL 5IIEA 3QUXB 4QHNA 4ODUA 4YHPA 2I25N 2WUBL 4J8RB 4AK1A 1NC4B 3QP3A 1A64A 2CUIA 2CRYA 2CIIA 3OAZK 1C7TA 3GKWL 1UFUA 3CDFA 4ZXBB 3VXUD 4PJ5B 3ZDZF 1QVOB 3GBNL 4PRIB 1BJMA 4DEPC 2C1OA 5BS0E 2FHCA 4QHKJ 3WEXA 2C9AA 4WUUB 4HWBL 2EXYC 2XYCA 4JPWL 3AXLB 3U82B 4RMVA 1CR9H 3MPCA 4G8FA 5FA4A 2ENYA 3R4DA 2A9NL 1WBXA 4U2ZA 3RWDA 5HYEA 5C0BD 4U4BA 2GSIB 3ZTNL 4IRJD 1EBAA 4PGBB 4RZCB 5I0DA 1EXUA 3V7AG 1XR8A 4PJHE 4ENEC 1UACL 3FQTA 3NA9L 5C9JA 3QAZC 5DEGB 4F9LA 5I2IA 3M07A 1HDMA 3D48R 3PWNB 3LQAH 3LEXA 4K55A 4LLYB 3EAKA 4ZFGL 5C0RL 4PRDA 1SM3H 3VXSD 1FGVL 2FLBT 4MJ4A 2V2TA 3EOYG 4Y4FA 4FTVA 5CWSB 4TNWK 1J5OL 4EI6B 1INQA 5FKPA 1OF2A 3PQYE 1JF6A 3KR3H 5A16A 1JPFA 4XCNB 3F7VA 2DL2A 3MRLB 5GGSY 5FGBA 1FN4B 5AZ2L 5E7FA 3HA0A 2DKUA 5BW7C 2FDBP 1T80A 4HK0A 5DJDB 1CBVH 3S37L 3ARFD 5DQDH 5CAYB 3CK0L 5TE6L 3MNVA 5E6ZA 4LCIL 4H8WH 1FVDB 3KJ6L 1KN2L 4GW5B 1TJHL 3TN0C 2PCPA 4K3DL 3PV6A 3GIVA 2HJLA 2YKLH 2WIIB 3MFGB 5F7WC 4OJFL 4QTIH 4GRWE 3RJDA 3TWCH 3MACL 3FCTA 1A7NH 2NTSP 2V5YA 3U0WH 5T1DL 1ZHLB 1E4XI 2XN9B 3DGGA 3TPUA 2DIAA 2ZPKL 4X9FA 2WZPD 5E2UH 3E1F1 4HG4K 3HZMA 2COQA 1OLZA 3BW9A 1S7TB 5IVNA 1J8HE 1ZT4B 4CRPA 3PWUA 2IAMC 2LU4A 4ZUVB 3QNYA 3RTQD 4ZUTB 2DKMA 2H2SC 1T2QH 5JORB 3EDFA 2A0LC 3LS4H 3BZDA 4OGXL 3SJVE 5DHVH 3TYGL 3QEUA 5F7MC 2Z8RA 2GJ6D 1Q9OA 3WS6C 2R69H 2FWOB 4PGJA 1AGCA 2P42B 3CSBA 5IB5B 2E9WA 3CVHL 1GOGA 3SJVA 4EQ3A 1BIIB 1R5VA 3DMMC 5J9PA 1T20B 1JWSA 4FZ8L 1GIGL 1HKFA 2EH8H 5I76B 3S96B 4U6HA 4U3CA 2Y6SC 2VLKB 4NO0A 4NBXB 5H2BA 4S0TD 3RZCB 4LLMB 2FJFB 4M43H 5B4MC 2BSTB 4PJ7E 4GOSA 4MA7H 5GZOC 4WEMB 5CJXA 5A1AA 4NWTH 4PJ7A 1OVZA 5KSBE 4I0CC 1EZVX 4ORZC 3O41A 3T0ED 4KKBC 1HH9B 3U48A 1IM3B 1EGJA 1L7TH 1RIVL 5KSBA 4ZAKB 1BECA 5J0BA 3KPSB 2EDNA 2GITA 1C5DA 2DQCL 3E6HA 1CGVA 3QHTC 5E8OA 2YD7A 3VCLB 1PYWA 1DBAH 5DEFB 3O9WC 2NR6C 4H25B 2W9EH 4YWGL 2VQ1A 1HINL 2IPTL 3SGKA 3FOLA 1U93A 2BHUA 3HB3C 3U0PA 4PJGE 1A6VL 4JQVA 2HN7B 1LEGB 1E4KA 4L8SA 4JM4H 2NY1B 1OP3H 2ERJB 4PJGA 4OTXL 5J7CC 4AEIH 1XIWB 2D9QB 4Y89A 4Q6IA 4Y5VA 2I9TB 1CG9A 3DUSA 4OD2A 1OOAA 4QGYA 4ONHB 3VMPA 4TSBL 2O5XH 1T4KA 3O4LD 3O3BA 1ONQA 4X8JB 5IMKA 2WWKO 3CDYA 4NNYB 2QLVB 1CK0L 2CDFB 2Y36L 2APFA 5ESAA 3UTSB 2OI9B 4LLVB 1H3PL 3TVMD 3CUPA 3JTTA 4HF5H 4O5LH 1WCBB 1NFIB 3H7BB 4KVCL 5EORH 1CU4L 3VXQA 4KDWA 2XQYG 2NW2A 3ULUD 3KWWA 4I48B 2WIMA 4PV9B 2R8SH 5LWYL 2F54B 3CC5A 5IVXE 3RA7H 2NY4D 1ADQA 4G43A 5FO7A 1CDJA 5CZXD 4XBGA 1TITA 4GMSL 4LGRB 3VA2C 1NEZA 5C0CE 4GH7B 2B1AL 4DGIL 4OFPA 6CGTA 3V0WL 3MA7B 4GQPH 4EIZC 4R96A 4UQ2A 1WWBX 3PGFH 1FDLH 1V3LA 4RBPK 3ZL4L 4XVJL 3AGVA 5DD3L 1AXSB 4RMUA 5C70A 3FT2B 2F5BL 2X4RA 4PREB 4NJAL 3NH7H 2QJDA 4JLRB 4JCMA 4HUMB 5C08B 2NLJA 3RVUD 5T5NG 3UPRA 2EDWA 1G1YA 1KACB 1KJ2H 2V5MA 3VXTA 1QSEE 5HHOB 1RU9L 5EU5A 4CKVX 4UAOC 3KPPA 1HN1A 3BHBA 4H20L 1A6PA 4AL8H 4LDLB 4R0LB 1EHLH 3LQZA 3CU7A 3MRFB 1E6OL 3LEYL 3MRDA 5BW7A 1AKJD 2EDQA 1T2XA 3MRPB 2A1WH 4P4KC 3SE4C 3HG1E 5BVJB 2JF1A 4ODWB 1OB1A 1A3QA 2KL6A 5GZND 4JB9L 4QRRE 3TN0A 3TYFB 3VXOA 2ICWJ 3OB0H 2RCSH 3NTCH 4LCYB 3GJEB 1D3CA 5CBAB 2XKSA 5E4EB 1CFQA 4HPYL 1CF8L 3X17A 1BZ9A 4K94H 3OMZA 3KPRE 2MCPL 1C08B 4QOKE 1GGBL 4NZJA 3P73B 1MLCB 3KLAA 1UA6L 5B21A 3KPRA 4OKVA 4Y1AD 3LN9A 1T1ZA 5EU6B 1RHHA 4OFVA 4Y19E 3P9MB 4GSDL 2K9UA 2UUDK 5DA0B 5CS7A 3QZWA 2DWEB 3W0WB 3QHFL 3Q3GB 4ZFFB 2IAMA 3MYJA 2DQIH 1KXVC 4R4FH 3UJIH 1H0DA 1I7RA 4KHTL 4WCYH 5IQ9B 5C07D 2FEEL 4YDJB 1AO7D 4M3KB 2R9HD 4PLKC 1A7PH 3SKUD 4XCYA 2HA1A 1KV3A 3F7RA 1D7FA 4X99A 5K9KA 2DWDB 1NAKH 1F3RB 2ZSVA 3QFJE 4KI5D 2EE3A 3DMMA 4WENB 5GGUB 2Q3AA 3FRPA 1UVQA 4BZ1H 1DBKH 3V4VH 1C7SA 5GGTH 2APTA 3QFJA 4G6ML 5EOCH 3U36B 4Y4HD 3QIUC 4G6JH 4M48L 4JFOB 1HSBA 1QFWL 4PJAF 2PYEB 3WIFB 3MJ9L 1CDCA 2OR9H 3MRGA 1REIA 4P4RB 3VRJA 1OAYH 3QWQB 5IB2B 2ZG2A 2YR3A 1ZWIB 3SY0A 1H3TA 4OLXH 2P5ED 3MRIA 4P9MH 5HGBB 4Z7QF 2FGZA 2DYPD 3KPLB 4LCCC 4G9FB 4MWFA 2B4CH 3STBA 5HGGS 4OIBA 1OGTA 3FQXB 4ELMF 1U8QB 1BOYA 3WXVH 5D8JH 2D9CA 5E9DE 4HXBL 4ZTOH 5INCA 3U4EA 2YMXH 1KCSH 2VKWA 3FONB 2IFFL 4C55A 5I73C 3CZFA 3V6BR 5D7LD 4G6KL 1OSZA 1H8SA 2NY0B 3UYRL 4Q74A 1X44A 3IXAA 1B4JH 4MXVE 4N0UB 3DX6B 2FGWL 2BOBA 4JFXA 1IQDB 3QQ4A 3SKOA 3WNMA 4S1QH 1G6VK 5D1XB 5BCAA 3KPOB 5F3BA 1EEZA 4IRZL 3I6GA 1R24B 3OKNA 2P5WE 1X4XA 1D5XA 4ODTL 1C16B 4S2SA 1FNGB 4XAKE 4EI5D 1MFAL 5F6HI 2WW8A 1I7UA 4UV7H 2P5WA 4UDTA 4CJ1A 3IGAA 3O6MH 2FZ3B 1WT5C 2VYRE 4JHAH 4XNXH 4QXWA 2GCYB 2WWMC 4DZBB 2B5IC 2ORBL 4ZFOB 4Y5XC 5ISZE 2VLRB 3DYPA 4BSJA 4NZDA 3KNBA 2QADC 2JJVA 4ZPTA 1CGSL 1PW3A 3GJFK 4P46D 5ISZA 4MD5B 3UEZA 2AKRA 1AGFB 4N1EA 3FQUA 2VDNL 5I19H 3MO1B 4JFEE 5SWZD 1NLDH 4DK3A 2W0PA 3DHMA 1CFNA 2DLGA 3H9SD 3P30L 2DQTH 3O6KL 2HH0L 4Y4KB 4MB3A 1CICB 4NQCB 1FZJB 5EC1A 5DQJB 4QTHB 5JO5A 4LSTL 5CKAA 1DL7L 5KG9B 3RL1B 5D1QC 4D0DB 3STLA 1DQDH 4JJ5B 4PJXB 3QA3B 2D4FA 1T04A 1U6AH