1IGML

Three dimensional structure of an fv from a human igm immunoglobulin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
115
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCQASQDISNYLAWYQQKPGKAPELRIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYQNLPLTFGPGTKVDIKRTVAAPSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of an Fv from a human IgM immunoglobulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
molecule keywords IGM-KAPPA POT FV (LIGHT CHAIN)
total genus 21
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 1992-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igmL00
3PWVA 4F9LC 5C86A 1P53A 1QFOA 5IQ9A 4H25B 4GW4B 3AGVA 3NN8A 5GRJL 2ZUUA 3W81A 3T2OA 4HK0A 1KT2A 1NCCL 2JJSA 3EFDH 2PO6D 4DWHA 2R56H 3JSSA 5CILL 5IV2B 3VXNB 2GSGB 1IAKA 2WUCL 4A6YL 2Y9RT 2X5PA 1A7OH 1V3JA 3NA9L 3V6ZA 3VRLE 2SEBB 4YO0A 5FOJA 3MOAL 4LF3A 5JHDE 4HUUA 1S9VB 2VLRA 1JYVA 3SY0B 3NCEB 4QRSA 2BMKA 1I3RB 1OAXH 4RX4D 5D7IE 1W72B 4EI5C 5IMLA 3TF7C 4WFGE 3CPLA 3PDOB 4NKIH 3NACH 4N5UA 1JGLL 2Z35B 1NLBH 4E41D 4G9FD 3EFFB 3BAEH 4NQUA 4OLEA 5DQJA 3QIBD 5FFLA 4JR9L 3BYTA 4S11A 2DQTL 3S36H 2BX5A 3VG0H 4Q9RH 3I9GL 3IDXL 4RMUA 3NCBB 4G42A 2V9QA 5IJVB 1A47A 4TUJA 3VWJC 4IIQA 3QDGD 4JGMA 3T77B 4LQFL 4RAVA 4Y5VB 4MLSA 4UOW0 4YDIL 2W91A 5DJYA 3LKSA 3OF6A 1GRWA 1KLFA 4K23H 1KELH 5CGYD 1P4LA 4POUB 1RFDL 4KPHH 4K9EL 3GRWH 3RWCA 4NZUH 3LKQA 5SWZE 1ZGLM 4GMTH 4K8RH 4G6AD 2VXSH 3UJIH 3I75A 4EXKA 3UPCA 4XC1H 4NN7B 5HHQB 3NCYS 4Y2DC 5L2JA 5ALBL 1FFRA 3ULSB 1NUNB 1Z9LA 3U36B 5KSBE 4PJXB 2JCCA 5E8OB 5C07E 3KPRE 1S7UB 4WUUA 2LE9A 3MLRH 5ACMA 5CZKA 1GXEA 3P0VH 1QRKA 3KPNB 4OLYH 2JIXD 4JO3L 4YHOL 4XX1E 3TV3L 2JB5L 4OQTL 1Z9SA 5DRWA 4HEME 1IAIL 1I3GH 1J1PL 2AJSH 2UY7A 8CGTA 4PJDA 3FT2A 2GFBB 3RBSA 2JIXA 4MJ5B 2CKBB 1FSKB 3FMGL 4AK1A 3LOWA 5ANMA 4Z7WB 2AK1L 1NGZA 1A7NH 1ONQB 2PW2A 3SE8H 1J0ZA 2NX5D 4QF1A 2N7BA 1A1NB 1U8HA 2CDFA 2YPKB 1P69B 2FX8L 2CUMA 3HE6B 4JVPA 4NRYB 3FOLA 1U8HB 1CD8A 2CDFB 3S4SG 5EG6C 2YC1A 5GQBA 3T04D 1MI5B 1RU9L 4P5MA 3MRQB 2P43B 4OZGF 5INDB 5FCSH 5DQDH 3WN5C 1A9EB 3HMXL 3GGWA 4Y89A 4U1GB 4P5TB 3WIFB 4MZ2A 5DUMH 1T5WB 4BFIB 1IFHL 2P24A 3CJJA 4P23D 5DRWB 3H9YA 2NXYD 4LLAA 4UOJA 4MCYA 3TP4A 1HH9A 4WGWB 1PEWA 2CRYA 2RQ8A 3KDMA 4PGBA 3I02A 1A6VH 1CYGA 4PTUA 3WE6B 2FIKB 3MRNA 3IJHA 1ZV5A 1FO0B 5KVDL 3QPXH 2IAMA 1ETZA 1KPRA 4BFIA 4JHBA 2A6JA 2W0KA 3F7RA 4Y1AE 5H35A 3MV8D 2CR6A 4FQXA 3VG9C 1A9EA 3WXVH 4U6VH 5DHXB 3CMOH 5EWIL 3MYZA 5D71H 2Y25A 1V05A 3HAEH 4NC0B 1MCOH 3FT3B 4XVJH 5SX4I 1CICD 3ILPB 4NQDA 3MZGB 3C5ZB 4G8EB 1D3CA 3EHBD 2H32A 4F58L 4QO1A 1MPAH 3WHXB 12E8H 3HI1B 3CFKB 1X5FA 1DUZA 2OZ4H 2EEDA 1LWRA 1P6FA 3L5JA 3NZ8B 2XWBB 3QUMA 5BZWA 2HAZA 2H1PH 2VE6B 3OXSA 5MHSE 1G9NL 1AQKL 1P7QA 3ESVF 2E9WA 3A6CL 1QSEB 1KV3A 1PZ5B 4X8XA 4JVUA 5EUOF 2EDLA 1JV5B 4KRPD 2JB5H 4OQTH 4WDIA 3KLAA 4CN4A 4S10A 1QOKA 3FB8A 4KXZH 4YQXL 2A1WH 1O5DT 3S7GA 1FNFA 3MCLH 2ESVE 3HG1B 3LSOB 4LCIH 3BD5A 2R9HC 5D70H 4C59B 2Z4QA 1BFOA 1JYWA 1I8KA 4H1LG 3I9GH 3IDXH 4WW1B 3RWHB 5J9PB 2KBGA 1KN4H 4K9EH 3HE7A 2P24B 3TO2B 2Y06H 1MREH 1ZANL 1IAKB 3B9VA 3DVIA 5IB3A 2ZOLA 1LE5A 1CR9H 1GSMA 1VEOA 3EJZC 4U1GC 3FHQA 4W4OC 1N5AB 5K33A 1QKZL 5I1GH 4PRIA 2XG5A 3IAQA 3FB8B 1RUAH 2E7LC 4OLZH 1Q9OA 2MWCA 1Z3GH 3SQOL 5KS9B 2J8UE 3O9WA 1EAPA 3H3BC 1ZA3A 4Z7VB 4TUJB 2AXJA 1QHOA 1H3XA 3I50L 4JJ5A 1XF5A 4QHUA 5GIRA 1W0YT 4U1SB 5ISZE 5ANMB 4B53A 4DKDC 2D7TH 2PO6B 4WENB 3L5IA 4NT6A 1KCRH 3HPLA 5E99L 3VFGL 2Z31B 3PQYE 4Y5YC 3QZWA 3W0WD 2K3TA 3V6FA 1IAOA 3ME0A 2BCKA 1VCAA 5HYEA 3TBTB 3RVUD 4AQOA 1YQVH 3NIDE 2RR3A 3FQWA 4U6YB 1Y6MR 3RWGA 2BJML 1G0DA 2C4XA 1WAAE 2NX5B 4QXUH 1G6VK 1I1CA 1M7XA 2D9QB 3KPMA 3O4OC 3U36A 1T2QH 25C8L 4R90L 5DZNA 4YXKL 4LMQI 4O58L 2LTQC 1CE1L 3DX6B 4APQC 5T1LD 5IR1A 2YPLD 1VEPA 1MPAL 5DDHB 5E8EB 3BQUD 1VB9A 1Y18B 5H2BA 3QUKB 1D5ZB 4D8PA 1BBDL 4GW4A 4WI7A 1FL3B 3OKNA 4NO5B 3NFSL 3DXAE 3VXSD 1A7RH 4P99A 3EUUA 1R5VA 5L88H 4MA3B 1DQQA 4JDTH 4PJGE 3BH9A 4M1GH 2VDRL 4FQPA 4I5BA 1UFUA 1T21A 4PFEA 4OGAD 3KYMA 1MFCH 2BVEA 1ZVHA 3MNVB 3UYRL 1IC4L 4TVPH 3MGOA 1IQWH 3TWCH 4RGMC 2X4SB 2AV7A 2DQDH 2HG5A 2J88H 4MD5B 1UA6L 5T5NG 4LCCA 5BW7C 1H3PL 2YA0A 4K8RD 5D5MA 2E7LA 5D70L 2VO5A 4TPRH 5D7LD 3KLAB 4KHXL 2BNQE 3P77B 1DQJA 4MJ6B 3T0BA 1DTUA 3TBSA 3VFSB 4GKZA 2JJSC 2ZZUT 3P9WB 1P7QB 3BPLC 2D4FA 2FBJH 5I8CA 3PWJB 3MCG1 1A9BB 3VFPA 4PV8B 1UCBH 5F9DC 4F37K 4U6VL 2FX7L 5HJ3B 4MA7H 5A40E 2EDDA 5CJ5A 3LQAL 1QRNA 3IDIA 4XAWL 3V6ZB 4RMWA 2OZ4L 2VZSA 3RZWA 2AI0L 3DURB 3EDFA 1QA9A 1WBZB 1AQKH 3G6AB 5C0AB 3R1GL 3F7PC 2IADA 3TLRA 5IHBA 4OV5A 4XMKH 4FG6C 3UTTE 1P1ZB 5FIEA 4HUMB 2VAAA 3PWPA 1R6VA 1FGNL 3BPLB 4N8PA 4U33A 4UV7L 3T0EC 4OF3A 1DBBH 4IOFD 2OTPA 1DN0B 4Z6AT 1FV1B 1Q9KA 3IDMB 1CD0A 3BE1L 5JDSA 1SJHB 1CGTA 1K6QH 2R1XA 2AGJL 3KPRD 5E2TL 1G7LB 2V7HB 1PVHA 1AO7D 4MNQB 2NY0C 5A2IH 3O8XD 5F89A 5IMKA 4DTGH 2E8ZA 5D1XC 4BK5A 1JZ6A 2NXYB 3FB6A 1CGXA 3NABL 2ZKHL 3T4YA 5KVDH 5HGAA 1NAML 4PJFF 5CSGA 1AXTL 2CDGA 4X5XB 1ORQB 1Z6JT 3U0WH 3QP3A 4K94L 3QUXC 3TVMA 5L2KE 4MNGB 5DYOB 5L0QB 1RUPH 1P7KB 3BPNB 4HFUH 3MV8B 3ZL4H 1I8MA 4L4TD 1I8IB 1FYTA 2D7TL 1DUYB 4ZUWB 4Y8AA 1A6TB 4P9HH 1OP5K 4R0LB 1BD2E 3FT4B 2EIDA 2R39A 3OKDB 2CKNA 3MV9A 3OKLB 5FA4A 5DJ0B 2AK4D 2RJMA 1MCIA 1H5BC 1K85A 2VITA 1DANU 5I8EA 1YN6B 3E6FB 4H1LH 3E1F1 4B5EA 1UG9A 1EHNA 3L5XH 1S8DA 4KMTL 3SQBA 5DTFB 2MHAB 1G7IB 1F4HA 3FO0H 4R97B 2DJUA 1KEMH 4IRJA 3RL2B 2FJFA 1V3LA 4WTWA 4YFLI 3BOVA 2DQGL 4PB0L 4QT5A 2DLHA 1YEFH 2IJ0C 2JJVA 4TQEL 2YPLB 3EDDA 3D1MC 5I66A 1A3RL 1N59A 3AVEA 5FOBA 3GSRA 3C87A 5EB9A 1JHKH 5B39B 3UTSA 3QWOB 4NJ9L 4HS8L 4M6MH 2GAZA 1FVCB 3QFJB 2C1OB 1U2HA 3SJVE 5IT2H 4NO3A 2EEBA 2HFGH 5JNYB 4LCCC 5IW1A 3SCMA 1ZT7A 2NY1D 5DJAB 2E9IA 4ZXBB 5T3ZE 1FNAA 3VXUE 3D0LA 1OTTD 1IRAY 4GOSA 3N06B 1CE6B 2F5BH 1J1OL 1L7IL 1JRHH 1KB5L 4KK9D 4UU9A 3CZFA 4I0PC 4JVWA 4RGND 5IFAL 2X1QA 5BRZD 3ZDZF 1SYVA 3ARZA 4JHWL 4N68A 2ZCLH 3P30H 2NW2A 3WNKA 1INEL 1QSFA 3QFJA 4ZD3H 3UBXI 3IAGC 1YEFL 4K94C 4DJMA 1ZS8B 1UKQA 1JNLH 1GVIA 1RZ8B 4DKFL 2Y6SD 1MCEA 2C3GA 4GG6F 1AQDB 3QCUL 5C70A 4LP5A 5K9KA 4OLVH 1A4KA 4MZ3A 2WZPD 3TBYA 1XGTA 4LF3B 1J0JA 5I1IL 1X7QB 5E6IB 2R4SL 2NY0D 5IKCB 3DVFA 1U8MA 2VN4A 1NGQL 3D3VE 4D0CA 2R8SH 3B6SB 3KHQA 15C8L 1RY7B 3ARYA 4P2QA 1GGUA 1JPTH 1UC6A 1CF8H 1NGXA 3HI5H 1IM9B 5IVOA 3JVGA 2Q87A 2I60H 3FQXB 3QDGA 3O4LE 4HWZA 5SWSD 3B8SA 3REWA 3O2DL 1KCVL 4PUBL 4Q9QH 1QRNE 2IGFL 2CK0H 3UXFA 1DQLL 5KSVA 5HI4C 3V2AR 5EOTB 1ORQA 4Z95L 5CEXB 1WEJH 3QNXA 4TRPH 1K3IA 3CDFA 3CXDL 4MNQD 5D6CB 3T4YB 3M07A 1OHQA 4F3FA 1KN2H 1G84A 1MCPH 3RPKA 2GW5A 5ISZD 3N50A 4Z18A 5FUZL 3RDTD 2XRAH 3DV6B 2UYLB 3HB3C 1OP5H 4XMPH 4Z77A 3O81A 2PTTA 2YK1H 4JO4L 4G5ZL 5EIIB 4AEFA 3OGOE 1G7IA 4KHTH 1RIHL 5ESVB 4G3YH 2UZIH 1KTLB 4ENED 3SGKA 1JHTA 5D93B 2R2EA 3E6FA 1BLNA 3NFNA 1DBJL 1NJ9B 1NMCC 1DN0A 4I3RH 4WFFE 4IOIA 4MD0A 1FAKT 2HJFA 4DZBB 3FB7A 5LAXA 1NDGA 3LKPB 4IEFB 2R1WB 1KC5H 2A74B 3N0PB 3FL7A 1IGIL 2BC4A 1FL3A 4OBRA 4IRSB 32C2B 3G6DL 4JFFE 5FYKE 2CKBH 3DVGA 5J56B 4QYOB 4OUUB 1MWAL 4KVNH 5E4IA 1U93B 2BNRA 4AH2B 4FQIL 3B3IA 2H2PD 3KYKL 1KIQA 1WAAA 1KG0A 5L2KA 1KCSL 1IMHC 1NANI 4MD4B 4WV1A 1JWUB 3ZDZE 2DQUH 2FEEL 4JDTL 4DCQA 5KG9A 4OZ4B 3NBNA 2DWDA 4WU5B 2R69H 4EUPA 2ADJA 1AD0B 2P42B 5KTEL 4LRNH 2J7LA 1JNJA 2FH8A 5L6YL 1HWGB 3O2WL 1RVFH 5DHYA 5KSAB 1RMFH 1R3LB 1VACB 2QADD 3OJDB 2N7AA 2BNUB 1BP3B 1U3HC 1HSAA 4LOUC 1AKJA 2FB4L 3VXSA 4F7MB 1RZKH 2DD8H 1I1AB 4Z5RA 2NX5E 4FP8L 1JZ5A 3AS0A 5I71C 4JO2H 4F7TB 1MELA 1FC1A 2VMFA 4OM0L 3O3DA 4KI5E 4PY7A 4XWOC 5C8JA 4YDJA 4U0QB 2NXZD 5GGRY 1EUUA 2AV1B 3KPQA 4U2YA 1T7ZA 4IHOB 4Z7UB 4L3EE 1CBVH 5IR1B 1FNSL 2BNUA 1ADQH 5CJXA 1R3LA 1VACA 4TSBH 2F54B 4Z78A 1FJ1A 2A9ML 3UJTH 3TEUA 1CGVA 1KB5A 2E9BA 3JVGC 4OZHE 1A7PL 3PWJA 1S7QA 2ZWLT 1MFBH 5E6ID 4GRWB 1OW0C 3NACL 5CKGA 5A16A 3B2UD 4MA1C 5EORL 1WZLA 2EXWC 1XR9B 2M8XA 4NM8L 4XRCA 2DD8L 3JWNC 3ARED 3DRTB 1IM9D 4Y16B 2VDLH 4IRZH 5LVEA 1KG0B 4MD5A 1ORSA 5DT1H 3ZE0F 1SEBA 4GRLC 3A67H 5ENWB 2PXYA 2OTWA 2QADC 4G80B 1ZVYA 4KROD 2QV2A 2QKIA 1XCQA 2XQYG 5IHLB 3KYMB 4FTVD 3ULVC 3KYOA 1FFNA 3KYAA 3G9VA 3BPNC 1S78D 3QDJE 7FABH 5C3LD 1A5FH 1KXVC 1FNSH 1B6UA 4OLZL 5C0CE 4RDQG 1KTKE 2B5IB 5E8NB 1WUNT 3QFJD 3WLBA 1G7MA 4P3CH 1CZ8L 3INUH 4YPGB 5D1XA 1KJVB 1RIVL 4JPVL 1EVTC 4PG2A 3B5TA 4WI2A 1CGWA 2YKLH 3GMLB 2HJKA 4M4RA 2YPVL 3IDGB 4V2BA 4Z5RB 1J8KA 3RWHA 2XXMB 1TVBB 4TN9A 4G6KH 5JW3L 1PY9A 1NLDH 1JP5A 3U82B 3N1GC 2ATKB 1NMBH 1KEGH 3EO0A 5BRZB 4GQPH 3RWEA 5HGGS 3SN6N 1BREA 2EZ0C 4NKQB 2OQJB 5I71B 2Z8VC 4NO2A 2FGWH 3RIAF 3V5DA 5EWIH 1HI6A 1I1AC 1AH1A 4E42B 3BZFA 2LU4A 4XTRC 4J12A 1NEZG 2CSPA 5DEZA 3PUCA 3MNWB 3QIWD 1JWMB 4LPTA 3O41B 1JF6A 4F33B 4J6RL 4OF8A 4D2NA 2EE6A 2GHWB 3P4LA 5ISZA 1BPVA 4GS7B 1AR1C 1ZT4B 5D96B 2UWEA 4Y4KA 4PY8I 1IGTA 3TO4A 3CSYA 3DV4B 5DD3H 1CFSB 3PNWB 3MODH 3VXUD 4G6ML 3E2HB 2X4PA 1EDQA 4MNGE 4OLUL 5IMOB 1JWMA 4YWGL 1WIPA 5EC1B 4AMKH 3S88H 1Q94B 1I85A 4MJ5A 1X5HA 5SWSB 3O4OB 2O5XL 1HI6B 1GOGA 2ZSWB 4PJHF 2XN9A 3HZYB 1QFPA 3QI9B 2GCYB 4Y16C 4MVBC 4WJ5B 4WEUD 1M05B 5CLTA 4PGEA 3ULVL 5KSAD 1CGYA 2NQCA 1P9MC 1Z2KA 1RMFL 4P46C 2F53D 2VAJA 1BOYA 3ETBF 3K46A 5ITBH 3SDXB 1LEIA 2HVJB 2OI9C 2EDOA 4R4FL 2BVOB 3RKDD 5EZJB 1NKRA 2WLZA 1BVLB 3BGFB 1AI1L 1AO7E 4JCMA 3FMGH 1DVFC 1DLHB 5J4MA 2DWEA 1A7NL 2CLRB 3H0TA 2H8PB 5I15H 4DOHB 3EDKA 2EICA 2ZSWA 3QO1B 2X44D 4U6XB 3PJSA 4GXVL 1P2CB 2GKIA 1EEUA 5JXED 4XPTL 5INDA 2ZNWA 2O61B 4NO0A 4LCWB 1HYSD 1OGAE 2OR9L 2YC1B 1MLBA 2ICEA 1T1YB 2EC8A 5DJZB 5T1MB 2J8UB 5IB2A 5B4MC 1SQ2N 5GGTL 1XCQB 3ILPA 4NQDB 3VCLB 3O11B 1BEYH 3MBEB 1CICB 3RGHA 3C5ZD 3TYGH 3BE1H 2GFBA 4Z0XA 4HSQA 3KPLA 2CKBA 5DQDL 4P46D 4K7PY 5FYLE 1UXSB 3QT2A 1FG9C 4LLYB 5KSUA 4LLWA 3QXUA 3QEUB 1YMMB 2COQA 4ZUSA 4L5FH 4NZJA 1U8PB 1EZVY 2WSKA 5EU3A 2XACC 4KK8D 2ZSVA 1RD6A 4I1NB 5E08H 4RRPG 2VJXA 3MLZL 3OKEB 2YK1L 1T1XA 3BP4A 5D2NB 4P48A 4HKZB 2IALA 3RVUC 4YFDB 2H3NB 4O2EA 1TPXB 3U0PA 1VGKB 2DQIH 3D25A 1C5DB 4GRMA 4UDUB 4TNVK 3RJQB 4QXGH 1MFEH 3KWWA 4WW2F 3SDAA 3L3GA 3GRWA 1CVSC 1GGYA 3GMQB 3BMVA 1J8HA 3VGDA 2IH1A 4BQ9A 5JOPD 1ZHKA 4KFZC 4U1NA 3S96B 5C08A 1CDYA 3G6AA 1K8IB 4XNZB 2GUOB 3UP1A 2R0WL 4XP9L 5IVNA 1I1AD 4O4YH 3BO8B 4C55A 1RFDH 5I16B 1I7TB 1UJ3C 2PF6A 5JZ7C 1XGPA 1U92B 4LAJH 3X13A 1FVDB 1BJ1H 1I85C 3OJVC 3QPQC 1ONQA 2PW2B 4BSVB 3TIEA 2YPVH 3H42H 3CDYA 2WAHA 1YYML 1KIPB 3FCTA 5ANME 4NBZB 4YHMH 5IVXE 2JB6B 3V5KA 1CXLA 1A3RH 1QR4A 1J11A 2HN7A 1Q72H 4HUUB 3IU4L 3P0VL 4P59L 1JJUA 2C4FU 2XKNB 3T2NL 4WWKD 2YD7A 3KPSA 1EUTA 1N8ZA 4HJ0C 4PJXA 5T5NF 4OGXL 2N4IA 3KPRA 1U93A 2BNRB 2FH6A 1QFUH 2VLJB 2X42A 4XPHL 3OKLA 5KJRH 3PGCA 1RZJH 1NBYB 5F1NB 3CDGB 2VZ3A 1NCCH 3EFDL 5HGDA 1WBZA 3WXWL 3ULVD 3C6LD 5B38A 3OB0K 2A9NH 2XKUA 1OOAA 3QI9D 1P7HL 5DEGB 4C57C 3SGDI 2IBZY 3HKFA 4MNHB 5AG9A 4UV7H 4IOFC 1P7KA 3EYFB 1HYSC 3LKSB 4KJWC 5FB8B 2HFTA 1MVFA 3ZE2F 3TNNA 5L9DH 2IFFH 5SWQB 4IIQB 2R2EB 4JKLA 4J8RB 1RHFA 1K6QL 1BAFL 4NPYA 3GHBL 4HX1A 4KRNA 4WI4A 4YHZL 1G1YA 1HSAB 2DBJA 5C09D 3WIHL 2Q76B 5ABDE 3VFRB 5ILTL 3RX7A 2VQTA 1WWBX 4JFXB 3LQZB 3LS4H 4OCYL 1INDL 2QSCH 2VWEC 4KI5F 1HINH 5D1QA 2PXYD 1QEWA 3ZT6A 4P2RA 4YHNA 2NXZC 5IWLC 4YNYA 4P2YA 2AXHA 1PGRB 5D7LB 2VLRE 3T0AA 2X9XA 4YBLC 5BQ7B 3CC5A 3WMSA 4WHYH 1JNHA 5TQ0H 3SDAC 4M5YL 4QXWA 4LEOA 1PW3A 1N3NB 2C4FT 1KJ3L 4RMVA 2GJ6A 4CADA 1MH5B 3WFCH 3ARBD 1DBML 2YEZA 4P46B 3U7WH 2Y07L 3BHBB 5KVEL 1F02I 4P2QB 5CLWA 2ZUYA 3KLDA 1U0QA 3HMXA 3AM8C 3VDCA 1UM5H 5C2UB 2AP2A 4DVBB 2W38A 4R8WH 5C0AD 1OAYH 3IETA 5EOCH 4EZMA 1CL7I 5E7FA 5FM4A 5TJWK 3RNKA 4OGYL 5F3BA 3ARPA 3LRSB 4J4PD 2C3VA 3MJ6A 3UO1L 2ICEB 2PN5A 1YA5A 2MQ3A 4NYLA 1E4XI 1UA6H 1NDMA 1OCWL 4KKAC 1ZS8A 2PUQT 1T20A 3ARWA 2BVTA 3AU1B 4TUOA 1CTOA 3X13B 5I76A 3DGCR 4JY5H 1N5YL 1PD6A 2VXVL 4IMLB 1WEJL 4QTIH 3ARGB 5F89B 3WFHA 3PV6A 1YEIL 5FGCE 1X6LA 1LK3H 1MNUL 3BDYH 2C3VB 1PQZB 4RGMB 2D0HA 3H9HB 4HIIB 2CRZA 2HKHL 5JUEL 4XHQA 3D25B 3LHPH 5C0RH 3GHBH 4NNYA 3CDGA 1BBDH 4OCNC 5A43C 4LCWD 1W72L 2YMXL 4L1DA 1BD2B 1FZJA 4XNUL 1GAFH 4DEPB 3SDCD 1DQMH 3CFEA 1OVZA 4PP2A 2P49B 1HEZB 2AJUH 1NBZA 2DLTA 1UADC 2IADB 1QQDB 3V4VH 5DR5L 3GB7A 4ZNEA 5D7JB 3EOAB 2V5YA 3DSFH 5E8PB 4CW1B 5JOFA 4I2XE 4Z7VF 2UYLA 3QA3A 2VOTA 1FYTD 3H9SE 2ARJB 3QZWG 3SDYH 5FA4B 4L3CA 1UXWA 4KTDL 3RKDC 3HZMB 4QRPA 4NCC1 4W4NA 2VERN 3HR5A 4FZEL 2X89D 3O2DH 5EZIH 3T0DA 1EEZB 3SJVB 3QIBB 5KS9A 1SM3H 2VLLB 5DFTA 1RK1B 1ACYL 2VH5H 4V1DA 4JFXA 5EIQA 3CH8A 1LEGA 2FO4A 1XR8A 4GG6E 2IEPA 2ICWA 2ZCLL 4P2CG 2XTJB 3B9EA 1PKOA 4JM4H 2NTFB 4NOBA 3EOBA 2FWOA 1RHHB 3D18A 2ED8A 3IXTA 3R06A 4ZD3L 3O6KL 2F19H 5I18H 4KDTC 3FQRB 5J9PA 5B39A 2MSPA 3D0VA 1F11A 2CLVA 3H42L 3VD4A 1JNLL 1AHWB 1Q1JL 1HXYA 4M1CC 3CVHL 4N9GB 4HXAL 1VERA 3BUTA 2C1PB 4XP1H 3U30C 3GJFH 3MRCB 2EIBA 1JNNL 1UACH 2HFGL 4LDOB 1N3NA 5LJYH 3ARBB 1JVKA 4FQ2L 1YEDB 5EC1A 3QQ3B 4AEEA 3N1PC 1MCHA 5L2JB 1SY6A 1SYSB 3NVQA 3WUWG 1A6WH 5J11C 5DO2C 2BSED 1UCTA 3E6HA 3VG0L 4U6YA 3O3EB 3PDGA 1OF2B 2F74A 5IFAH 1UVQB 5IFJA 5CZXD 4XNZC 5D7SH 5F70A 2VLKA 2F5BL 4R26L 1ZAGA 5E00A 2QL1A 5C0BD 5EH1A 5D7LA 3CX2A 3MLSH 1AC0A 5I1AB 3HA0A 5EC2A 5I8CB 5GRVL 5FV1L 4XAKE 3PDDA 2FSEA 2W9DL 5JR1L 5I76B 5EIVA 5DFVD 4Z7UA 5TH2A 4QRPE 1QUNA 4KKBD 3EO1B 5CJ8A 5CD5C 4Z7UF 4PY7B 3H9SA 1TZGH 1ZEAL 3DBXA 2AABH 4I2XA 1DBKH 4ZAKB 4NQSA 2YOCA 3PV7A 4RAHA 3D39A 4MNQA 1MIEL 1NCUA 4M7JH 5ID1A 5C09B 3HNVL 4ODSH 4RGOH 1C7TA 3QIWC 2B2XL 3G6JB 1NC2D 3UTQB 3B2UC 4Z7QF 4DKEH 5JXAH 1MCJA 4L8BB 1CWVA 2VLJA 4Z7QE 4ZOCA 4WUUD 3NABH 3C8DA 3TCXA 5C07B 4HC1L 1NAMH 1T1XB 3BP4B 2QQLH 4U6TA 3C5JA 4L9LA 4WI9A 3PHQA 4JFPB 1JGEA 4N0CC 3UJJH 4HIEA 4I3SL 1SJXA 1EEYB 3CGTA 5A3ID 1FFNB 3SDCB 1AP2B 4Z7UE 1KOAA 4R2GC 2I5YL 3OKMB 4ZFGH 3U7WL 1JRHI 2H6PA 1MWAA 2XKNA 1JUFB 1K4CB 2X4OB 5GGRA 1EEQA 1YDPA 1AE6L 2IQAB 3C6LC 4G6JL 4JM2C 3NPSC 2ZP0T 4P2QD 1ZA6A 4KQ4L 4PJEA 2XZCL 3PP3K 5MEOA 1HHHB 3ARFA 1YJDH 3MRBB 1DCLA 2L0DA 2E6JA 1EFXD 2B0SH 2YXFA 2J4WL 2R1WA 3S96A 3CUPB 4XGZA 5DEFB 5HYQA 1S7UA 1XF4B 2HG5B 3W11C 5TDOB 3BIBX 1YEGH 4P9ML 2F8VA 3VXQB 4YZFF 3O9WB 2EDWA 1Q9OB 2GY7B 5IUSA 2AXGA 3N1QC 2YRLA 3TNNB 3V52L 3ZTNH 2ATPB 5GGTA 1M7DB 4FQ1L 4OFYA 3BD3A 1Z5LA 4XGZB 4O2FA 5EU6D 1LEIB 4R3SA 1D5XB 1IGFL 4HWUA 1KGCE 4NHUA 4ZUVA 1XF1A 3OAUH 1OD7A 3B8YA 1AR2A 2AVGA 5GSRA 2FYYB 3VU2A 5DD5H 3T0WA 5K59F 2X4UA 1QACA 1FDLH 1R24B 1Z9OA 1WFNA 4TUKH 4Y4FA 4PJEB 4QHLA 5HI5C 1UQSB 4WW1A 1BX2B 3PGFH 3VFWA 3X3FH 1UB5A 5GRZA 2LVEA 2Y23A 1JK8B 3FO1B 1R5WA 2V5SA 4EN3B 2VDQL 4PLKD 4YLQT 2WQ8A 2OR8A 3WV0A 3KLSA 2MPAL 3PP4H 2OL3H 3O11A 3PNWA 3I3DA 4IDJH 5IFJB 1MIMH 1BD2D 2YPKA 3MUGA 5ALCL 1FLRL 3KPLB 4K71B 4UIKH 5D5MB 4ETQB 3RU8H 3F12A 2VKXA 4LSQH 1U3HD 3MBEA 3IDNA 3WFBL 3ARFD 3B3IB 2VKWA 3OPZL 5CZVH 3ZE2E 2AJYH 4WTZA 3CLFH 3ULUH 4KKBC 1UQSA 1XF5B 4QHUB 4LSRL 2XT1B 5GIRB 3SPVA 2I25N 1T21B 2VISA 5IM7A 1AGFB 1URLA 4KJPC 2IG2L 2C3HA 3TBYB 2H8PA 5K9KB 3WS6C 5GSRB 4PR5A 1GC1L 3NA9H 4ZO9A 4PRBB 5I1HH 2JJUA 3ULVE 3PGFL 5FYLH 5EPMB 2D2OA 1UJTA 3PIQA 4IBLT 4YXLH 1CZ8H 1LK2A 3WBDA 1UZ6F 4PLNC 3ZDYE 1HKLH 1WF5A 4CBPA 2UZXB 2JJTC 4ZAKD 5LBSL 4TTGA 1C5DA 2OJZL 5GGSA 3VXSB 2WQRA 4PD4K 5HVHB 4RMQA 3FO2B 1Z3GL 3BRDA 3BZEB 3LB6D 3UJTL 3KPSE 2AW2A 5DLMH 3BN9C 4HWBL 5DGQA 5FM5O 4ZTOH 3BEVA 4X83A 3OPZH 2BJMH 4PRBA 3RQ3A 1AGBB 1SBSL 2VLKB 2X4PB 3FFCB 3CX5K 5EFIB 3RZCB 1U8PA 1DE4A 2WLYA 3WN5B 2FSEB 2HFFB 4PJBE 5IP4A 2OK0L 3H9SD 4WCYH 3HZMA 4HHAA 2VZOA 3EOTH 1OARH 3DX8A 2P48B 4WW2A 3TBWA 1UH3A 2Y36H 2VE6A 5C2BL 4MLIA 1HHGB 5K93A 1ZHLB 1UM6L 1QLEH 4QT5B 4OZFA 3WIIH 4AIOA 4WO4A 1H3UA 5D7JA 3W5MA 2HFEA 5LQBL 2PTUA 3OSKA 5DHVA 4Z7WF 5GGSY 3W9EB 5I1KL 1G6RL 5CP3H 5I1GL 1LQSR 1JFQH 3MA7B 3LKPA 3LV3B 2DBLH 5HHPA 3V5HA 1BFSA 3MV7E 3TO2A 4FZ8L 1YMME 3AB0B 2OP4H 3G6JA 1YQ2A 4GSDH 1JHTB 1EXUA 5BO1L 4KQ4H 1BFOB 5CJQH 1GC1C 3UTTB 2FRGP 1NFDE 2B0SL 3Q2CA 2XZZA 4GKSA 3ARGA 4F8QA 2OCFD 3WFEH 3LMJL 1R3KA 4KTEH 3AS3A 3ELAT 3BZDA 2VZ1A 4LFHD 4PRPE 1X4ZA 4NUJA 4PJ5A 4XPFH 3O3BA 5EU6B 5HYJE 5CJXC 3BSZH 2Q86A 1WTGT 1RULL 1VGEL 3V5HB 1PG7H 1WCBA 2DICA 4H5SA 4LHUB 1QFWH 3RWCB 3ZDYF 3LAFA 2CXGA 4PV9A 5EZOH 3STZA 1LP9A 1PJ9A 2P45B 4ZPTB 1MSPA 1AD0A 3BP6B 2YN5A 4HUVA 4Z7NF 4GG8B 3FRUA 3V4UL 5IW1B 4ONFL 2ZCHH 3ULVF 1I75A 4HCRA 2EYTB 4DCQB 3FQTB 4U4BA 5T1KB 3VXTB 3NIGE 3GMPB 1OGAA 3BKML 1NEZA 4PJ8C 1F4YH 2VDKL 1KJMA 1N59B 5FOBB 1QBMH 4OZIB 3WS3B 4G8IB 5TE7H 3B5GA 2FCBA 2MMXA 4FRWA 5T1LA 4R26H 3S4SB 1T4KA 3HC3L 1J5OL 2OS7A 3WO4C 2P5WD 5IFHH 4R4BA 5CJBA 3K3QA 5FF6A 1ZHNB 3ESUF 4LRIA 5B38G 2R8SL 2FNBA 1FZOA 4W68A 2EKSA 2HLFC 5FK9A 4ZPVA 1PG7L 4MJ2A 4G43B 5DJXA 4Y1AD 3O3AA 4JDVA 3LN5B 3C09B 4HCRL 3SKUD 3SO5A 3THML 2DI8A 2WUBL 5MERB 5JHDB 3G5ZA 3IFNL 1P5UA 1JPGA 2WBJD 5ICXA 1MRFH 3WXWH 1VPOH 4OF6A 5LCVL 4PGDB 1MIEH 4CL7A 3KNBB 3VFVA 5B3JE 2DM2A 3VFSA 3CK0L 3Q3GB 1KFAH 3SE9L 5FECA 3O9WC 2VLME 1TFHA 2GYSA 4F8TA 3LQZA 1CN4A 4P57B 2P5EB 1KN2L 4HPOH 1XAUA 4NZUL 3BYYA 1J05A 4Y4KC 3TO4C 5L9DL 1TZIB 3MFFA 3CD4A 1M6OB 1MHHB 3VXRD 2KZWA 4S0SD 2X4SA 3UPAA 1FPTL 1N64H 3BUYA 1E27B 2V17L 3OMZA 1DEEA 2UWEE 3EJZD 5KZCB 3L3HB 2CK2A 1KLUB 5CINL 4HH9B 3VFNB 1OAXL 4AEIH 3FFCD 2GAZB 2M26A 3EYQC 4YDLB 3RZCD 2DMCA 2I27N 4S1SH 4NQTA 1C08B 2OMNA 4Y16A 3RZCC 1G7QB 4B41A 2WMPA 5B38B 4X6CE 3VFOA 1F2XK 1J88A 3PL6D 4ZUTA 3TV3H 5C2BH 1IM9A 1RUQH 1JPST 1KXQE 3KJ6H 4HIEB 3MOBL 1U8JA 3P4OB 4MQXD 2BSSA 4PRHA 4MQSB 3WL9A 4JFOA 2HRLA 1KEML 2DQJL 4O5LL 2OL3A 1NMCB 1ZT1B 1I9IL 3EJYD 2UWEF 4KMLB 5FO7A 5DMIL 4EBQL 1F6FB 2AJXL 1BQSA 3S9DB 5CIPB 4JB9L 3L3OA 3H2WA 4PJCE 4ETYA 5JW4R 4K3DL 5DK2A 4F2MB 4JY6B 4G7YH 4YX2H 3H6JA 3DBXB 4H1LB 5ECJE 1DVFA 3UTTD 3EDJA 2R0WH 1GGIH 3OKKA 4NGHL 1ZTXL 4AY0A 3DUHA 1JRHL 4F7PB 4PJIB 1P4IH 3QFDB 2AJZA 3DSFL 3ZE0E 5ADOL 5GZND 4WU7B 3T4AB 2QR0B 1XF4A 4CU7A 3WJJC 4RA3A 5E2VL 1OM3L 5I1LB 3OF6D 3LEYH 1QP1A 4PJ7A 3BP5B 4R96B 5EUKB 4MNHA 4EI5A 1JGLH 4JY6A 3U2SB 3MA9H 4P0DA 5JOPE 2DWDB 2BVUA 2Z8RA 1QTYT 5LCVH 2FEEI 3KR3H 5E2TH 2ICWJ 3W2DL 4NKOB 6FABH 3RUGF 3GMRB 4EIZC 2EDKA 2D7NA 3QA3B 2CIIA 5FO8B 4Y19E 4MCZB 4ORGB 4KUCD 1J87A 3ARDB 4P4KD 3KLHD 3L3KB 1NMAH 1EV2E 5I1JH 2X1OA 3BEWA 3U30B 2AJ3A 3LPFA 5L0QC 1P4BL 3I6LD 4L8DA 1YEHL 3DUUB 1IGMH 4E5XA 1NAMA 4TPRL 4BYHA 4OTXL 3IKKA 2EC9U 4XHJD 3DROA 4R4ND 3ZZ1A 5HJ3A 1T0NB 2NX5A 4PJ9C 4JFFB 4X8JB 4PJAF 2NNAA 3VD9A 2CDEA 2QHRL 5D2LF 5DO2D 5HGBA 5IFHL 4NDMA 4Y4FC 3QO0B 2DRUA 2WINA 4HUVB 5EOCJ 1DBAH 3MO1B 1V7NH 4HKJB 1XR8B 2C7UA 5DQ9B 3HAEG 4TULH 4PJIF 3VXMD 1WISA 3ECBB 4U2ZA 2YBRB 3PJSB 3MGTA 3J8F7 3SOBH 2FO1A 1MCQA 4JY4A 2W0FA 4JFYB 1D5IH 4ZXBA 35C8L 2VTFA 4WHCA 3TT1L 2AI0H 2HTLC 3EO9L 3PGDB 4RFEA 1EEZA 4S2SA 3X12A 1TETL 2OTUA 3DXAD 4J3SA 2YWYA 3VD3A 4UNTA 4M1CD 2DS4A 1HOCA 5GRVK 4CN6A 3IJHB 3EYFA 1KC5L 2VXQL 1AGBA 1FN4A 1PG7W 5T1DH 2BNRE 5TQ0L 3QEQA 4JDVB 1IL1A 1OPGL 5C0GB 1S5IH 4ZPVB 3U79A 5DRZA 1P84K 3D85D 2CMRL 2DQEL 3UDWC 4UDUA 4JHAH 3E6HB 3C8HA 1QLEL 4JFFA 4U7KA 4Y2DB 1ZHNA 4XBEH 1FC2D 4YBLB 1HHKB 5ELIA 5F1SA 3LD8B 1NGXB 4UBDD 2H9GB 3QEUA 4AEHL 1T89A 5GS0L 2BOBB 4ONHA 2PYEA 4LCUA 3N1FC 4U6HB 1YEJH 4HUKB 5HDBE 3C2AL 3VFGH 5D6DC 4UILH 2XZQH 3O6FB 1KYOJ 1PSKL 3WNPA 5BS0B 2OX5A 5CEZD 3GSNL 3CFJB 1D5IL 1FAIH 1V3KA 1TTGA 3QDJA 2X4TB 3H9HA 4WO4B 4X98B 3BH8A 3QXDB 3SCMC 4M62L 2IPTH 1TPXC 3I2CL 1YUHB 5K9QG 2P5WB 2Q7NA 2NR6C 4YFLF 3VWKB 1F58L 2PO6A 4HLZG 4X9GA 2FWOB 1IAIM 2P8PB 2FL5B 3BJLA 2D03H 5DK3A 1PFCA 1E27A 4Y16D 3X14A 1CGSL 3QXVA 2BHUA 5EUKA 1YNTB 1A7RL 1P4BH 4OZHA 1IEAA 2VB5A 5BRZA 1FGVL 5DFVC 1D9KD 4HUWA 2VLLA 3MBXH 3IDYB 1R3HB 5FGBC 3AS1A 3QDGE 4OZHF 5E0QA 2AK4E 3KWWB 3NH7H 1FV1A 3SDDB 3TPUB 3TA3D 4P2QE 5INCB 1ED3A 1ZOXA 2H26B 2VXTL 4LHQB 2HH0H 2DJSA 3FN0H 1UWGH 1JMZA 1OM3H 5DK2B 4F2MA 1VADA 5DVKA 1KPUA 3IAPA 3TN0C 1X5AA 2DQCL 3HMWH 3KPSD 3QG7L 5J13C 1IKFH 5K9JH 4GMSH 2Z8SA 5I1CL 5DDHA 2UZYB 5DJ6B 3NAAH 5L2KD 1OSPH 4L3EB 5IMMA 5T5FH 3CSYB 4K3GA 1MY7A 4ELME 2QQKH 4YEEA 5GJTH 2HYMA 4WUKH 2W0FB 5GZOC 4NP4H 1KB5H 3IDJA 3PL6B 2NY6C 5DK0A 4M7LT 4JZNA 5DRXA 3LY6A 4MWFB 4P3DB 5D2NC 1NCWL 3DI2B 4AENB 3DX7B 4O4YL 5C7XH 4Z8FL 3HUJE 4K3HA 4GKZB 2JTDA 4H8WL 5IESH 2OQJA 4NO0B 3HPLB 3D2UD 4K3DH 1DDHA 1E4KA 3F62A 2Y5EA 12E8L 1WLHA 4HJJH 1CLZH 2XV6B 4JG1H 1S78C 2FYYA 3BVNB 3F7YB 1MF2L 2CLRA 3A6CH 5H35B 3CIQA 3GKWL 4WEBH 3QIUD 1LK2B 3IFLL 4MQXC 4P5TC 4JREB 3EGSA 4G8FA 5BVPH 2DN7A 3ZKNC 3ARVA 4RBPH 1J18A 4AEIL 1D5BA 2Q3AA 4QXGL 4ZO6A 5HVGB 1RI8A 3QIBC 1WIOA 1ZVSA 3JWOC 4I3GA 3W39A 5GGVL 5DSCA 3HC0A 4LLVB 4ZS6C 1D5ZA 4X9BA 4D8PB 4HIHB 4LSUL 4LCIL 2F53B 1MHEA 2VQ1B 2PXYC 1S7VA 2ITDB 3GSOB 5JW4N 5JW4M 3OR7A 4HCRH 3SCMD 3ET9F 5ID1B 4HKZA 5HYJD 1P9MA 3D9AH 4P2OA 3ZSTA 4OCSH 3OKOA 4G43A 1JN6A 2VYRE 3MV9E 3V52H 3EGSB 3FQUA 5CBAA 4RNRA 3HLAA 3TJEL 1Q0XH 4KI5D 4Y5VA 5J7CC 4OGAC 3GMOB 1XR9A 1JV5A 5SV3A 1WQVT 3BVNA 3IF1B 5D8JL 1P6AB 4ALAH 2X10A 1G9MC 3IDIB 4PJFE 1JPSH 5M7QA 1U41A 1A9BA 1FORL 1TJHL 1DL7L 1FYHB 3QIUC 3VFPB 4YDVB 3NCCB 3HI6H 3B9AA 1A02N 1FFOB 1FVDA 5JR1H 1F97A 5DS8B 3TIDB 3LMJH 5DD6B 3LKNB 1EAPB 4Z7VA 3LEYL 1GCFA 1E4JA 4IRSA 1IEHA 1I3RA 2BY0A 3UTPD 1FL5B 3DRQB 2IF7A 2QQNL 4B7IA 3HLAB 1JGUH 4NRXA 3D9AL 1ZHKB 3H8NA 1X5GA 3D3VA 3UDWA 3AB0C 4L8BA 5HHMB 1QFWL 3W2DH 5C6PB 1QR1B 4LLQA 3IDGA 4I3SH 4KUCF 2FZ3A 1JFQL 1YPZA 4PJ8D 3NFPB 4HAGA 2NY6D 4NWTH 4W70A 3PWPE 3L5HA 4HC1H 4PJ9A 3UTTA 5D96C 1QD0A 3OX8B 3SO3B 5IBTL 3GSWB 1CK0H 1HZHL 3QFJE 4DVRH 3KJ4B 5INCA 4UB0L 4U05A 4JG1L 5BO1H 2BVQA 1FFOA 3OJDA 4ISVB 2VN7A 2NY7L 3FZUD 5EBLB 4I0CC 1TXKA 5D5MF 3NPSB 3BDBA 3MA7A 4P5KA 2GITA 2DMKA 3VXPA 1LGVA 2NY4B 1KIQB 4U1LB 4AIZB 4OB5H 5IEHA 4X6DA 2R0LL 2FR4A 2B5IC 5DHVB 4PJIE 4PREA 3ZYOA 2EE3A 4BFBD 4WFFD 4ODUA 2DQCH 3DMMC 4KKNA 3QHZH 3QNYA 3FHAA 3E8UH 4HWBH 5FDWA 3SJVA 2HJLB 1MLBB 2AQ2A 4JZNB 4JR9H 4ZFZB 1EVUA 1IBGH 5F7EH 1G0YR 4PS4L 4OM1L 1G9ML 3PXHA 5D2LE 5D5ME 1BM3H 2Q3ZA 1U8KA 3UTSE 2XWBA 1DANT 1B6DA 4BQCA 4YGVA 4M62H 3BDXA 3RDTC 4NP4L 4ODWA 4K2UL 2AQ3A 3NTCL 1R24A 2BSRB 2ZUXA 3DVGB 3BKCH 1HILB 5TGBB 4ZG1A 3IVKA 3EOAA 3ROOB 3KPOA 2PCPA 4NHUB 4LQ1A 3AMKA 5E4EB 4R4BB 3BWAA 2BNRD 2OSLA 3I50H 3VA2C 1BVLA 1UKSA 2BVOA 3FQRA 4BQBA 3I02B 4MYWB 1YEEL 1T0MB 3PXJA 1A1MB 1HKLL 3IRZA 2QJDA 4UT6H 2YHGA 1PKQB 43CAB 5BXFB 1IEBB 3MRLA 3VXQA 3HE7B 3VXTA 1AGEA 3U0PB 1I9RL 1WT5C 2CIKB 2A77H 2FECL 4CUCA 5C6TL 1AHWC 1MFAH 5I0DA 3QEQE 4R6UA 3DVNB 1J1XL 5C0GA 1HH6A 3KPPA 3BP6A 3ZKXB 2EH7H 2YRPA 4GAYB 4MCYB 3V6OE 1MFDL 1D6EA 4K71C 3UMTA 3TA3B 1BMGA 2OL3L 3I6GA 3DLQR 5E5RB 4YXKH 2NZ9D 1YJDC 3HTLX 5K9JL 1IGCL 1NCBL 1AD9B 2B1AL 1UWEH 1HQ4B 4LARH 1TTUA 1NEUA 2YD5A 2CQVA 3GMMB 4GBXD 2J3SA 5ITFA 1VA9A 3WFBH 4YC2B 5BOPA 5DC0A 4JM2A 4MAUH 3HZKA 1YEIH 4XRCB 1JIBA 3WLWD 5EFIA 1QO3B 3O6FA 4Y7MA 3DUSA 1V7MH 1WZ1L 3GSQA 3QULA 1OAYL 4XXDB 2AXFB 5HDOA 1ZKAA 3LVEA 1QFHA 4MB4A 2FJHA 5LGHH 1B0GA 3PWUB 5CS7A 1XF2A 5F88A 2DLGA 1RZ7H 2ZUQC 5IG7B 1J0HA 4J2XA 3V4VL 1FZMA 1FDLL 3F58H 1KT2B 4HGWB 3C2AH 2ZG1A 5F7EL 2BY2A 1FN4B 3K8LA 3OAYH 1QLFB 4Y19A 2ESVA 5C0IB 2L7UA 1IL1B 2IAMD 1EK3A 3BI9X 4XWGL 4K3EH 3O2WH 1MCKA 3S3SA 1N5YH 3FAXA 3HCVA 2H45A 4UDTB 5A2LH 5E1AB 2X7LA 4XPFL 3MLVL 1N26A 4YHIB 5TE6H 4WW2C 2RHEA 1EAJA 3IXAB 4N1CA 3G6DH 4HWNA 1LK3L 5EBWA 4ZFOA 1T20B 3U2SA 4C83A 1MCOL 1HHIB 4PJ7E 2PKDA 4KK8C 4I0PB 1UB6B 3ZTNL 2VXVH 5MI0C 2A83B 1FQ9C 2EO9A 4PP1D 4C56D 1CDJA 1UM6H 1RZJC 1E4XL 1IGIH 1EERB 3RL1A 3GB7B 2UWEB 1KCSH 3RX8A 4L4VA 3CPLB 4U1LA 3BD4A 4AIZA 1CFVL 3LS5H 3O8XA 3BT2L 3MRIA 4BH7B 3O41A 4LSVH 5SV4A 3ZYJA 1WV7T 4ELMF 3JUZA 1EBAA 5KTEH 4OZIE 4M6OH 4PG9A 2FD6L 3FT4A 3JV0A 1Q0YL 4HS6B 4OD3H 1G7JA 5HVWA 3RGVA 1N6QL 4UT7H 4X80L 1IT9H 3GSWA 2FX7H 3HNTH 3MTRA 2G9HA 2B1AH 5ILTH 3L3IB 3UTOA 4GRLD 5JPMB 5FUZH 1EJ6A 3F5WA 3CSBA 4G3YL 5EU7E 5KAQF 2V2TA 3SEPA 5TPWL 4L9LC 4OLVL 3RWFA 2ATKA 4OGZA 4NKOA 3QH3B 2YR3A 2A0LC 2HA1A 2WW8A 4BH7A 1PX3A 3F12B 3HPJB 1JF1A 1Q9LB 4QHNB 5CWSB 3EOBB 1T5XB 4P59H 3T1FB 4N0UB 2L4OA 4PJBB 1JPTL 1HYRC 1TITA 4YPGA 4Y4HB 4KDTA 1RZIA 1CF8L 3MV7D 5K9QI 1SBBA 1CQKA 3CUPA 5CHNA 4QRRB 2ED7A 3NIDF 1QBAA 1T22B 3JTTA 1IC5H 3T2PA 5L7XL 3BMWA 3MRBA 4F57H 1F8TL 4RIRB 3ARUA 3QIBA 3QUXB 3QFDA 1QPXA 4NSKA 4N1HB 5JNYA 5J1AA 1GZQA 3GIVB 3GSVA 2NW3A 4LAQL 3SKJH 4JM4L 2LAAA 4H0IA 1I9RH 2LVCA 3LRHA 1KCRL 5E99H 4NGHH 3TA3C 1WVZA 4KJYA 4B7LA 3LEXA 5FGCB 4WI6A 2XN9D 2P5EA 4Z76A 3A6BL 4PJDF 3VGFA 8FABA 2OI9B 2YEZB 5IVXF 5EU4A 3MOBH 3MJ7B 3ROOA 5F88B 3QHZL 2DQJH 4N90D 1BQHA 1IAIH 3BKCL 4LLUB 4MXWH 4PGCA 4DZ8B 2IALB 5C0DB 5DRNA 3LN9A 2DIJA 5FHBL 6FABL 4D9LL 3W0WA 3NCMA 3TESA 3HC0B 4LLVA 4YPJA 4OCXL 4L8SB 2V6HA 3Q5YA 1HXYB 3UZVB 5IBUB 1DQJB 4LLWB 1C08A 3QUYC 5TFSH 3H3KA 2X70B 4OD2B 1GOFA 2ZCKH 4HH8A 4C56A 5GS2D 5DJ8A 4KJYB 4FQXD 4LKXA 3KHOA 3LKOB 4AT6A 2FDBP 1K2DB 4RAUA 3INUL 4XCYB 5I2IA 4M7LL 2UY6A 4EQ2A 4OT1H 4ODXA 5T1MA 1J05B 4X0KB 5F1IB 3PHOA 3LCYA 1UB6A 1YEKL 3QWRA 4JFDD 5EBMA 2AEQL 3EYOA 4MJID 4JANA 3IU3A 3KYNB 4L8SC 1RK0B 3C9NA 4X6EA 3REWB 4M6NL 5CIPA 1WZKA 5JDSB 1CGSH 4NQEE 1H9VA 3Q3GA 4XBPB 2VUYA 1JTTA 5I15L 4FQHB 2R23A 2A1WL 2R0KL 1RUPL 1S7TB 3O2DA 4FABH 4XPGL 1S7XA 2G75A 3WEXA 1XGQA 2R1YB 3GK8L 2ERJB 1HQRB 1T7YA 4KGLA 1N8ZB 4HIXL 1NQBA 5HHME 1G9MH 3C6LA 4XCNA 3F5WB 4K94H 2HMID 4XI5D 5E6IC 4YBQC 4C4KT 1JTPA 3VFOB 4ZTPH 3RVXC 4Y5YB 4QOKD 1YY8A 1R3JA 4H20L 3MRRA 4JKMA 1TQCC 1LDPH 1CBVL 4Y4KD 3TO4D 3HNSL 3WNNA 1NEZB 4LCWE 3ZTJG 2I5YH 3HRZA 5BS0E 2F58L 4V1DD 2NW3B 2FHFA 2DLFH 1AIFB 4R4NC 2V17H 4NJAH 4FXKA 4GKNB 1MFNA 3FQTA 5T1KA 1B4JL 3S5LB 2AERT 1LEGB 2FO4B 4BH8A 4NQCA 3U4EB 2JF1A 4JZJB 3UC0L 4HF5L 2O5YH 4FFYH 4GS7C 5LWYL 1WIUA 9CGTA 4XVSH 2HP4A 1ULVA 4FXGA 4J1UB 4OZIF 5E5MA 3T3PE 2EIZA 4KH2A 4LGSB 1EFXB 2WIIB 2FBJL 3T0XA 3WHE1 3TM6A 3ZE1E 1FSKC 4M7JL 4X4YA 4Q58C 4F9PA 3FFCA 3GZKA 1H3VA 3S3PA 1D6EB 1OAKL 5DSCB 3DYMA 4GXVH 1CLZL 5FGSA 3MODL 3MQIA 3WO3B 2JCCE 2P8LA 2JK5B 1MCWM 4IRJB 1ND0B 1WFTA 3RGVB 1C1EH 3Q6FB 5BVJA 4KKLD 3EW3B 4F37F 4I0PD 3VXMA 2E7BA 1FL6B 4ZS7L 2O5ZH 3PWUA 4JPVH 3MLSL 5E70A 5LGHL 4YEFA 3TT3H 4G9FA 4FTVA 3BX7C 1FNGB 3EYUH 1C8PA 3MRGB 3WLBB 2X4RA 6CGTA 1OGTA 1A0QH 3FN9A 3O0RL 3GSUB 4NFCA 3DURA 3JBG7 1ZXQA 3DUSB 3TN0A 5FO9B 3ARRA 5D1ZD 1PDKA 5DRZB 4I8DA 4NM4L 3D6GA 1ZT4A 3O6KH 4NCC2 2ADIA 2Q8BL 4W4OA 1WGOA 1UM4H 4EN3D 3X17A 1LP9B 3C5ZA 3NGBB 3ULUL 4J4PC 5AEAA 4ZXBC 4GMSL 5BS0D 1HDMB 1UJ3A 3DTXA 3FN3A 3V8CA 1TQBC 5CEYA 1F4XL 1NGWA 2VDOL 2QQKL 4WO4D 5IROC 1DE4B 5HHNA 3T0ED 5C0EA 4P2OD 3PWLB 3JTSA 3VGAB 5H37G 3TH3T 4JN1H 2DBLL 3P9LB 2BSTB 3EIFA 3ECBA 3UROR 5MHSD 5CBAB 4LSDA 3SGDH 3BZEA 3MO1A 1Y6KR 3MBXL 1NH6A 2WK2A 2R1YA 2PYEB 1J10A 3M17A 5E4EC 4R7DA 4UOW1 2R23B 2IC2A 1IM3A 5IOPA 2EYSB 3O6FC 4EN3C 2MKWA 2BOCA 4HJJL 3A0OA 4UQ3B 1RK0A 4QRPD 3QUXD 2DQDL 1J86A 3HMWL 3QG7H 3SDDD 3RWJB 5IBLD 4M1DL 4JO2L 1FLRH 3WKNA 3KXFA 4YH6A 2EDRA 4NFDA 1K9TA 3BPCA 2NY5L 5ACZB 2DTML 2IPTL 1CDHA 1YY9C 1TLKA 2YPLE 3QR2A 3H7LA 2A9NL 2NYYD 2W65B 4WFHE 1NCDH 4NQCB 3U4EA 3FQWB 3VMOA 3K4DA 4NHCH 5GHWH 4FXKB 4K7FB 1P5VA 4RZCB 1YEEH 2ADIB 5MEOB 3JZ7A 5F3HA 4L4TE 1BJ8A 3FQNA 3H9ZA 2X4TA 3QZWB 4AENA 1WICA 3PQYD 2F15A 1T2XA 5CFHA 5D72H 1AFVL 4FG6D 4PJAA 5JPNA 2VXTH 1CFBA 4OQTA 3AY4A 4Q0XH 2APFA 3BPCB 2VC2H 1FIGH 2OJZH 4XZUA 3UPRB 2A73B 3IS1X 4NRZB 1ZLWH 4ZUVB 1C5BH 3B5HA 4NO0D 4LSVL 5J6HA 5F44A 2Q8BH 3TJHC 1BM3L 4AEHH 1GGCL 4H1LA 5KSBB 4CVUA 4TNWK 3OX8A 2X05A 2RCSL 4Y4FD 3ARFC 1X5LA 2MQCA 3IS0X 1YC8A 4MCZA 4ORGA 1X5JA 2K9UA 2CIIB 5LAXB 3UC0H 4EVNA 3ZHKA 3VFTB 5BMFL 5L6YH 1QFWM 1M05A 2AAVA 3U4BL 5A3IC 4JN2A 4EQ3A 3I75B 3P73B 1F6AA 5E8DH 4XZUB 2LABA 4S2SB 4RIRA 1Q94A 1WTLA 1YMHA 2HT4C 4P5MB 1SEBB 4HUWB 1U91B 3MREB 4ETQA 1M4KA 4PJGF 2HT4D 4Z7WE 3ZTJH 5HPMA 4JZJA 2X1PA 4M5YH 4UV4H 4D0BA 4EUPB 2XOTA 2C7UB 3FZUC 5CEZH 1MOEA 4ODTH 2EIEA 4K3JH 1BZQK 5EO9A 4N0UA 2A6DA 1H5BB 1A0QL 4XNMA 1G9EA 5DUML 4XH2A 4JFQA 5D7LE 2GJZA 2XRAL 2W65A 4PJBF 1MI5E 2O5ZL 2JIXB 2F54A 4Z78B 2BRRH 2FIRT 2OR7A 4G5ZH 2DIBA 4QOKB 4WI8A 2W60A 4BZ1L 1MRDL 4DKEL 5JXAL 1M6OA 1CXIA 1MHHA 2WUBH 3GMOA 3L95A 2NY0B 1S5HA 1T04A 2MFNA 4BKLA 1RUKH 2IPUG 2O61A 3KR3L 4YDJB 3U6RB 3UZQA 4NJAL 1ZGLB 4JFDE 3NN8B 3QDAA 5C92A 2N56A 5DRXB 2EDXA 5LXGH 3GMQA 3RVVC 2PW1B 4M61A 4U6HA 2AV7B 1A6AA 2BOBA 4ONHB 4UV4L 3HE6D 4YHLL 3QPXL 1UZ6E 4KK6D 5ICZA 5C09A 4JPKL 4PRAB 5J1TC 3OHXB 4Y1AB 4ELMB 4LPUA 4Y2DA 2HN7B 2C5DC 3UTQA 5EO0A 4CAGA 2AK1H 3BH9B 4IJ3B 1LEKB 1MJ8L 4I2XB 1I8KB 2UUDH 4W81A 3W39B 1ZTXH 5D2NA 3GBMH 5HXMA 3M45A 3D39B 4H0HB 1HH9B 4NNXA 4CMMA 5I30H 1U6AH 4O00A 3VGGA 1YNLH 5A2FA 5F1IA 5DD6A 1VFMA 1NBQA 5JW3H 2GTZA 2UVFA 3HUJB 5IEKB 4F7EA 4PJHA 5J6GB 1Q8MA 4YK4C 4YDVA 3MRHA 3GJEB 3UX9B 5I19H 2A6KB 3MXWH 1RIVH 1E6JL 5ENWA 5FHAL 4I0KA 4GG6A 1JZ8A 2I9TA 3CFDA 5HYSA 1B3JA 3T1WA 3GSNA 1IEAB 1U8LA 3VH8A 3VXRB 4FFZH 1BBJA 4HQQL 1LO5A 1VFOA 2W0LA 3RTQB 4RFOL 1C12B 2XTJE 4HXAH 5F93C 4UQ2B 4XCFL 4IS6B 4DW2H 3HI1A 4JFEE 3MV9D 4QYOA 2R2BA 3FTGA 3TYFB 4HDIA 4OZGB 4XCCH 3C60B 5B8CA 1SYSA 2FL5A 2VDMH 3V8OA 4JDZB 1JGEB 4X8JA 3VWKC 2FBOJ 3MMEB 3MOQA 4N0FA 3RA7H 4JFHE 1VKXB 3CCHB 4GKOA 4JO3H 1H15B 4KJPD 4E42A 4YHPA 4U1SA 3SDYL 5SWZB 5IHZA 4JJ5B 1AGDA 5MENA 4UTAL 2YD4A 4QGTA 3ZKSD 1U8NB 3UBXB 1QO3A 1MAJA 4P2OC 2ADFL 4KDVA 3VD5A 1N2RB 4IMKC 2ENSA 5EU3B 5E6YA 5CGTA 2VC2L 4XVTH 3OZ9H 2MTPA 3NMEA 1UGNA 5T3ZL 4G6MH 2XA8L 5LQBH 3GUTB 3ISWA 2W59A 3MACH 4RFOH 1W72H 2JELL 4KJWD 2GIYA 4Y8DC 3P40A 3LIZL 5IGXH 1FVEB 4YR6B 5C9JA 3TH4T 1NFIB 3QXTA 2W9EL 2DQTH 4JFEA 4FQLH 2GK0A 4A6YA 5HI5D 3QXWA 4UIMA 3BZ4A 4MDIA 1E6OH 4EI6A 5L8LB 1JNNH 3STZB 3QQ9D 1T3FA 4MDJA 1Z0MA 4QRRA 5DJ2A 4PYGA 4OIIH 1KJ2B 3FOLB 4OF7A 2E27H 4GW1A 5GRWA 4JHZA 3DX7A 5JLZA 4YR6A 1TJIL 1IEBA 3R4DA 5JQ6H 5FHBH 1PKQA 2QEJA 4RX4A 3H0TB 2H2SC 4WFGD 4UUJB 3HFMH 3OXSB 3RWIB 3W5NA 4M00A 1JPFB 2DKSA 3A67L 4X7DC 4FQ2H 4JAMA 1KIRB 1MRFL 2NXZB 5TE4H 5ADPH 4X7CC 4LNRA 1A2YA 3QDMA 1FGVH 2OSLB 3CXHJ 5TF1L 2HVJA 1XGTB 4CKVX 1F4XH 2VDOH 4ZYKA 2A6IB 3IFOA 3VI3F 3GSXA 5F6HI 1TTFA 3F6LA 2VITB 2AJVL 4PGEB 4ERSL 4EDWH 5D1XD 5IB1A 3ARDD 2BXYA 4ODWB 3IJSB 3U1SL 1LD9B 1Q0YH 2ADGB 2BRRL 3GSQB 3QULB 1N6QH 4JFDA 1T66C 3Q1SL 2IAMC 5CAYB 1QLRB 4OV5B 1CVRA 2H9GA 4RA0C 3JV6B 2A6IA 4KRLB 2J5LB 3QISA 4WFED 3FONB 5JLZB 4OIBA 1SYVB 3KXFD 3QDMB 2NZIA 5DD0L 4XP5H 2APXA 2N1KA 4JQIH 4LEOB 4QKXB 4XXCC 5FXCH 4XWGH 4FHBD 4DGVL 1BIIB 2WBWB 4EI5D 5HYSB 1A64A 4O51B 5E9DE 2DL9A 2YUWA 4P2RE 5KS9E 3DIFB 5KSBF 1I3UA 1T5WA 4N0UE 1PYWA 3J7HA 3WUZA 1G6RH 2I07B 1DBMH 4J4PA 1GHFL 4XC3H 5GISH 5MEPA 3IFNH 4U31A 5SX5K 4DUVA 1JF5A 4QRTA 4XPBH 2EDHA 3R1GH 4HD9A 3BH8B 5GJSH 1WWWX 1HH6B 3VFRA 1L9MA 4LVHC 3EFFA 3PF2A 3IDMA 1Q9KB 3V95A 2WBKA 3CFJA 1YNKL 4ZNEE 5K9OB 3MFGB 4YGAB 2XZQL 1NGPH 4JHAL 3BWUC 2NY2B 1NFKA 5I8KL 5DRNB 1WCQA 1HINL 2X70A 3G6JF 4S1QL 4PLOB 2X89A 1R5IA 3D85B 1ACZA 1TZHB 4DGVH 2OZ4A 5EPMA 4JPWL 5LGJA 5E8NA 1YY8B 2VDNH 3EHBC 1AFVH 5JDJA 4L8SA 1QA9B 3K4ZA 4MB3A 4HIIA 3GSXB 4XT1C 3IDYC 4M48H 1T83A 3KPNA 4R9HA 3L3KA 1KNOA 4XB7A 1AGDB 5MENB 1DP0A 4TVPE 1QFUL 2FX9L 2X9WA 1KJ3H 2KZ1B 3OB8A 4GRWH 3HAEB 1W0VA 1T2QL 25C8H 5FEBA 1A21A 1YYLH 3NZHH 1GGCH 1HHGA 1AO7B 5FYJL 1JBJA 5CP3A 1DJSA 2XICA 4UZGA 2R0ZH 2D7OA 3CFDB 1NAKL 1N6UA 3IF1A 4QXUL 5JW5B 2NMSA 2R29H 4L4TA 1KTRL 1BFVH 3K74B 3MLUL 2B2XH 2HLAA 1KULA 5I1HL 1NCAH 3CVIL 4N5ED 4UT9H 1GC1H 3LPGA 1J0KA 4OAWB 1RPQA 2FEDC 4AL8L 4HLZH 3IU3B 3KYNA 3V6FB 1QSFD 3GSNB 3VXRA 4NQCE 2GITB 1OW0A 2LV4A 2V7HA 2ADJB 3FJTA 3T3ME 3NCJH 4XB8A 4L4TB 1I7ZB 2PR4L 3D39D 5CWSA 2W9DH 4FOMA 3SGJA 4NZTL 1IZKA 2XKSA 1LNUB 2VR9A 3I3EA 5HD8D 4L8DB 4AH2A 5ACLA 1E6OL 2AK4B 4MXVE 3HFML 2EKJA 2FZ3B 3OGCB 2E27L 2C3XA 5JZ7D 2AABL 2A73A 1U8IA 1TJIH 1V5JA 2BHYA 4LIQE 3IDUA 4NNPL 4PJAB 3RU8L 1A22B 5EULV 3D5OF 3MV9B 5D7JC 1DDHB 3C2SA 4HXBH 2VLMD 4MSWA 3NIFF 2GJZB 4L3ED 2G9HB 4JFQB 3ZT5A 2JLLA 1S5HB 1T04B 2Q7YA 1MCSA 5TF1H 4JKPH 5CINH 4TYUA 4TRPL 4H0GA 1G7JB 4LPXA 2RAMA 4HIXH 4JQXC 2W60B 2A38A 2ZUTA 2W1NA 1T4KB 5SWZD 1FNEA 1N0LA 2FR4B 1ZK9A 4WNQA 2R9HD 1KACB 1LO4L 1T89C 3I6LE 3TBWB 4K07A 4LSPL 5F1OB 3OZ9L 5T3ZH 3W11D 1X4XA 5M94B 1MLCB 1BAFH 4G6AC 2PYFB 3MACL 2AS5M 3GJFA 2V5MA 4ZO7A 1A8JH 2D31A 4HC1A 1XH3B 3IU4H 1XZ0A 4KK5C 2IH1B 4EOWH 5I19L 4MQTB 4OJFH 3UBXG 1JN6B 5DXWA 5CHNB 4NO5A 4G9FE 1IZJA 3QCTL 3SDAB 2F74B 2LAGB 3QDGB 4HWZB 4PRDB 4LIQH 4BSJA 3MRLB 5FYJD 3W0WE 3WXVL 3QEQD 3KNBA 5CSBA 2DKUA 4JFDB 2AJYL 3DETC 2XY1A 1F3JB 1AO7A 4OGXH 2ESVB 3HG1E 4CVZB 4PRHB 5C0IA 5IKCA 3PIQB 2EXWD 3NA4A 4U1IA 5KS9F 1LE9B 5E94A 3WE6A 4GKSB 3U7YL 2Z9TA 3HUJF 4HGWA 2NY7H 4U0RC 3OV6A 1CI5A 3T0EA 4LFHG 3RJDA 2DMBA 3C5SA 3FFCE 1MJ8H 3JTSB 1ZSDA 4MA8H 3C08L 5HYJB 2XN9E 2DQHL 1DVFD 1IGJB 5F72S 3LKNA 1UH4A 2XQYK 1UZ8A 1VESA 3L7FA 2AKRB 2H1PL 3E3QE 4J3UA 4D0DB 1JL8A 3P11L 1BEYL 4PJFB 1QBML 3BXNA 2J8OA 4F7CB 1XF3B 2PO6C 4KAQH 3FQNB 1MI5D 3VMPA 1W0WB 3HC3H 2IBBA 3T0VA 1DL7H 3TT3L 1HHJA 1SVCP 3LH2H 4LCYB 3OWEA 3FQXA 5F7MC 1S7WA 5EUOA 1VFBA 5LWYH 4V1DB 5D2LB 4KU1A 3OJ2C 4HF5H 4Q97A 2VXUL 1J8HB 4QRTB 2CH8A 1R5WB 4EN3A 1HHIA 4QWWC 3MV8E 2DI7A 1XIWA 2HLFD 1WWAX 3T08A 3VE0B 1L7TH 3GM8A 1QSZA 3MRCA 2DQIL 1ZSDB 4HG4K 1EFQA 5E7BA 4YXHL 2B1HL 3U4AA 3CMGA 4EVNB 2L7JA 1CG9A 4UT9L 5CZXC 1Q0XL 1RURH 2YUVA 3O3AB 1OAUH 4GAGL 2CLVB 2NR6D 1MJJB 2X1WL 4M8QB 1J9CT 4ODHH 2AEWA 4E0RB 3RAJL 5KVFL 5FF6B 1E4KC 4J3XA 2PCPB 1EXUB 3KAAA 5D8JH 4E9LA 3QUYA 5C6WH 3RDTB 2HJKB 1G7PB 5EOQH 5F9JA 5F7NC 1AGCB 3QQ9C 4NQED 4R7NA 1GIGH 1F4YL 2WM0A 4H88H 4Q7DA 2HT3C 1E28A 2IPUK 1KGCD 4LHUG 2NY2C 4Q2ZB 5EN2B 5MEQA 3CZJA 1YNTA 1A4JA 2F58H 2JJTA 3IB4A 3P9LA 4JFZL 1JPSL 3IFPA 3DARA 2G60L 3IVKB 4LIQL 2ITCA 3ABZA 4G8GB 4KY1H 4O9HH 2DYPA 3MLVH 5TE6L 1EIBA 2H41A 3VW3H 1CXKA 2PYFA 1B88A 4BZ2L 4YIQB 4D0DA 4XPAH 3D2UA 5C1MB 2YZ1A 1TCMA 1FCGA 3BFOA 3RI5F 1L9NA 1FNGA 4FNLL 4LHJB 3BGFC 3EOTL 3HE6C 1AXIB 5FDWB 1NSNL 3DNKA 1WWCA 5GGUB 1SY6H 4HULB 4XPBL 4J23A 4LSPH 3I6GB 1A6UL 4X6DB 4NQVB 1NDMB 4UTBH 3MRGA 3C5JB 5I1KH 3Q5TA 3DHJA 3KPPB 2VIRA 4P2OB 4G6KL 2E8YA 4TSBL 1S7TA 3IKCA 3OL2A 2IQ9L 1MCNA 4LEXH 4HJGB 4QRUA 3UYRH 1GOHA 1XCTB 1IC7L 4KUZH 4IHOA 2WP3T 3MRKB 1DQTA 2P8LB 1H3PH 4DN3L 3QEQB 1F3DJ 1NMBL 5GS1A 4PGZA 4DGYL 4L4JA 3X3GH 5E8EA 3U6RA 1BJ1J 3V4PL 2ESVD 1CDBA 3DGGB 3DPBA 4NNPH 2HT2C 1MJUH 4PJXF 2OTUB 4WVRA 3O4LB 4PB9H 1QSEA 2VISB 3ARGD 3ZKMD 1S7SB 2DTMH 3ILQD 5TF0A 4P4KC 3RHWF 3AREB 4JQVA 1DVFB 3U9UB 3SBWC 3VJ6B 2P5WA 3PE9A 2F9BT 2BHZA 3BAEL 3VDBA 4NYLB 4Y5XB 2EO1A 5GHWL 2Y7QB 2FHBA 5FUCC 2K1MA 3NH7L 1BQUA 2IFGA 2VDRH 5IMLB 2PETA 4LOUD 1S9XA 5E8PA 4UNUA 4CW1A 5JOFB 5F3BB 4KKCD 5FO9A 3TN0B 5J13B 4UQ2A 2R29L 1N4XL 3MLWH 2J12B 4NQCD 1BOGB 3BQUC 5J1SC 2WP3O 1NBZB 4Y4HC 4R0LC 4DUXA 1WBYB 4JGJA 1EMTH 1JHLL 3MGAA 1KB9K 1NLDL 3C6SA 4U1JB 3WL9B 1F3JA 4M6OL 1KLGB 1LO3L 2HKHH 4N5EC 5TE7L 3GIZH 3NGBC 2OJEA 3O2VH 4PJ8A 2V2WA 4JFED 1QYGH 1XGRA 3EYSH 5HHOE 4JFPA 4ZS7H 1RVFL 3DHMA 3LKRB 1MRCH 2I9LB 4JFHD 4NM8H 4FQCH 1YPZB 4X0KA 3P2TA 1AXTH 1KTDB 3BQUB 4LDEB 4LRNL 2OJEB 5D7IB 4FP8H 4NRZA 2FX9H 4LKCA 2G2RB 4QNPF 2KL6A 5GRJH 3BUYB 5HVFB 1YEGL 2ICWB 1KUMA 3OAUL 4OZHB 4CDGC 3S8WA 1UEMA 4Z77B 1QBBA 2OXGA 1S5IL 2EE2A 5JQHC 3PWPD 4NQXA 1OAKH 1NCAL 3T4AA 2E3VA 4JO1H 4LEXL 3EOYG 3IRPX 3S35X 1HXMB 5JW5A 3NCYP 4HZAA 4XVUC 4C54A 4U1MA 4EUPH 5TQ2L 2VSDA 2IANB 1OAQL 1NGYA 3VXUB 5KSAC 5I17B 3MCKA 4MWFA 4KHTL 3AUVA 5LGKA 4KY1L 3TYGL 1SEQH 4QRQA 3VFUA 2DYPB 4TULL 1ZA3B 3G04A 4QOKE 2AJ3B 32C2A 1UVQA 4I3RL 1RIUL 5J0BA 3MXVL 2BC4B 4L3EA 3WIHA 1AP2A 4FFZL 1IKNC 1IQDB 5C0CB 3QIWB 1D5XA 5HHXH 1CQYA 3SKNB 3MA9L 3PG2A 5AZ2L 4PG9B 4S1DC 5DMGC 1TCRB 5JIIA 2LTQB 1AGCA 2D7MA 4NN6B 5F9JB 3IGAA 2XA3A 1AR1D 1U58B 5E6IA 3LDBB 4BZYA 3O8XB 1FG2A 4P4RB 1PZUB 1E4WL 3UJJL 1XCTA 2GTWA 1I7ZA 5I74C 4M43H 1MHEB 5BOZG 2FATL 4OFYD 2ZNXA 1II4E 3RAJH 5ESQA 2BCKB 1NMAL 4ONGH 2Y7QA 5C0ND 4ZAKA 2FLRT 4UMGA 5CIPH 1F4WL 3BP5A 4KV5E 1XZ0B 3K2MC 4HMDA 5TDPA 5F1KC 1WC7B 2YD2A 5H94B 4XVJL 3MJ8A 4I18A 5EU6A 5AZEH 2IH3B 1JGUL 3HC4L 5FM8A 3DJ9A 5I16A 1CICA 1RUKL 1P4IL 4NQDD 4POYA 5DUBB 3HS0A 1BZ7A 2ORBL 3MRFA 4U7SA 3QG6A 5FECB 3VGBA 3DO7B 3WHXA 3T09A 5FDYA 4ESKA 3JV6A 1AI1H 1W72A 5FV2A 3CFCH 3SKOB 1OF2A 3QJHB 2EEAA 4ENEC 5IT2L 1KBGH 1IE5A 1YMMD 1CT8B 2P8MA 5AAMA 5C71A 5DVNA 5D93C 5LGJB 1P2CA 2X1XR 4FABL 3U0TA 2MKLC 1U3JA 4ZTPL 3QQ4A 2Z93B 4EDXA 1BGXL 1G7HA 1I1YB 3F7VB 5JMRA 3HZVA 3ARTA 1YZZA 2I60L 1WFOA 1AQDA 3RI5K 4Z7NE 4RISH 4PLJD 4HT1L 3MBED 1FO0A 3K2UL 4WHTA 3RWJA 4OLUH 4M8QA 5EZJA 2OYPA 3B9DA 1DQDH 1MREL 4X4ME 4PGBB 2NY1B 1VADB 4TNVF 4ZXBD 4X5WA 1NC2A 5A2JH 4LLDB 2EYRA 3G08B 4RMRA 3B2VH 4RCAA 7CGTA 3BN3B 5HI4D 1JGVH 3IXAA 4RGNB 1YYMH 3CFCL 1FYTE 1RUAL 1RUQL 1R3HA 2Z0BA 3OQ3B 4JZOB 3MC0A 3IFLH 5IIEA 5I1IH 3TNMA 2XWJB 1HSBB 4J3TA 5DYOA 4DN3H 1ZLUK 5B8CC 4O5LH 2R0KH 2W9LA 3MZTA 4XNQB 4YHML 7FABL 3N9GL 4GQ9H 3MJ8B 4I18B 3HI5L 3NAAL 1SMAA 2ZKHH 4HT1H 3WDIA 1FLTX 4PJ5B 4JJHA 4MXWL 1N7ML 4NUGH 2XQBH 2M1KA 3GRWL 2QHLA 4LLMA 4PPTA 2XWTA 5DQ9A 1W0VB 1JPGB 3ZDXE 1HCVA 4NWUL 2OR9H 4KDWA 3DX9B 4XVTL 2V2TB 2ARJA 4ELKB 4UTAH 4X5WB 3N1MC 2KQMA 2ZG2A 3QRGL 3OKEA 1A6ZA 2NNAB 1HILA 2DDQH 4WWID 4Q9QL 1K3ZA 2XY2A 3C6LB 3B43A 3QUMH 4XCNB 3QDJD 1KCLA 1GAFL 2Z93A 4EDXB 5F21B 3ULUF 1FORH 1TJHH 4LL9A 3BEWB 4XP4L 4MJ4A 2ICWI 3AMLA 4OZGA 2EDQA 2BY3A 2CUHA 2XTJC 3GMPA 2VZVA 1YEJL 4Z7VE 2J6EA 4WWKB 4ZAKC 4Y4KB 3TO4B 1G0XA 4NN6C 4N1EA 1E0OB 2KUTA 1A14L 3FO0L 3LKQB 3ZHLA 4X6DF 4GG8A 1NL0H 5F96H 2Z92B 5D1QD 2FD6H 3CNKA 3S5LG 1L0YA 4GAYA 1MVUB 3MYJB 1OCWH 3GMRA 4NKIL 5I74B 3CMOL 1S9KC 5HGAB 3SE4A 3VXUA 1IT9L 4JFEB 1GZQB 2IBZX 1AGEB 2DF3A 4CJ1A 3MBEC 2EH8H 4XI5C 3S37L 2BNQA 1F4WH 1CU4L 1KJ2H 4JFYA 5I1EH 3AU1A 1BQLH 4KC3B 4OUOA 3MSPA 5DQJB 1VSCA 4OF0A 1BFVL 2QBWA 1PEZA 1GGTA 5JIKA 2CD0A 5FUOL 4MA7L 1DSFH 5ICZB 5HD8C 2CPCA 3QUZB 1LMKA 4PBVC 1U58A 4HPYH 3BGAA 2KKQA 1GH7A 4DZ8A 3GO1L 2YMXH 4ZFOL 3GKZA 3WSQL 1J5OH 3SKMA 4JQIL 5D1ZC 5HHOA 2VZUA 3MRDB 4QTHA 2VDNL 5MP6L 1FE8L 2NY2D 2ZSVB 4M48L 4OFPA 5DJDA 4IS6A 3ZYZA 5GPRA 2YRZA 5FYJE 1CE1H 1SJVA 2O93L 2Z91A 1KIRA 3TZVD 4OZFB 1S3KL 2X4OA 3C6SB 4U1JA 1LO5B 4OKVA 1NUDA 1MAKA 5KANI 1U8LB 1M7IA 3LZFH 4ZDHA 4IRSD 3DWTA 3HG1D 4JY5L 1DFBH 2A6DB 3TJHD 1ZWIB 2YA1A 2DQHH 5B21A 1WC7A 5EU6E 5L88L 3HUJA 2GTZB 2QADB 5IEKA 1A5FL 4I9WE 4S1RH 1G7QA 4XC3L 2XPGB 5EBMB 4JQXA 1T0PB 3R8BB 2MOVA 4N8VG 4P3CL 5GJSL 1A3LL 4OAWA 4M03A 4X4XA 3MNVA 4KRPB 1QSEE 2J1KA 2J88L 1C7SA 3WD5H 2YUZA 1Z9MA 5E03A 3H7BB 3DSNA 5HI3D 1U8OA 4R8WL 4ORZC 1Q38A 3AC0A 5LBSH 5C6TH 4M1DH 1YQVL 1MF2H 2QSQA 1AC6A 2BVPA 1MFDH 3MJGX 3K8KA 3O45B 3NFPA 2NY4C 1N5AA 3Q0HA 3QIWA 2FJGA 1F5WA 2ATPA 1NC4A 3VWJB 3RIAK 4KZEL 1XIWC 4JO4H 4KHXH 4TOYH 1B0RA 4XNXL 5SX4H 2VQUA 1NCBH 4PRPD 1XEDA 4BA8A 4F15C 1MRCL 2E6PA 3VA6A 2NY1C 3RUGE 4N0CD 1CDIA 2HKFH 4FZEH 2E7MA 3IT8D 1MCDA 4TVSa 4PRNA 3SE3C 1FNHA 4UINH 1J12A 1OL0A 1D6VL 4M3KB 1CR9L 1IAOB 1NANH 5A1AA 4OLXH 1TNMA 4OCMC 2BZDA 2B8OT 5KG9B 4KZDL 3G9AB 4LRIC 1U95B 5T1LB 1L6XA 2VDPL 4ZDHB 3MLTA 3BIAX 4KVCL 1YMHB 4O02L 1EHAA 3NCFB 1IC4H 2EH7L 4QCIA 1BZ9B 3ORJA 4J8RA 4NN5B 4F9LA 4GW1B 5IROA 4HUXA 2VQ1A 1BHGA 3QSKB 4LSSH 1MVUA 3MYJA 3V9FA 5JHDD 3N85H 1T22A 1R5VB 3VRJB 4QTHB 4ODVH 4XPHH 3RVTC 1RJYB 5DI8B 1EHLL 3D0VB 3OKNB 3V6BR 4FTVB 2PYEE 3JWDC 4PJCA 1CIUA 5HGDB 5GGSB 5J6HB 1T5XA 1AJ7H 4DKFH 3BGMA 2YD8A 1A6UH 4NWUH 4RSVA 1R3IL 1UYWL 2H2SD 1YNLL 4BFGA 4PS4H 5DT1L 5IB4A 1MJJA 4PRHE 3WFDH 2AEPH 1K4DA 2X09A 1ZGLA 4RQQB 3RWDA 1VPOL 3DYOA 5FK9B 5J3HC 4HIJA 4KUZL 1MHPH 4NOFA 3X14B 4KKLC 1BFTA 4HWEH 2IMNA 4HQQH 5ERWB 1D9KA 4NCDA 3SPVB 4HPYL 5HGHA 5IF0B 4DVRL 3CU1A 4MD4A 4WV1B 5DURD 3GJFK 1TJGL 5GRYA 2A9MH 3TIEB 3E2HC 3IDJB 1ADQL 3WSQH 5ACZA 4OF5A 2Q6WB 1R0AL 1P7QD 5EO9B 4PB9L 1CXEA 1AD9A 4WTXA 3MRMB 1FE8H 3VW3L 5F9OH 2J8UA 5IB2B 3CZFB 4DFIA 2GUOA 1W8OA 2DQFA 3FKUS 4S1SL 4M3JA 5FGRA 2A2QT 1IGYB 1CE6A 3RA7L 2ADGA 2ADFH 4A6YB 1MEXL 4C4KO 1SY6L 1MFEL 4WFEE 1I4FA 5IMMB 1JE6A 1XGUB 2X4UB 1FFPA 2ENYA 3JV4A 3VRLF 3SDDA 2RGSA 2CLZA 1J8HD 5GGTH 3C5SB 1TENA 1KENH 1HN1A 1CLOH 3CK0H 3PV6B 3HG1A 3RY4A 3EO0B 5I1EL 4KMQA 4XX1G 5JMOC 1X5KA 2QQLL 3OHXA 3P11H 3RPIA 1CG9B 1XFPA 3JWDL 3TZVA 1FZMB 1WFUA 3C8KA 5F9OL 2P4AB 2IPKA 4X6BA 5CBEB 1LO0H 2F8XC 3QUZC 5FYLD 5DEFA 5HYQB 1G7MB 5GGVH 4NKMA 2XZCH 5D6CA 3OKDA 1K5NB 3BN9D 5I75B 1XIWB 2K7PA 1MRDH 4JANB 1D5MA 1MWAH 1YUHA 4KVNL 3QUZD 1SJEA 3F6IA 4HV8A 4JPIB 2R4SH 4O9HL 4RZCA 3W9EA 1X5YA 1J1PH 4P9HC 2GK0B 1I8IA 1JZ3A 1SJEB 4JPIA 4MGXA 5F96L 2P8PA 1HCFX 4G8EA 1U8QA 2FGWL 1ERNA 3L9RA 3DMMB 4EKXA 4ODSL 4ZQKB 1CXHA 4RMTA 4NKMB 3TJEH 4YXHH 1QHPA 1UZ8B 4K7PL 5F7KC 1EZVX 4E41B 5CBEA 5CGYC 4D9QE 2OBGA 1VENA 3QCVL 4JPKH 2AJVH 4ERSH 5DD1L 5HYJA 3QUYB 2FJFB 4IDLA 3TZVB 4EIGB 4PJ5E 2P7TA 5EU5A 1M1SA 4OCXH 4E0RA 4CADB 5IMKB 1OP3H 3SDXE 1KPVB 1RJLB 4FQXC 4N9GA 1NCDL 5TFSL 1RURL 1NFDA 4G7YL 1XGQB 4H8WH 3U7YH 3CXHK 4IOIB 4MD0B 5D7SL 5CCKL 1FFPB 3G6JE 4FN0A 4GW5B 1BWMA 3L3JB 3QUML 2O5XH 3MV7A 4JKKA 1SMOA 1UWGL 3C9NB 2HH0L 4FXGB 4J1UA 4X6CA 1S9YB 2EDBA 4O2FB 4PLKC 2NCMA 3O3DB 3MV8A 4AYFA 3QCUH 1M7DA 1B90A 2MQ0A 1R3IH 3MRJA 4X6CF 4ODVL 4XTRD 5T5FL 1L6ZA 4YE4H 3KS0J 5IVZB 5EUOE 3KPOB 1OD9A 3F7YA 1G6RB 5DZLA 1W8NA 3VD7A 1AKJB 1KCUL 4TSAH 4YDKH 3ARDC 1JHKL 4WUKL 5TDPB 1BZ9A 4F33A 4UINL 5I1AA 2CXKA 1GL4B