1IGML

Three dimensional structure of an fv from a human igm immunoglobulin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
115
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCQASQDISNYLAWYQQKPGKAPELRIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYQNLPLTFGPGTKVDIKRTVAAPSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of an Fv from a human IgM immunoglobulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
molecule keywords IGM-KAPPA POT FV (LIGHT CHAIN)
total genus 21
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 1992-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igmL00
3OKDB 3A6BH 2BOCA 3OKEB 4JJHA 1CE1H 5I76B 3O2VH 1CGXA 4PLJD 4U0QB 1VPOL 1A3QA 1RIUL 4WEBL 1KB9J 3VXSE 4H1LH 4YHKH 2OL3H 4E42B 2VDLH 4BELD 1NSNH 2E7BA 1AR1D 1JGLH 1CE6A 1PEZA 3BZEB 1C5BH 4L4TA 5CILH 3DX8B 4FQXD 5EUOE 3MRJB 4KDWA 3O6ML 5F3HB 1XGQA 3CFEA 1EAPB 2ICCA 1GVIA 4XHQA 5JHLH 2IPTH 1TVDA 3QA3A 4NO0B 1CR9L 3U46A 2YHGA 1G0XA 3KLAA 4LPVA 4MSWB 5EU6A 5FHBL 2O5XL 4PJCF 3GHEH 3HI6L 4KHXL 4Y2DC 1S9WB 5BQ7B 1EPFA 5SX5H 2OMNA 4RFNB 5F7WC 2VR9A 2VDMH 4H88L 3EYOA 1PQZB 4WO4D 1MCNA 3S88L 4KHTH 4UDTA 3OXSB 4GKNB 2X40A 2VABB 4MNQA 4X98A 4ZUWA 3BW9A 1QA9B 2BY0A 1X6NA 1WJ3A 5CMAB 3O4LE 1S9WA 2E8YA 1NGYB 1FGVL 2X9WA 4JG0H 3CH1B 1FAIL 5I18H 4ZOBA 3AM8A 3H3BC 4JFPB 1CWVA 2XZCH 1QNZL 5IMOB 2Y1VA 4HKBB 1DBML 3EYVB 3MGOB 4YGVB 3CFDB 4P9HL 2F5AL 4HC1L 4UILL 2EE9A 5FDYA 4ZS7L 1V3MA 5H2BA 2E7MA 1FBIL 1XGQB 1K3ZA 3U82B 1OCWL 1T2JA 4MXVE 4O51A 1LP9A 4LCYA 4JFQB 4QRPE 1MJUH 4RX4D 4NQSB 4RAVA 1CE6B 1I1RA 4C56B 1U8KB 2IFFL 3BMVA 4YK4C 4XNXH 2BY3A 1TJHL 4EUPA 4TVPE 5GRUL 1NC2D 1U8PA 4MJ4A 3ILQD 3NMEA 1NBZA 2K9UA 3NCYS 4LEXH 2D7OA 1IC5H 4A6YH 4LPCA 1RIVH 3PGDA 1RUPH 4Z0BH 3TC9A 4KVNL 4QXTA 3RHWK 1KPVA 2X70B 5D7LD 3OKLB 4IM8A 3HC0A 1FFRA 5LQBH 2KZ1B 4P5TA 1NCBL 3BO8B 1CG9A 2XZAL 2XA8L 3WIIL 5KVEL 5IW6A 3KLHD 3WXVH 4DJMA 5ELIA 3K4ZA 5HYQB 4LHUB 4JZJA 1HOCB 2P42B 5I18L 1MCQA 2P5WA 4RMUA 1ZGLB 3ZE0F 5FUZL 2CO6B 2Q8BL 4LARH 1U8IB 5J9PB 1EFXB 5ISZD 2DIAA 4P46D 1N7MH 5K59E 3VXRA 1EO8L 4K9EL 2FHFA 4N5EC 1U3HC 3RGVD 3X12B 1WEJH 4APQB 5I1AA 3P9MB 5CJXA 5CJOL 1KACB 3NGBC 3O6LH 1NC4B 5E8NA 1P1ZA 4IBLT 4S1SL 3UJJL 3F7YB 5I30H 3GHEL 3D39B 3O45A 3K2MC 3G6DH 4OUUA 3BP7B 3C5JB 3HUJA 3TYFA 5D1XD 4WV1C 5C71A 3MRGA 4BKLA 3TBSB 4OCYH 4OF6A 4MD0A 2HTLC 1W72B 4MHHI 3MUGB 5K9QG 2IQ9L 4PGCA 1CDJA 4OD3L 2HP4A 1BIHA 3LEYL 3KDMB 1EEZB 4KRLB 1MCOH 3QUXD 1A6ZA 3ARPA 4MS8D 3INUL 1AGBB 3HZVA 2Y7QA 3QIBC 4I13B 5FKAA 5GS1C 2R2HB 4OZHB 3O4LD 3NPZB 5DVNA 3RWJA 1DBAL 3EFDH 2UZIH 1RJLA 3DX9A 1LP9E 2ARJQ 2AQ1A 1OTUC 1CLZH 2IQAA 4JM2B 5JNYB 1U8LB 4KTYA 4U2YA 5F7EH 1RVFH 2PTUA 1GGBL 1CZ8L 2DI9A 5FYJL 2DQTL 2OXHA 2YUXA 3O2DA 4G43A 3U7YL 2G5BA 1JPSH 5C7XL 1XH3A 4HQQH 4OCWL 2BSTB 2AP2A 2MWCA 4WENB 2M8XA 7FABL 3QQ4B 2ZWLT 1UJ3C 3PDGA 1OQOA 2DJUA 2H1PH 3FB8B 3PIQB 1RZJH 2IALA 3BKYL 5KS9B 2J8UB 4K8RH 2VZVA 5EULV 2WWMC 4M02A 2FX7H 5AYQA 4YPGA 4GAJH 3ZKMD 5C0IA 3MRMA 2UYLB 3QP3A 4GW1A 1BEYH 4LCWA 3T65B 1KLGA 2P7TB 3FQRB 1WBXB 3F5WB 1OAZH 4LL9A 1FFNB 3V4UH 5L8JB 1HZHL 1YPZE 5TGBB 3PWVA 5BRZD 3DO3A 2X4QA 3RVVC 4GG8A 4FQHB 1T1XB 2DKUA 2VRAA 3TIDB 1T83A 5IB2B 4U1HA 2NY6C 5LGHL 3AS0A 3VG9C 5BS0A 1A8JH 1WBXA 1XIWA 4H8WL 5HGHA 3IDYC 1MCOL 2EIZB 4OV5B 3I85A 3QUMA 4X7SH 1IEBA 3F6IA 4X5XA 3V6ZB 1R0AL 2Y6SD 3MRCB 4JFFB 4PPTA 1NBQA 5E6YA 4RFEA 4XNQA 1IGFH 3BQUD 2OMBA 2PR4L 2W92A 2VXQL 3WIHL 4J23A 3HS0B 2Q3ZA 3EUUA 3U7AA 4KPHL 2ZUUA 2EO1A 4O2FA 1OAUL 3LN9A 4YJZL 4ZQKA 5TE6H 5C0FB 1AC0A 5DURB 1PZ5B 2A77H 3VFGH 3FQXB 3QFJA 4L8SC 4ZTOL 1U95A 2UY6A 3C5SB 2NY5C 5C0EA 3SDXA 1R6VA 3H0TB 1S3KH 3Q6GL 1TTFA 4KKBC 5SWSB 3MYZA 5CD5C 4LLVB 5MHSE 4AY0A 3HRZB 5DMGD 4NN6B 3VFOA 2JJSA 1EHLH 3DVFA 2R69H 1N7ML 3ARBD 3T1FB 2IWGA 4P3CH 4LDOB 3UBXI 4YHLH 4R2GC 3BHBA 2F9BT 4NPYB 4N9GA 1RZKH 3GMQB 4Z7VE 4JFDB 2VWEE 3NGBB 5I1GL 4UDUB 3VCLA 4PR5A 2NTSP 3SDDD 1YEFH 2LABA 5DUBB 4NHUB 1IL1A 5IVXA 5M95B 2DD8H 5TDNB 3VXQB 5L88H 3S34L 3MCLH 5KJRH 4NKIH 1KLFA 4LSVH 3H6JA 4IMKC 1SMAA 4FFZL 4ONHA 3ARDD 2R8SH 4JN2B 3AROA 3UTSB 1INDH 3CNKA 4R4FH 5EZLA 4G8GE 3KLDA 3P9LB 4ZFFB 5I1JL 2BRQA 1AO7D 1KJVB 1L7IH 5DJ2B 2DDQL 2QJDA 4HIJB 3ARQA 5DS8B 1FNGA 4YR6B 1UACH 4ZS6D 2CJUL 2BNRE 4XNXL 4NQTA 3ULSA 5SWQB 3KPSE 4O2EB 5T5NF 3K8LA 4JAMA 3GMRA 3DSFH 1MCWW 4WWID 4H25A 5DDHA 4NP4L 4P59L 4ZO7A 4XNYL 1KEGH 4HFUL 3V0WH 3GMNB 3WL9A 1G6RA 4QYOB 4N0FA 1MPAL 2WWKT 3CH8A 1RMFH 5EPMB 2BVOA 5FAAA 3EGSA 1CFSA 2N1KA 4HUUB 5KSBF 3PJSA 5JMOC 5DRXB 1G7IA 5TDPA 5KN5B 3JTSB 4Y5VA 5CGYD 3ARDC 1N6VA 4QGYA 4F7TB 5MP6H 1OTSC 2EXYD 2WUCH 5FYLD 3QZWG 5HHOD 2APBA 4PB0H 3OKMB 4EBQL 1S7QB 5GS3A 2EDEA 1WWBX 3QHZH 3BGFC 4Y19B 2NPLX 1DL7H 2Q6WB 5ECJE 3L9RB 2HJLB 4P4KB 2OR8A 4P2OA 2W9EH 2VXQH 5F6IB 4UUJA 1AXTH 2JCCA 1A9EB 3G04B 4HUXB 5FYJU 5FO8B 2DWEB 2FBJH 4PGDA 3OHXA 4KV5E 2KL6A 4N0UA 2QHLA 3JV6A 2YRZA 1XMWA 4MMXC 1R5IB 2BHUA 2VISB 1MCRA 4MXVF 5HD8D 5CZVL 5FGCB 4QOKD 2YWZA 3FO2B 5CBAB 5GSRA 3NTCH 5JPNA 3EIFA 1BOYA 4WTXA 5CSZA 2B4CH 2FYYB 3C60C 1UQSB 4PYHA 1UM4H 5EBMB 4PJAA 2IGFH 1T2QL 1LQSR 3QQ3A 3E2HB 3P4MB 1HQRA 3WFHA 2BRRH 1HZHH 1X7QB 2XKNB 4C58B 4NKDA 3QUZC 1ACYH 2XQBL 9CGTA 5FIEA 1RJCA 4TVPD 3TJHC 1R5WA 1TTGA 4LCIH 4R6UA 2NXZD 2XN9A 4LSSH 4K7FB 4N0YL 3JVGA 1G1CA 2FIKA 1LEKB 3MRFB 3SDDA 4Z7UB 3VRJB 4NHCL 2CK0H 4FNLL 1KCSL 1S7VA 1E27A 4MQXD 2BNRB 2C1PA 4G6MH 3ZDYE 5HD8C 1NAMH 2AKRA 3M17A 3EJZD 1X3DA 3DURA 1UYWH 2EO9A 5CINH 1FNLA 3P30L 4CBPA 5T1DH 1H3XA 2V9TA 4KKNA 2DQDL 2HVJB 1B90A 4M48H 2XIDA 1B6UA 2QR0A 4RWYH 1MEXL 4FQXA 1F58L 3EFFA 1JGUL 5FYKE 3G9VA 1K9TA 1AGCA 4YXHH 2F58L 4YK4B 1D5IH 2DQHH 4YFDB 1JF1A 2VKXA 3QSKB 3LKRB 2GJZA 5L2JA 1FG9C 1GSMA 43CAA 3NFNA 4GW5B 2C1OA 2YD3A 3IETA 4TSCL 4J6RH 4DW2L 4ZAKD 3LQZB 2J3SA 1A1NB 1YJDC 3BDYH 1ADQH 4HWBA 2FEDC 4NIKB 4PRBA 4QTIH 3RHWF 1D5XB 1MF2L 3C08L 2XOTA 1PZ5A 1INEH 2CDGB 4ESKA 1XGYH 5JQ6H 1TCMA 5GS0H 1AHWB 5FYLL 4KK9D 1ZEAH 2HKFL 3S96B 2JJTC 4POZD 5IG7B 5E6IA 3WKML 4AM0A 3MRMB 4P3DB 3FAWA 3O3EB 2I9LB 3SE8L 3TT1H 1SQ2N 2YPLB 1GC1L 3C2AH 2YN3A 5CHNA 4UIMB 3FB8A 3FOMB 4Z8FH 1AR2A 2YR3A 1T22B 1XZ0B 4ODWB 3THMH 1J0HA 5IEHA 2EYRA 3QDAA 4Q6IB 5AG8A 2PYEB 3HLAA 5E8EB 2YXMA 5EOTB 1T04B 2MHAB 2OZ4H 4WHTB 1EO8H 4GRLA 1V7NH 2FGWL 3MRHB 3EFFB 4U1JB 4FQJL 4Y16A 4CDHA 2Q8BH 3RKDD 1A6ZB 2WINA 1KFAH 3SJVD 5F93C 4NRYA 2EDLA 5JW5B 4OLYH 3PGFH 3L5XL 3GO1H 2R2HA 4OZHA 4N5UA 5H8DA 3QIUC 3MOQA 5DJ8A 3BGMA 2VMFA 3DROB 3RAJL 2DQJL 1GGCH 1F8TH 4KKAD 5C0AB 3T0DA 2AEIT 4Y4KC 4LCCA 1R3HA 5MERA 4JPIB 4DUXA 1FH5H 1T03L 2IAND 4JKWA 2DQIH 3ARDB 3LV3A 1I4FB 3NIFE 1AR1C 2FGZA 3RL1B 1BQHB 2D7NA 2DQUH 1CGUA 4JKKA 1OAQH 4XMPH 1VERA 2CIIA 4BKLB 1CXFA 5HDOA 1KJ2L 1V05A 4R7NA 4R8WL 1N4XL 3PE9A 3KLHC 1MHPH 4XNUH 4G9FE 3SBWC 3QWOA 2V9QA 3P0VH 1HIMH 3MRDA 4AIOA 4ZS7H 4PJ9B 5ETUB 4P2YA 1HWHB 1XF3A 4PJHA 4X99A 4HG4J 5F1KC 1E6OH 1X5IA 4KRPB 1D7FA 3B5TA 1QFHA 2EDJA 3CK0L 2FSEA 4DKFH 3L5IA 5IJVA 2HN7B 1T6VN 2XQYG 4HWZA 1NGWA 2HN7A 1KTRL 2P8MA 4MAUH 1KGCE 5F8RC 5CBEA 4I48A 5H94A 3ZKND 1Z5LB 4ELMA 1IAMA 4JB9L 2VLRE 1FFPB 1ZT7B 4H1LB 4QGTA 4QHLB 4WI3A 1L0QA 4YHIA 1P4BL 1BD2B 1DTUA 1S7SA 1XF3B 4PJ9A 5D5MB 3S88H 3PQYE 2EIEA 3IKCB 3SKMB 3JWOH 3QUKB 4HXBH 3ZMRA 3KPRE 4HJJL 4R90H 3G6AB 4QWWC 1REIA 5L2KE 1AI1H 4CJ1A 1ZXQA 3TCLA 3JTSA 4Y5VB 1YEEL 2LFGA 2NY1B 5DZNA 2XV6B 3RNKA 2HTLD 5D1ZD 1MOEA 3G5VA 4OIIH 3MJ8A 3HCVA 5ICYA 3DGGB 1BLNA 1H5BC 4XPHL 3TO2B 2Y5EA 2XACC 3LKQA 1E6JL 2WP3O 3EO9H 1G6RH 3IFNH 1P1ZB 2ESVE 5F88B 4KI5E 2C3VA 3GSRB 5F1NA 4I2XA 2XFXB 4R97C 4YEEA 5FA4A 2OL3B 4C59B 4WW2B 4XXCA 3IJSB 3TLRA 3D48R 5MEOA 2G60H 2FSEB 1DQMH 5T5FH 3SDCD 4M03A 1X5KA 4LQFH 1QSEA 4GAFB 3H3PH 3VWJB 5JLZB 1VPOH 1K6QL 4XVTL 3V8OA 5C1MB 4HWEL 2IAMD 4OGYL 3OXSA 4GKNA 4M7LT 4V1DE 1YQVL 4X83A 4TNVF 3P11H 5DUML 1FNFA 3EKCA 4YDJB 3QAZC 5K9OB 4LCWD 3TIEA 1HKLL 5BQ7A 3FN0L 3VXUA 4P5TB 2R1YB 5EBLA 3MV7A 3T0EC 1Q94A 2PXYC 3BZ4B 3CZFA 3D9AL 4GLRH 4QRSB 5C09D 1OHQA 4LKCA 4QY8A 4UDTB 1BQHG 1CTNA 3VG0L 2DS4A 2CLVA 4RGOH 3RIFK 1DJSA 2G9HA 3VXMA 2ICWB 3F6LA 3JBG7 1R3KB 4NQDB 2NY5H 5DT1H 3BP4B 2WUBL 3GSNL 5IG7A 5HGGS 4DKAA 3KVQA 5DRNB 4Y19E 4UQ2A 5D4QA 3FQXA 4LFHD 4OKDA 3MMEA 3ARUA 4QY8B 2XPGA 3MREA 3OPZL 3E3QC 4NNYA 4XP1H 1KN4H 2DQIL 1WITA 1JTOA 1ZLWH 5GRYA 1WCBA 2Y36H 5KANI 2IPKA 4X4MA 1S78C 1CBVL 4XTRD 3WFBL 4FOMA 1GGCL 6FABL 1MI5A 3O4LB 1MIEL 3N85H 5DD6B 3X17A 4LVEA 1UJTA 4BZ1L 4OLYL 2J5LB 2HT2D 1NEZG 1KFAL 3X13B 4ZFOB 1H8OA 3QUMH 5E03A 3NZHH 2V7NA 1MH5A 4QLRA 2I27N 1F90H 3MJ9L 4LP4A 5C3LD 4UTBL 5K9OA 3B2VH 1T66C 4ODSL 3D0LB 4OLUL 5DD1H 3SPVA 5IOPA 4GKOA 5FXCH 3BH8A 4UIKH 3GSXA 1ZHBA 4DGYL 1AGFA 3CVHA 4KUZH 4P2OC 4UIKL 5ILTL 3KR3H 4Z78B 4JKMA 4LBEA 4TNWF 1DEEA 3UEZA 1A7PH 4HF5L 4NN5C 2RFXA 3SGEH 1F6AA 3U6RB 3LKPB 3TT1L 2R56H 3SE8H 1INQB 1NMBL 1JF5A 4G3YH 4OD1L 2C1OB 1KIQA 1H3PL 43CAB 4BZ1H 5DK2B 2ED7A 5DVOA 2PUQT 3TO4A 4RCAA 3T3PF 3RNQB 3VXOA 1KJ3H 5C86A 3HFML 1FRGH 3WN5B 1INEL 4JFZH 4MX7A 3OKKB 2JE8A 3I50H 4NO5A 1CBVH 3WFHB 2A83A 3V6OE 1J1PH 1G7PA 2Z93A 1ZLSH 5CZXC 1SY6L 4XI5C 3IJYB 1NEZA 3RWCB 4K94L 3BP6A 25C8H 2P24A 1XAUA 3ROOA 1PG7X 5E9DA 2X4PA 2YOCA 5JW3L 3DYPA 3MLSH 5IMMA 3S37L 1CXKA 5L2KD 3OV6A 4GXVL 3UROR 3GJFH 3VXPB 4KDTA 4BA8A 4JVPA 2H3NB 2VDNL 4OZGE 1U6AH 1EO5A 5A2JH 3SQOH 4GH7B 5ESQA 4EI5B 4YHYB 4M9PA 4ZS6C 3D25B 3FCTB 2R29L 2Q1EA 4GQ9L 1ZVSA 1OWRM 4K55A 4R26L 1EGJA 3QG6A 5EOCL 3VXQA 3WJJA 1WTLA 4Y5YA 4LAJH 1TJIH 5KVFL 4U33A 1HHIA 4H26B 2DB8A 3MROA 3OB0H 4P5TD 4DZBB 4JRWA 3ZHLA 3TZVD 5BV7L 2MNUA 4JE4B 2JJWA 3MJ8B 5ISZE 1FZOB 1I8IB 2R0KL 2APTA 1T0NB 2DL9A 4YNYA 2XNAA 4PY7B 1IGYB 3WBDA 4WHYH 4YDIH 1K6QH 1FNHA 3DROA 5L0QC 2CLZA 3T08A 4KZDH 4Q9QL 4F9LA 2N7BA 4JFDD 4Q0XL 4NZRL 4CJ0A 3GIVA 1RUKH 1DQML 4JPWH 3RTQD 4QRRA 4KKBD 3K8KA 4X9IA 4IS6A 1HNFA 5BV7C 3SCMD 1NGXB 4GMTH 1ETZB 2IGFL 1KUMA 2L7JA 2OR9L 2W9DH 5E8PA 1WC7B 4YLQT 1YEDA 1JHKH 1FIGL 4W6XB 1HCVA 3IU3A 3MRCA 1LE9A 1UG9A 4RMQA 1KJ2A 3HLAB 4MXQC 3IXAB 5C2BL 4PJ7E 3ULUH 1NC2B 2VDKH 5DMKA 4W4OC 3QWOB 4KI5D 3REVA 3FKUS 4U1KB 2GTZB 2I26N 1ZK9A 5GS2D 5JTWA 2VH5L 3SCMC 5DZLA 4AMKL 3ZKXB 3TIDA 4NHUA 4LU5L 1WAAE 2YMXL 2W9EL 5C07E 2Q86B 3QDJE 4OZFG 5C0EB 1XCTB 5AYUH 5EWIH 3MV8D 4GAGL 5HJ3A 1JZ4A 5J11C 4QXGH 2BCKA 4WUKL 1JTPA 4YHPB 1MAMH 1G9NC 4GBXD 4PJ7F 3RTQC 4F33B 2B7DT 1JF6A 4HKXB 4DKFL 3DUSA 3W11C 2JCCF 3P4LA 2A6JA 4MA3A 5F1OB 4KZDL 3SDXB 3EJYC 5HY9A 5K9JL 4XBEH 1RMFL 1EIBA 3QO1A 3FO0H 1HIML 4K3DH 3ULVE 2UUDH 4HFUH 5EZLB 5T1LD 2VLKB 1MHPL 4XNUL 4X7EC 4HJ0D 4XGZA 4R8WH 4M8VA 1T4KA 3UAJC 3GSVB 1OARL 1CQYA 1G7MB 1OAQL 3D3VE 3O3BA 4PJEE 5J6HB 4KFZC 1ZVYA 3VFUB 1IL1B 1L7TL 3ARFB 5FEBA 4OJFL 1WFTA 5AEAA 3QDGD 1MHCB 2I60H 3BZDA 3WE6A 2FB4H 3DLQR 1EZVX 2D0FA 5FM8A 4MNQB 3DURB 3BWAA 4LLWB 4AK1A 4MNGA 1CGSH 3N1MC 2JF1A 3TFKC 2R4SL 3L5WA 4X9GA 5DQDL 3DBXB 2Y7QB 2DKSA 5D2NE 3QFDA 3C8KA 3UBXA 4PJIF 4X4XB 4MQ7B 1HXMA 4CMHB 1HSAA 2WNGA 2QHRL 4CDGC 2J8HA 4JEGB 3UCRA 2KDGA 4BUGA 1RZKL 2UZYB 5FYKH 5HJ3B 5F7HA 2E9JA 2C4FU 4GKZB 1NANI 1R3KA 1J1PL 2NY0B 3C9NA 2XKNA 3G5VB 4P57B 2ICWA 5GPRA 3WD5H 4CRPA 2W38A 1B4RA 4MA3B 5ADOH 1A7BA 2VOTA 3TCXA 3U0TA 1KIRA 2X4TA 4HGKC 5D1QD 4BFGA 1CLOL 4LOUD 4X4YA 2JK5B 3T0AA 3DO7B 4ZTOH 1OGTA 4WI6A 5EDXA 4DN4H 3C8DA 3WE6B 1WZMA 1ERNA 3KPPB 1GGIL 2E27H 3SOBH 1S7UB 1GHFH 3ALWA 3MRPB 2CRMA 4EZMA 3VMNA 3WIHH 1CXIA 4LLYA 2HJKA 2WBJB 1IE5A 5EBMA 3MLYL 1VFOA 1AQKH 5JA8B 2QR0B 2R4RL 4N8PA 4NM8L 1A1MA 5FYLH 4HV8B 4UUJB 5GGTA 3MGTB 5DZOA 4JRYB 5CEXB 3BH9B 2B1HH 3WO4C 4I1NB 4H8WH 4Y1AD 2H2PC 5IIEA 1DUZB 3V6BR 4FQIL 4I0PC 5IHLB 1AGBA 1FG2B 3HZVB 4QHKI 4LRIA 4L3EE 5D2NC 3QEHA 4PRHA 4ZNEA 2DWEA 3HUJB 5CEYA 1A9EA 4NYLA 4P46B 4PJGB 1I9IL 3TO4C 2HLFD 5CGTA 1VSCA 3OB0K 1VACA 1GZPB 4OFKA 5BMFH 1F6LL 3GMPB 3IAGC 2WMPA 4YXHL 3PL6A 1G7LB 4FXLA 5EA0L 1T7YA 3D18B 4NKDB 2JELH 3TJEL 1X7QA 1UWGH 4PV9B 43C9B 4EUPG 15C8H 1SVZA 1E4JA 1CL7I 2DQDH 5D5MF 3LKOB 4UT9H 1FVDA 4HEME 5CJXC 4RA3A 1SM3H 5GGSY 4XT1C 3DX7B 1UADC 2NY5L 1H0DB 3R8BB 3RUGB 4JFYA 1I1FB 1KLUB 7FABH 2Z8RA 4MD5A 1IM9D 1B2WL 2Z8WC 1B9ZA 4OT1H 2EXWD 4L3CB 3ARED 2C26A 2PKDA 2M1KA 4NN5B 1ZT1B 2HMID 4QHUA 3S4SB 1QRKA 1DANT 4OFIA 4B53A 5F7EL 1S7RA 5CGYC 4XC3H 4P2OB 5MEPB 1G7PB 1J8HE 5CIPB 1DQLH 5C07D 4HIHB 4QXTB 1IEAB 3VCLB 3RJDA 4JZJB 4KKLC 5SX4H 2YPLE 4HS3B 3WNPA 1IGML 1RUAH 3DPBA 5HGDA 4HUVB 3T04D 4K2UL 2D0HA 4K3JH 4KK8D 4E9LA 4Z76B 5IMMB 1UEYA 3SE4C 3B3IB 1F45A 1CG9B 1SJHB 3FO1A 2I9LA 2NY0D 3FMGL 4OZIF 4HBCL 5E8DH 5GHWL 1PX3A 4G8GD 5D7JC 1DQQA 3V95A 4LVOC 1J11A 4NWTL 4GRWB 3ZO0A 3W39A 4YHML 2C7UA 3LRSB 4I9WE 4PS4H 4QCIB 4OD3H 3IS1X 3STLB 4NN7C 1T20B 4UB0L 3TZVC 3RWHA 5E1HB 2Q76A 4HKZA 4R7DB 3R1GH 5HI3D 3GHBL 4NQDA 1PKQB 1FE8H 2QSCL 3ME0A 2Y72A 1IAII 5DJ8B 5E2TL 4LVHB 2E6JA 1BZ9B 3CDGA 1NMCC 4N90D 5E8EA 5I1HL 1J05A 1RHHA 3DMMD 2MCG1 3T0EA 3R4DA 2DQFB 4UOJA 4KWUA 3D1MC 4U6HB 3MV9E 3O6LL 2W60B 3B9EA 4ELKA 2UWEE 3ARFA 3LD8B 1OAXL 2FX9L 3HUJF 4ZNEE 1I8LA 4K9EH 3HC4H 4DVRL 2WWKO 2H2SD 5HYEA 4P2CG 4ZTPL 4K07A 5D96C 3ARTA 5FUZH 4TTGA 3W2DH 5I9QC 4Z95L 3S3JA 4LLUB 4E5XB 3FOMA 1SEQH 4AENA 5JXAL 1JMXA 1Z2KA 2KQMA 1A14H 2EEBA 3WIIH 5ALBL 1MLBB 4RMWA 4KJYA 4Q9CA 1F00I 4P5MB 5LJYH 2JB5H 3QPQD 4OGAD 5E8OB 5E5MA 2H2SC 2GJ6E 4FG6D 3MSPA 3DETD 4C4KT 1JP5A 4R4FL 2BCKB 3DV4B 5F7DB 4E42A 2IAMB 4G42A 3MFFA 4KVNH 4G42B 2ZNXA 3WFDL 3S4SG 3S36X 3VI4E 3QEGH 4F58L 4G6KH 4M6MH 4G6AC 4XMPL 12E8L 3DGGA 5B8CA 5DMIH 3EYVA 3GB7B 2AQ2A 4NKOA 4D0BB 3W82A 4R97B 4GJTB 2L7UA 1EDQA 4L4VE 4TUJA 3ARYA 1MSPA 3ZHDA 4ENED 3P0GB 4OT1L 3K81A 1ZLWK 5A16B 5ITFA 4Y4HA 1MRCH 5DJDA 4JREB 4P3CL 5GS1B 4NKMA 3NCBB 1DVFD 1PYWB 2W0PA 2VZ1A 5INCB 1SJEA 5J8OA 4U4BA 1XCQB 1SM3L 1YEDB 3O9WA 4MA8H 1ZT7A 4H1LA 4YHIB 1C08A 4UTAH 5FECB 1DBMH 5IVOA 4PGDB 3OR7A 5IBTH 2VDOH 5FO8A 3HAEH 3I9GH 5LAXB 3KPLA 3T4YA 3AS1A 3PV7A 4YHOH 1J9CT 2I25N 3DRTA 4WW2A 5IB3B 4HIIB 3E3QE 5EU6B 1MFAL 4P49A 1WIPA 3L5JA 2WIMA 1KXVC 1BFOA 1MJ8L 1OAUH 3LPFA 4YHYC 3JUZA 1ITBB 4JJ5B 3L6FB 3JWDH 1I9IH 3FJTA 4WUUA 3FQUA 2CQVA 1XIWD 2NY6B 3P0YL 3P73A 2EE3A 4PJEA 3F7RA 3SEPA 1UFUA 5IWLA 3HI6H 1RULH 2FEDD 3ZTNL 5DVLA 3SDAB 4DZBA 3UTTB 3D18A 2ESVD 4FN0A 1UKQA 4OUUB 1OAKH 3CCHA 4XVUD 5DD3H 3ZTJG 1N8ZB 1O7SA 2YPKB 5C0AD 3OKDA 3GSNA 1IRAY 1XH3B 5T1KA 4X80H 4X0KB 4MDIA 4APQA 3SGDH 3TBSA 3P4OA 1UQSA 3MA7B 1OLLA 2P5EB 2JCCB 3G04A 5JQ6L 4NBXB 2Z4QA 3VFRB 4HPYH 5K9KA 1M05B 1OSPL 1U36A 4CVXA 3OKMA 4M9OA 3RWDA 3GKWH 1YN6B 2YD9A 1FL3B 4Z18A 4YDLC 2WAHA 2YEZB 1UB6A 4UQ3B 2CXKA 3FHAA 3VWJC 3QXTA 4HEPG 1A6AB 3BDXA 1KEMH 2DTML 2NW3B 1U58B 1MCPL 4I18B 2ADFL 2DRUA 5TDNA 2E7LA 3WD5L 3IJSA 5DSCB 3FTGB 3VFMA 2EICA 5IB3A 4DGIH 2I9TA 1PJ9A 1S7UA 2H32H 3ZZ1A 3KDMA 4JFDA 1NFDF 2EYRB 4FQCH 3VH8B 4XVUC 3X11B 1UXWB 1ZHNB 3E8UL 3OGCA 3B9AA 4LLQB 4WVRA 5C0JB 2F5BH 5DEGB 3W0WD 4QOKB 2VL5B 1AGEA 2LTQC 5T1DL 4PRAA 1J1OL 3P30H 4QRUB 5DRWA 2W0KA 1QLFB 2X2YA 4WFED 2RCSH 2YD2A 3FRUA 2O5ZH 5FCUL 2ZPKH 5MEQA 3W5MA 1NUNB 1FL5A 3PABB 4Y7MA 5KSAD 1LP9B 3GMRB 1JGEB 4Y4HD 4GG6F 5T3ZE 3VGHA 2YPKA 2E6QA 4H20H 3QJFA 3INUH 1SBBA 5IB4A 3VGBA 3VDBA 4Y1AA 4JPIA 4Q2ZB 3ULUD 4O2CB 1Q0XH 2J12B 2V2TB 3NCJH 1Y18B 3AAZA 3DI2B 3BPNC 5BO1L 5C9JA 1QRNE 2EDRA 4OFPA 5I1LB 2DBLH 2VUYA 3NFNB 2V2XB 5E99H 4OFYD 3IVKA 2FECI 1XF2B 2APWA 1PKQE 4HLZH 3SE9L 2HRPL 4MB5A 3BJ91 3U7WH 3BRDA 1WGOA 3RVVD 3HG1E 4ZFGH 5HI4D 3RUGF 2PO6C 1D9KC 3UDWC 1F5WA 1R24A 1V3LA 5TH2A 4FXGB 5D71H 5EO9A 3HR5A 5GGUA 2FBJL 5DFVC 2EDFA 3BEWB 3T1WA 5KSBE 5TPWH 1PBYA 4HJGA 3AVEA 4P23A 3ET9F 3T0WA 2VLJE 2X1QA 5F9DC 2GCYB 3VI3E 1B3JA 1QSED 1I7ZA 1DQJA 4GMSH 1F4WH 4P3DA 4ZUUB 1HNGA 3QDGA 4PRIB 1J86A 3G6JE 3CX5K 1N0XH 1ZS8A 3WV0A 4HCRL 1WICA 3TN0A 5DQ9B 3TPUA 3WHXA 4KQ4L 3QUYA 5JW5A 1OP3K 3BPLB 4JRXA 1OW0A 2GK2A 5DLMH 1UA6L 1UXSA 4WTZA 1X6LA 4FTVB 4Y16B 5B39A 4P9MH 1LO2L 3GMOB 1TQCC 1KV3A 2C7UB 1E28A 3WS3B 1SYVA 4P0DA 3HE6B 3RKDC 5JNYA 3BZEA 1VADA 3C6LB 3T2QA 3BDBA 4PRPB 5BS0E 2Y07H 2CR6A 4OKVB 2NY1D 1S8DB 2QL1A 1T22A 5IMKA 4KRMB 3PWJB 3WNMA 1L4IA 4HKJA 1LE9B 2GW5A 4G6KL 2UYLA 1HI6A 1XF4A 5IKCA 3BQUA 3QCVL 5F89A 3MRLA 4HIHA 2LV4A 2NY4B 1ETZA 1KBGH 1EEZA 5CZKA 3STZB 1O0VA 1W8NA 1Y6MR 4PJ8C 3H42L 4Z7UE 2BVTA 5L0QB 3QDMA 2JKXA 5BOPA 2J8UE 3D2UA 2XZCL 1BVKB 3RGVC 3LD8C 3OAZK 3FB7A 4IMLB 1MI5D 3W2DL 5ICZA 4JY4A 2R29H 2G2RB 1P2CB 1G0DA 2GTWA 2R23A 1I1AA 4R3SB 1CF8L 3WL9B 1X5XA 3BFOA 4R7DA 2B5IC 2H26A 4GXVH 3QUXA 1AO7E 3B6SA 2HH0L 1C5DA 4U3HA 5TJWK 1OTTC 2VITB 1C5DB 2IEPA 3GBMH 4G8IA 4PTUB 3VE0B 5CBEB 4O2EA 2D03L 2MFNA 5C8JA 2VDRH 5ICXA 5EU4A 3UYPA 4OLEA 4OI9A 1I1AB 5I1IL 4OZHF 3LKSA 3O6KL 1AP2B 4BSWA 1BQSA 4MAYA 3W11D 1Q9OA 1WWWX 5JHLL 3KPMB 2H41A 3I6GB 3QR2A 3C6SA 2BNUB 4M1CC 3QUYC 2QQKH 5FF6A 4M7ZC 1ZVHA 3DXAD 4QHMA 1R0AH 2JJUA 2R56L 4JRYA 4PJIB 5DC0A 1NSNL 2DJSA 4NWTH 5E4EB 4OQTL 3TO4D 1QLRA 1TPXB 5L7XH 4H5SB 3TWCL 2V17L 2XWTA 5EOQH 4GRLD 4UT6H 4P23C 4I18A 1AO7B 2BNUA 1JPTL 3GFUA 5EFIB 5J7CC 4HK0A 2VO5A 3ARWA 4NT6A 3WXWH 2CRYA 4CL7A 1EFXA 3UDWA 4PBXA 2ARJB 4FQXC 2NR6D 4KMTL 3IDXH 1E4KA 5DS8A 3MNWA 1U93A 4ACPA 5SX4I 5FYKU 4BQ6A 5HBBA 1WIOA 3P9MA 2BNRD 1X5AA 1YY8A 2IANA 5AG9A 4CGTA 3BKYH 1BZ7B 4WUUD 1XGTB 3BPLC 3WFBH 4JANA 2GK0B 4M1DH 4JFPA 2F19H 3V2AR 3FT2B 4WU7A 2J88H 5EUKB 4O5LH 1IEHA 3Q1SL 3T4AB 4GG6E 3CFBA 4WFHE 3HC0B 5F3BB 1CGYA 5DEFA 5CUSH 4JHBA 2IBBA 1OWWA 4YBHA 4HSQA 4AIXA 3T3PE 3QDME 3S97C 2AI0H 5CUSL 5FYJH 1BX2A 4HAFA 4HWUA 1RK0B 1UWGL 4LDLB 4UIMA 4I0PB 4IOFD 2YD6A 1MCCA 5EA0H 4EJ1C 3ZT5A 3MBXL 3UJTH 5GGUB 5E1AB 1QTYT 1U8QB 3HKFA 3EFDL 2LU3A 4MJIB 4U3XA 1F11A 4Y4KD 2E8ZA 4MB4A 3V0AC 1KELH 1QFWL 4HDIB 5D72L 3U83A 1K8DB 1MNUL 1I85C 3HZYA 4U1NB 1CIDA 4Z7VB 2VQTA 3NPSC 4XCYA 4MCYB 4POYA 4PGJA 4PRBB 2VTFA 4G8EA 3RGVB 4XP9L 1I7RB 3LKPA 3MQIA 1P9MA 3RFZC 4B41A 5DUMH 1ND0B 5LKNA 1S7TA 4UBDD 3CH1A 2VE6B 5EZOL 1FNGB 5DJ0B 2R1XB 1NLBL 3D3VD 5BVPH 3JTTA 4UV4H 1AKJB 1LO4H 2OJEA 2V17H 5EOQL 3TWCH 5JW4Q 1CT8B 4G7VH 4F7MB 5D1XB 5B3JE 3ETBF 1NCUA 3OKNA 1NKOA 1XIWC 2ZJSL 3F7VA 4JRYE 4NO2A 5DQ9A 3HB3D 5J1TC 1NDGB 1CFTA 3F62A 2R1XA 1AD0A 5EORL 3P4NA 3VRLE 3EJYD 2FX8L 5JQHC 1K4DB 1YECH 4F3FA 1S9XA 1TQCB 4YO0A 4YHZL 4YO0B 3ARSA 4I0PA 4P2QA 5FGCE 5T1MB 5C0BA 5IBLC 3BX7C 5I1LA 2OX5A 4H0HB 4YPGB 4ERSH 4EDWL 4NQXB 3P4NB 4BSVA 3DV6B 5JUEL 4Z5RB 3VRLF 4OLXH 4GAYB 2ZCHH 3H9SA 2EEDA 2XZAH 5BRZA 1FGNL 1I9JL 5E7FA 3VDAA 1X5GA 2VR5A 3IB4A 1T1ZB 5EZIH 5DJAA 2VXTH 5CGMA 3MLRH 2R9HC 5IQ9B 4EOWH 1OW0C 4G9FD 1FL5B 3N1FC 3PABA 4PJFF 3RRQA 4Z7QE 5T3ZH 3N50A 1S9KC 1RIVL 5LXGL 5E00A 4U1LB 4FMKA 3PIQA 3G6AA 3KYAA 5LG1A 3ZYJA 4PBWD 3VJ6A 3U0WH 2FHBA 3TGXA 3DIFA 3JWOC 4O58H 3MTRA 5T1KB 4F33A 2DL2A 1D9KB 5JZ7D 2X89D 3V8CA 1MJUL 1RQ5A 1WK0A 3U4EA 4J8RA 3U48A 5C6TL 2A6KA 4M8QA 3QCVH 3QIBA 2YUZA 4O58L 4HLZG 1Y6NR 3AS2A 3MGAA 4L1HA 1JYWA 1TJGL 1G7QB 1MCIA 3SGEI 2GAZA 1ZLUH 4UT7L 2R0WL 1G7JB 1HN1A 1DBJH 3CX5J 4PJ5E 1RV6X 4KROC 1T3FA 1WZKA 3GM8A 4APQD 2V2XA 5DO2C 2XWTB 1QR4A 4XB8A 1OAYL 2XI9A 1EJOH 3MOBH 4KHTL 5GXBB 3ZKMC 3QJHB 5IW3A 1JYVA 1ZT4B 5FDWA 4KQ4H 3VWKA 3W9DA 4L8DB 4PJIA 3C60D 1Q8MA 5BZDB 4RA0C 4XC1H 2O93L 3G5YB 4N68A 3ULUF 3EOBB 3CSGA 1CDIA 3VE0A 2C3HA 3MBEA 4PP2A 1FSKB 4Y4KB 3RWFA 3LOWA 1J87A 2PTTB 2H2PD 4TN9A 3IS0X 2RAMA 4LVOB 1YPZF 3DXAB 1U93B 3P9WB 4JHAL 1A7RH 4MAYB 3QUKA 4I4WA 3U36A 3IKCA 2JIXB 3HNVH 1KGCD 5HHOB 5C8JB 3MBEB 3OAYH 4PP2B 4PP1C 4KV5F 2XY1A 5CILL 3TA3A 4JZJC 1IKNA 4P2QE 5FB8B 3MRKA 1WFOA 4LCUB 3HR6A 5ID0A 4X8JA 2BHZA 1WFUA 4JKPL 5TFSH 1JNHB 3H9ZA 1RJYA 3VXNA 4O4YL 5LAXA 4LOUC 1J88A 1P6AB 1JNLL 5B39G 1ORSA 2VLRA 3V9FA 1YEGH 2ICEB 1V3KA 2E7LC 4TSBL 2VABA 1XF4B 4TVSa 5IKCB 2YKLL 3LZFL 4JJ5A 5SWSD 2VDPH 4XRCA 2EYTB 1H3WM 1ADQL 5F7MC 4MS8C 1KB9K 4TRPH 1X5YA 3OR7B 2IG2H 2VZ3A 3SE4A 2P8PA 3Q6FA 3GIZH 1PG7L 4F7EA 4LPXA 1N2RA 1AXSA 2VQUA 4U0RC 1BFSA 4JO4H 1FAKT 2EXYC 1KPRA 3M1BB 1U3HB 2RCSL 2DF3A 2VDNH 1R3HB 5MERB 3WHE1 1NGZB 3KNBA 3SGJC 4WI9A 5GS1A 4HKBA 4JR9H 3VXRB 4OM0L 4CU6A 4C56A 3AM8C 5D2NB 1T6WA 3QAZB 1KXTB 4TQEH 3HMWL 4X6DE 3OAYK 3ZDZE 2VR4A 5IUSA 3S8WA 1QA9A 5IVZA 4RRPA 3I2CL 2RIKA 3CVIL 1GH7A 2GUOA 2Z31D 1YEKL 1ES0A 3U9PH 4NHCH 2D9CA 2WQRA 4U6TA 2GY7B 3S5LG 5GJTL 3FFDB 1QBMH 4AJ0A 1DSFL 1U8NB 3VXUE 3VWJD 4S1DD 4JFFE 1R24B 3QCTH 4M7KL 1IT9L 1OL0A 1VKXB 5J1AB 4JN1H 3BIAX 4P2RB 4XPBH 1WWAX 1JHLL 1SJEB 1GGYA 3C5ZD 1T2QH 3MLWL 4R9HA 3QXDA 4TYUA 2XY2A 5DD6A 3N1QC 5F7LB 2VAAA 4LLMA 4IRSA 4A2LA 5CP3H 3EJJX 2HJFA 4JHAH 5DD3L 1K8IA 3NTCL 1O7VA 2HT3D 2XRAH 4KKCD 3MV9B 4MSWA 4PGEA 4ODTL 5F7YC 4LSPH 5HGAB 5C09B 3Q48A 1JNNH 3MLUH 3RU8L 1JZ6A 2F53D 1MY5A 3C5ZC 3RY6C 4QTHA 4NGHH 3P0YH 4UQ2B 3OZ9H 4JM4H 3B2UD 1AXTL 5EUOB 1RZIA 1KJMB 3KWWB 4PRIA 4HK3N 4XB7A 5E4EC 3MJ7B 2VLLB 3WDJA 1IKFL 1XGUA 1DN0A 1EHAA 2WUCL 2BC4B 5LGKA 4BFEA 4S10A 4S1RH 1RUMH 1TQBC 1DBJL 2EH8H 4LPWA 3L5HA 2R0WH 5CP7B 4KGJA 5I8CA 1J0ZA 4ZOEA 5DQJB 4EXKA 3F12A 2X7LA 2VLJB 3VH8A 3IFLL 4FQ1H 4B50A 2I5YL 1JPGA 3CMOH 3FFDA 1JYXA 1KN2L 2A9NH 3A0OA 1P53A 2GT9A 1G0YR 4NQED 2WBJD 2Y6SC 3FTGA 4LKXB 4ZXBA 3WNNA 2W07A 4EI6B 3QHFH 5DRWB 1E27B 2AJVH 1YYLH 3U2SA 1D9KD 5C0AE 1UB6B 4NJ9L 3TZVB 3WIFB 2AQ3A 1G84A 4HV8A 5FYJD 1X4XA 4OB5L 1QVOA 32C2B 1BAFL 1L7IL 4ZPTB 5EFIA 3H7LA 1INDL 3U4EB 2JB5L 3R06B 5DGRA 2WBKA 4NQCE 5BZDA 1MFCH 2ARJA 2DD8L 3DI3B 5MENE 3O2DH 5E56A 5JXAH 4D3CL 4M5ZL 2YD7A 1VEOA 4PV8A 1P2CA 4BH8A 2X4TB 4MVBD 4R96A 4ERSL 3KPTA 1NBVL 4Z95H 5I71C 3N06B 3RA7H 2A6IA 1RD6A 2NY3B 3CLEH 2K3TA 4ZYKB 1FZOA 1I8IA 5LBSL 3OR6A 4ELMF 2AJSL 3C9NB 4P57A 3IXTA 3F7PC 5EU3B 4L4JA 3S9DB 4FXKA 5A2FA 2X5PA 5IW1B 1M6OB 3KPMA 3OBAA 2FO1A 1DE4B 5KSVA 1G1YA 2EDOA 2BSED 1S7RB 2A0LC 4S1DC 5J1SC 1JIBA 1NCDH 4OIIL 4TTDD 2NR6C 4IRSD 3MRHA 3RKPA 4X8JB 3VXSD 5TE6L 1F4WL 5C0BB 5T1MA 1C08B 3BH9A 3L7FA 4U1GB 4OZ4A 1ED3A 4EI5D 1H3UA 4AZ8A 5GRZA 1A7OH 3T2NL 3V5KB 3GHBH 4EN3A 1OY3B 5TPWL 3CDCA 3VXPA 1P5VA 1YNKL 3OXRA 4I4WB 4PJFA 5FKPB 4P2RD 3HE6A 5HVHC 2MCPH 4JB9H 1XF5B 4XMKH 5ICZB 4KY1L 4RBPH 3G5ZA 5HHXL 4E0RA 3DX6B 2P24B 4XP9H 1CDGA 1U3JA 1T7XA 5L2KB 1F2QA 3BKJL 3QO0A 2NTFB 1Q9LA 3FT3A 1G7LA 5B8CB 3QNZB 5E8DL 5GHWH 3EOTH 1DBBH 1LDPH 3HNSL 3LEVL 3WHXB 3HS0A 4PG2C 5DD5L 5GIRA 2PW1A 4K23H 2E9WA 2D7TH 4JY4B 2DBLL 2B5IB 2HG5A 1H5BA 2RR3A 1BFTA 5C70A 4OZGB 4XVSH 4ZXBD 5HDBE 1MLBA 1P84J 3GB7A 1F97A 5T3ZD 3AMKA 3RTQB 5GS0C 5IB5A 1FZKB 3GEWB 4JG1L 3Q3GA 1S8DA 5KVDH 2X4RA 4WGVB 5B4MD 5ENWA 3OKOA 5IBUB 1G7QA 5F7DA 1MHCA 1TQBB 4OGZA 1CFQA 1SYVB 4YE4H 3MUHL 2AK4E 3ZTJH 1T03H 2YSSB 4HFWB 4M1DL 4WI5A 3UZQA 5TQ2H 1G7MA 5TGBA 2GTZA 2P45B 4RIRA 4UZGA 1LNUA 1L9MA 3REVB 3Q3GB 3O9WB 2OSLA 1EAPA 5HDQL 3DWTA 3VI4F 1DFBL 4QNPF 5T3XD 4AENB 4HC1A 4OKVA 3HRZA 3VFOB 2QQLL 3RZCC 2D7QA 3QPQC 4C55A 5FYJE 1GGBH 2DLGA 4GRMB 4M43H 2PO6D 5DJDB 4CAGA 5F6HI 5J6GB 3ZE0E 1NGPL 4FQCL 2ED8A 3O3BB 4CN1A 4QRRE 3RVWC 3ZT6A 4PB9L 1B0GA 3H7BB 4M1GL 4DVBB 3MV8B 1JK8B 1U3HA 4NUJB 4Z7OF 5BV7B 1M7IA 1BWWA 1JPTH 5HVFB 1BHGA 2P5ED 1MCPH 2FJGA 3O41A 1MHHA 3STLA 5D2LA 3TN0B 3MRNB 3UTSD 3S7GA 2DQGL 1CGVA 1HHHB 5J06A 2Y9RT 3AY4C 3GJEB 2X4NA 3V7MA 4QRQA 5JW4R 4KI1A 1HQRB 1MUJB 3O6FA 5DA4A 2ZOKB 3IFOB 3HZKB 1ORQA 4Y2DD 3F65A 3BESR 1EXUA 3B5GA 1KIUA 3RTQA 3BEVA 3G08B 1AQKL 4ONFH 1EUUA 1X5HA 2Y25A 4B0MM 5KSAB 4LEOB 4KTDH 2K7PA 3K80A 4YWGL 4OCSL 1RJYB 3UZEA 1JZ2A 2AABH 4FABL 2EECA 4KK6D 4OV6F 5CFHA 1RURH 2EDWA 5B22A 3TIEB 4HPOH 3T3MF 1RULL 1CICA 3NCMA 5D1ZC 2FWOA 4X6DA 3PWPE 4QHUB 2QLVB 4LAQH 1CLOH 4U1SA 3MZGB 1HEZB 3MJ6A 2HH0H 2IANB 1AH1A 1RK0A 3IDMA 1BX2B 5E2WL 3KPRB 4FZ8H 3UAJD 2YD1A 3RPIA 5TE7L 2BSRB 1H15A 1JRHL 2OBGA 2VKWA 3ZDYF 1MWAH 3FRUB 2CKBA 5FYKL 5F72S 2ADIA 4WDIA 4X9FA 4L8CA 4ZSOE 1S5IH 3U30C 1WBYB 3B83A 4YHOL 4CMMA 1SJVA 4JQIH 4PJXE 2ZKHL 5FA3A 3SDAD 1QSEE 1C1EL 1N8ZA 1ONQA 3GMNA 3PP4H 4YH6A 1KB5A 4R4ND 2BSSA 3O11B 1XR9B 4PJ9D 4OM1L 4G6ML 4WO4B 1KBGL 5IFJA 1HYSD 5DGQA 1CU4L 1J0YA 5E94A 4E41A 3W81A 3CFJB 5I19H 5GZND 2IBZY 1UXWA 1ZHNA 3EO0A 1LMKA 3PWNA 4CW1A 1SYSA 2E6PA 1U2HA 4LKXA 4ZXBB 4LVNB 2GT9B 4TULH 3VFMB 4GLRI 4U1MB 4L3EA 3BN9C 2WIIA 3FL7A 2ZOLB 5D1QB 3SGDI 4U7KA 1LO2H 2ZOLA 5D1QA 1E4XL 2YPVH 3FRPG 4LLYB 4U6VL 4EIGB 4CVUA 1UA6H 2HJLA 4P4KA 1DQDL 3MUGA 4Y19A 5D1ZB 4MA7H 2Q6WA 4JY5L 1ZTXH 4NJAL 4HCRH 3VGDA 4N8CH 3E6HA 4JY6A 2V5RA 2X4PB 4ZUVB 4QXWA 1TLKA 4JDTL 3TYGL 5I6XC 5T1LA 4YHNB 1BREA 5IBLD 3O45B 2HJKB 2WBJA 5IP4A 4PV9A 2XG5A 1IM9A 5CSGA 1MRDL 5ISZA 2IBGA 2HWZH 4LNVA 4X5WB 4URTB 4OZIE 1AC6A 2ZCLH 4LHJB 2Q8AL 1VB9A 4HH9B 4NNXB 1ZS8B 1FN4B 3K2UH 4D8PB 2K1MA 1NMAH 3FB6A 3LN5B 4JQXC 3U6RA 3NAAL 4WNQA 4ALAL 4OLWH 1IGIH 3WJJC 4ZFGL 5CP7A 2WZPD 1NKRA 2VJXA 3B9KC 3LPGA 4U1IA 3WLBA 3BP5A 4U7SA 2W0FA 3REWB 3L7EA 2EKJA 3PWJA 5TF0A 2HFTA 3V0WL 2OR9H 4U7MA 4Y2DB 3WUZA 5ACLA 4NP4H 3KJ4B 4HS6B 3MGTA 3O3DB 2CPCA 4XPTH 2C4FT 2HA1A 1CXLA 5HGBA 4FXGA 5GSVB 4CUCA 3OWEA 4D3CH 5FECA 1FPTH 4TUKH 5I8CB 1PY9A 2CJUH 5IVXB 4JGMA 2GJ6D 2BY1A 4MDJB 4MNHB 4R0LA 1A6WH 1T04A 3TJHD 4QF1A 3VRIB 4N9GB 1FFNA 1FL6A 1KNOB 3F5WA 2VXSH 5DR5H 4OZFA 4C57C 3VFNA 2FR4A 2ZPKL 2FL5B 1LD9A 4FRWA 3WDIA 3VGAB 4MCZA 3R0NA 1HH6B 4PJCA 4PJGF 1AY1L 3M8OL 1LK2B 1M71A 3BZFA 3NPSB 3RGVA 5KJRL 1F6AB 1C16B 5KZCB 4KJYB 1N3NA 4XC3L 3TNNB 2R2BA 3VD5A 1GXEA 1FFOB 5FHAL 1CD9B 4JQXA 3ZDXE 2OTPA 4X7FC 3OL2A 4MDJA 5A3IC 2NXYB 1KENL 3NN8A 4JRXB 5FO7A 4BFIA 2ZCKL 4FS0A 1YMHA 2MKWA 1HKFA 3LRSA 1T0MB 4YHPA 3TVMB 4BQCA 2Q7YA 3DRQB 3QIWD 3PHQA 3STZA 4DAGL 5EOCJ 4PRNB 4WFGE 1WBZB 1A7NH 2VN7A 3UC0L 2AJZA 3IAPA 4X8XA 4P9HC 3BP5B 1E4WH 1FV1A 3GI9H 5H37H 1MQKH 2ICEA 3LB6C 3RY4A 4HPOL 3JUYA 1X4YA 1IC4L 1FVEA 3X3FH 3IXAA 2ARWA 3CAFA 1XIWB 2A6DB 1LNUB 3C2SA 3FFCB 4JO2H 5TH2B 5D1XC 1JNHA 3FZUC 1FO0H 2EH7L 3LDBB 2H8PA 3CDFA 1VCAA 1KTLB 5I73B 1T1XA 1C7SA 3HN3A 3QULB 4LPTA 3LS4L 4M6NL 3P2TA 4HHAA 2ESVB 4XGZB 1U42A 4FQIH 1NC2A 5F9WB 2DQFA 3GIVB 1K2DB 4RBPK 1LHZA 4A2MA 3FQNA 4OBRA 1V7ML 4ZUUA 4WEMB 4P46C 5ILTH 3NOIA 4NM8H 3IYLW 3KPNB 2A6JB 4Y4FB 1QLFA 3LS4H 4M6NH 3WS6C 2VERN 3MLYH 3QG7H 5IESL 2DQCL 4MJ6B 4P23B 4WTZG 4X0KA 1FC1A 1OF2A 3QEUB 1N2RB 2CRZA 1QSFE 2DLFH 3PHOA 5F9JA 1D6VL 4ZUTA 4JLRA 1NGPH 4HG4K 1OVZA 1YPZB 1BIIA 4M43L 1ZA3A 1UWXK 4RNRB 1BEYL 1QRND 3AB0C 2XQYK 4M7LL 1E4WL 3TBYA 1WISA 4D0DB 1UZ6F 1SYSB 4XCCL 4MA8L 3QZWA 2NW3A 5IF0B 1VFAA 2OCFD 3I3BA 4U2ZA 3SN6N 5JZ7C 3TA3B 3MX0A 1O5DT 4LLAA 1BFVH 3RVTD 4XH2B 5JHDD 1N5YL 1RUQL 2CDFA 2Q20A 3OPZH 2BFVH 1HILA 5E8PB 4HXAH 5I1DB 2DQEH 5SWZE 1PSKH 1CICC 1U8MB 2V5TA 1CZ8H 1E0OB 1U58A 1LO5B 3JV4B 1NANH 5DK3A 1N64H 2WUBH 5F1NB 1YY9D 3UX9B 4XVSL 2PYEA 3QEGL 4F58H 4FP8H 5I75C 4PRHE 4Y4FC 4WU5B 4Q9RL 5IM7B 4ELME 4J3TA 1S7QA 4PD4J 4KKLD 1OM3H 5MEQB 1I1CA 4NQEB 4ONGL 1UH2A 3X14B 1MRFH 3RNKB 1S9YA 4LF3A 3SO3C 4I77H 4YBQC 1HK6A 4I0KA 2ADJA 3G5XB 3IDGA 3KPNA 3BQUC 3MXWH 1G7IB 5TDPB 5C08E 1QP1A 4PRAB 4QRUA 1DBBL 3ZLQC 3KPRA 1CICD 4MDIB 5J13B 4PRDB 1TVHB 1BM3H 1BVKA 3KYMB 3E6FB 1F4YH 1N59B 3QCUH 1FPTL 1OARH 3VU2A 3GMPA 3LZFH 3IKKA 3ARGA 1UH4A 1U9KA 4DQOL 1Q0YH 4ZTPH 4PJ9C 4RAUB 3JWDC 4WHCA 4X4XA 4HWEH 3DARA 1J1XL 3C8KB 4K3DL 5DD0L 3UBXB 3U0PA 5TDOA 5IMLA 5INDB 3KS0H 4GKSB 3GM0A 3MV8E 4XX1E 2WLZA 5DK0A 4LDEB 3GSQB 3OKYA 4WTWA 4XP6H 1U91B 4ORGA 3QH3B 3U4AA 3RVUD 3KHOA 2G60L 3HZKA 4CVXB 1NAMB 1IAOA 1PYWA 4S1SH 3RZCA 1J8HA 3BT2H 3OAUH 4Y16C 1A0QL 3SKJH 1B0RB 3SBWA 3MA7A 4AIZA 1FE8L 4RISL 5JA9A 5F6HJ 1JPGB 4FQPA 3U1SL 4LGPB 2AJXH 3UBXG 4EN3C 3J8F7 1YYMH 2WBJC 4PJBB 1RJZA 3PP3H 3RA7L 1A7QL 1U3ZA 2H32B 2J1KA 3ULUL 4WJ5B 5D7LA 4U1LA 1NJ9A 2VE6A 4BSVB 4YEFA 5AZEH 5I8OH 3IJHB 5HPOA 2EKSA 3NFPA 5I15H 4M6OL 5I2IB 1ZLVK 3BVNA 4JVWA 2C5DC 4JFXA 1Q1JH 4J4PC 4U6VH 4MQTB 4GXUM 5ACZA 5CEZE 3QWQB 4MCYA 1JN6B 5JOFA 4NM4L 2GYSA 2Q7YB 1DEEB 1LWRA 2BNQE 4K94C 5DJ6B 2XT1B 2BVQB 1ZHBB 4LEXL 2B0SL 1Q94B 4JHWH 3BH8B 3LS5L 1PEWA 1T7VA 3TBTB 1JWUA 4X6FB 5GS2H 5GGRA 4HIEB 4DKEL 2FYYA 1U3YA 2IADA 4MGXA 2R2EA 1KYOJ 1PG7W 5JIIA 4KJPD 3HE6C 3X13A 4JFED 3EO1B 4BH7A 1FCCA 4KMQA 1F4XL 2IH1A 2A9NL 1KN2H 4KTEL 4HC1H 1NFIB 4N0CD 1MI5B 1BZ9A 3CDGB 3V5DB 2IADB 1RK1B 3WNOA 3QFJD 4L8SA 3BAEH 4XCEB 2FIKB 3SDDB 3CSBA 3L3IA 1S7WA 5JHDB 3N9GH 1EJ6A 4R26H 1R5VB 3S35H 2R9HD 3D69A 2HFFB 1JRHH 2GKIA 1Q72H 3AU1A 3SKNA 1T1YB 4I2XE 4WW2F 1MHEA 1PZUB 5F8QC 1JUFA 1F42A 3QI9A 1AE6L 4L8BB 5DUPH 3LMJL 1IGYA 2DLTA 3BN9D 3OXRB 1DQQB 4P5MA 2PTVA 3LQZA 5JW3H 5I2IA 4KKCC 3LKOA 2VL5A 1YMME 4LAQL 3NACH 3VFNB 2D31B 5A2LH 1P84K 3V6OC 1BQLH 2EDXA 3I6LE 4FQJH 4MJIE 3PWUA 4I3RL 2CDEB 5FHBH 5HGDB 1EA9C 4ODTH 3EOYG 1VHPA 3MUJA 2Q86A 1CQKA 3AREC 1UB5A 1KYOK 4XHJC 2JJSC 1MLCB 4NFBA 4N90E 1QYGH 3PQYB 3VFTA 4ONFL 3QXAA 2QSVA 5DJXA 3THML 3MRIB 4JANB 4OFYA 1JHLH 4JDVB 5GRXG 5HYSB 4XBPA 1GHFL 4JKLA 4QRRB 3MRRA 2E27L 1FJ1A 3OR6B 1CCZA 4ZAKB 4DN4L 4N5ED 4XH2A 2VDLL 4XRCB 4LRNH 5EN2A 5DWUL 3SGKA 3IU4L 1RIUH 1D3CA 3QYCA 1Z6JT 3QIWA 3KYKH 4QXUL 4I9WD 1FZJA 1WC7A 1HE7A 2D4FA 1CXHA 1DR9A 4X7TB 5DJXB 3AREA 3DJ9A 2Z93B 4WHYG 1MCDA 3ZE1F 5T3XH 3S5LA 4I3RH 3I2CH 1RAMA 4QTIL 1T5WB 4PJEF 3EJZC 4LHUD 3B9KB 3IAQA 4Y5XB 2DI8A 3QUML 1EO7A 2AEPH 3JWNC 4MZ3A 4KUCD 4EUPH 3KPSB 3ARDA 4TUOB 3WLWD 3KYMA 4YNYB 3AREB 2APXA 5DQDH 1HXYB 1MI5E 2Q3AA 3FB7B 3S6CA 1J8HD 5GZOC 3UTQB 5TQ2L 3L6FA 5HYIA 1PG7H 3DXAA 5F6IC 1OD7A 3ESUF 3QUZD 1BF2A 2A1WH 3M45A 5TF1H 4Y5YB 2ZG3A 2CLRA 4NRYB 2AI0L 3ECBA 4F9LC 2E9IA 1AFVL 4HGWA 4F8TA 1U8MA 5C09E 1RFDH 3FONB 4HIXH 5A43C 5I1EH 2FLBT 5EN2B 2ICWI 4JFHD 4ZAKA 3NIFF 3EO0B 1MFBL 2L0DA 4PJAE 4S11A 4DFHA 4DKEH 1FDLL 3GBNH 3S3PA 1A1MB 5E9DB 5CEZD 3D9AH 4IMKA 3QZWB 4TVPH 2ZUVA 5KVMC 2B0SH 4JHWL 5ICXB 3QI9D 2OXGA 4R7NB 4ODXA 5E2JA 1RZGA 1R3LA 5FOBA 4PYGA 1G6RB 3GJEA 3VW3H 1T4KB 1KTDA 1MCSA 4O02H 3GMQA 5SWZD 1M7DB 3ORJA 3HNVL 2B4CL 2DIJA 3GSXB 3QEQA 3QDJA 5FA3B 4KDTC 1EXUB 4XVTH 1ZLVH 5EU6D 3T2NH 4JFXB 1KIRB 2CKBB 2HFEB 2FCBA 1DUZA 2OQJA 4KC3B 4GKZA 5HVWA 4Y8AA 1CGWA 2AJXL 3QEQB 1KCLA 4ZQKB 3IDMB 2AXFA 2FJGB 3MLVH 4WUUE 3UO1H 2VC2H 1E6JH 3IFNL 1MIML 5KVGH 2HT4C 3I6KA 4NOFA 5F9OH 2DM7A 4PB0L 4OIAA 2GUOB 2IH1B 1IAOB 1RIHL 5IVNA 1NMCB 3ZE2F 4JRYD 4RGND 3LRHA 1NBYB 3O2DL 5JLZA 1BD2E 3BEVB 1QSEB 4N1HB 1U8JA 2BERA 2EYSA 1M1SA 2FEEL 5DK0B 3RIAK 5B3JF 1LGVA 1PQZA 3BVNB 4DCQB 4NN7B 4P59H 1KEGL 3RBSA 3O9WD 3DSFL 3MLTB 2R0KH 5I6XB 3NH7H 4GG8B 2MPAH 1R3IH 1OTTD 1Y0LA 5KSAC 1K85A 4M3KB 1GPOL 4OLZL 5SX5K 2LVCA 1UM6L 2BOBB 1IM3B 3PNWB 1N5AA 5EC2B 5BZWB 3MXWL 3WO3B 3IF1B 4NJ9H 4V2CB 4F7MA 2DDQH 1DQJB 3DUUA 5EOCH 4P4RA 4RRPG 3RJQB 3QQ3B 3LH2L 3VG9B 2R8SL 3DSNA 3VDCA 2VYRE 1GOGA 2Z8SA 5D7IA 1U6AL 4ZXBC 4P2QD 4KRPC 1I9JH 1NFDE 3CMOL 2I5YH 1MCJA 2R0LL 3MROB 3VFVA 2IC2A 1S7XA 2X05A 5DURD 1UT9A 3K46A 4WEUD 5B4MC 4HXAL 3TBVB 1U92B 4AT6A 3X12A 5I1AB 1FYTA 4YAQB 4AIZB 2MQ0A 1Z3GH 4DUWA 3JSSA 2V2TA 4NDMA 2F54B 1ZLSL 3RZCB 3PGCA 3PWVB 5B38B 3QIWB 1DE4A 4UQ3A 5IHUL 5JOPE 4OZ4B 3UO1L 2AXJA 3NABH 4GBXC 4XCCH 1AD9A 2X42A 3DX7A 1CD8A 2X1PA 3WDHA 3GSQA 1PY4A 2MSPA 5FUOH 2YRLA 5C0CD 1T2XA 4M5YH 3QDJD 2WP3T 1Y18A 2DKMA 3C5ZA 4GG6B 1NCAL 5KZCD 4HK3J 1JNNL 2J8UA 2XYCA 3GNMH 3WNLA 1UKSA 4U6XA 4F57H 1DN2A 1KB5H 1A7PL 4HF5H 4Q6YA 3KPSA 3PL6B 4RQQA 1HSBA 3HUJE 4WWKA 2JJVA 1G9MC 3QNZA 2OZ4L 4UV4L 4L8DA 5CEZH 4X5WA 4NYLB 4P46A 3O2WL 4PJGA 1ONQB 5FM5O 1I9RH 5H94B 1MCLA 2D31A 1HXYA 1CFBA 3EHBD 4M7KH 1U8IA 4QOKE 5J9PA 1NL0L 1JUFB 2WV3A 1XGRB 4MQSB 3QI9C 1YDPA 2NYYD 3TV3L 4Q6IC 3MO1B 3BD5A 3C6LD 3L7FB 4L4TE 3H9SE 4NQVB 4NZTH 5BXFB 3FFCD 2FD6H 4GKSA 4TSAH 3RGHA 4LGSB 5I1EL 1A3LL 3CFIC 1MWAB 4NRZA 3B2UC 3E0GA 4GRLB 3IGAA 1NGXA 2Y36L 3H9YA 1NEZB 3BMWA 3X3FL 3A67L 5ADPH 3BIKB 5ESQB 4U1MA 3KPPA 3MO1A 4PJIE 2XXMB 3BDYL 4RGNC 3MRDB 2XXCB 3PWPD 4TSCH 5C0BD 4IJ3C 3HAEG 3RNQA 2CLZB 4W68A 1AHWC 2A74A 1RZ7H 4Y4HB 2KZWA 4IOIB 4WI2A 2YC1B 2YPLA 3I02B 1HDMB 4JPVH 3O8XB 1WBZA 2AEQL 4HZLA 1Q38A 3H0TA 3TA3D 4D9QE 1M4KA 1I7UA 2ZCKH 3D39E 3DETC 4WWKB 1FIEA 1IJ9A 4K9EC 2F5BL 4CMHC 3R06A 3C6LC 1QHPA 3QEUA 1OF2B 3BSZH 4KMTH 5ALCH 4YX2L 4OZGF 1UCBH 2B2XL 3TNMA 4U1JA 3ESVF 2VDPL 1NAML 1IAIL 1WT5A 4NUJA 4XPAH 1HH6A 2R23B 3P11L 3CXHK 2VLME 5EUOA 1Y6KR 4RFEB 4OGYH 2AS5M 1KEML 2DTMH 1BBDL 1DVFB 2VN4A 3HNTH 4JO1H 5DTFA 3VFWB 3QIUB 4KK8C 4PLNC 2P46B 2WBWB 4O2FB 3AMLA 4OIBA 1TZHA 4PJ5D 2AJUL 3LHPH 4PJDA 5BJTA 2AJ3A 4G8GB 3MYJB 5F97E 4RNRA 1IKNC 2DMKA 3FFCA 2JIXD 2QQKL 2A6DA 2IQ9H 4KMLB 4NKOB 5JIHA 5DUBA 3CPLB 4NNYB 3QIUA 3DXAE 4EKXA 3PGDB 1FV1B 3U46B 3OKOB 3M07A 3CC5B 4WCYH 2QADD 3QRGH 1TETL 1NMAL 5CZVH 2W1NA 1MCHA 1U8KA 4YDKL 5I30L 5DVMA 1YEHL 3DNKA 2X89A 3O6FB 2YRPA 5DHYA 4FQHA 3QDJB 5D7KD 1IM3A 3PNWA 3JWOL 3HE6D 3AU1B 4U1NA 3SKNB 3ARBA 3HTLX 5IV2B 3QA3B 4LKCB 1CF8H 4X4ME 5D2LB 1P4BH 4PJ8B 4LARL 1CXEA 5E8OA 3P4MA 5ANMB 1WFNA 2VLJD 1CL7L 1JPST 4WW1A 1B0GB 3ES6A 2DJ4A 2ATKA 5BJTB 3IDGB 3I9GL 1E4KC 3WXVL 2OI9B 3GSWB 5IQ7L 1MCFA 1QFPA 3V5HA 4JFFA 1Z9MA 3MV01 4UTAL 5E6IC 4P4KC 1DQDH 5BOZG 1FC2D 1ZSDA 2IF7A 2VISA 1C12A 4PJBE 5I66B 5LQBL 4N1EA 5IJKA 3FONA 4CADB 3FQTB 5C0CE 3ZT7A 4WU7B 3WSQH 4UAOC 5LWYL 3VGFA 2HFGL 1XEDA 5GGSA 4ELKB 4Y2DA 1UACL 2EYTA 3O4OB 4HGMA 5HYJB 4NO0A 4F80A 5ETUA 3ARGB 4B7IA 1DEDA 1FORH 4G6AD 4XWGH 1N6UA 4X6CE 4F8QA 5I8KH 5F7KC 3RUGE 3OG6B 4QEGA 3E6FA 3W9EA 1GZQA 3GSOB 1T89A 4OM1H 4PJDF 4QRPA 4YHNA 5T1LB 3CX2A 5F1SA 1FBIH 5IFJB 1NJ9B 3DMMC 3X14A 1YUHA 3GO1L 4HUKB 5ALBH 1BPVA 5GSRB 5I8OL 3CSYA 4DUVA 1AO7A 1G9MH 4OTXH 1FZMA 4Y1AB 2HYMA 1N0XL 1FAIH 5HI3C 1NC4A 4L9DA 3T77A 4F7EB 5SWQA 3ULSB 1DBKH 5C0CB 5AAMA 2FGWH 3QUXC 4JZNB 1B0RA 4P99A 4PLKD 4PRHB 3P40A 1K4CB 2DM2A 2ADJB 5CS7A 4J3OC 5JPNB 4HT1H 1KCVL 3C5JA 1HCFX 4XPGL 5F70A 1J8HB 4GSDH 1OAXH 2YBRA 3BT2L 3OAUL 4CW1B 3L7EB 3RDTC 2F53B 3RWGA 2G75A 5D1ZA 4IRJD 4PJCE 1FLRL 3LB6D 4JFFD 3BGAA 4M62L 4ORGB 3WYRA 4YDKH 1J18A 1OB1A 1WV7T 4KAQL 4G7YH 2ZJSH 3RWCA 1K3IA 1A5FL 4NC1C 2AABL 1MVFA 5HI4C 3U7WL 1OOAA 5DEZA 4J7RA 5EPMA 3H9HA 5GZOD 5J13C 2KQNA 1U92A 4AT6B 2YWYA 3IDIA 1QR1A 1CFVH 5F88A 1NLBH 5EOTA 5BVPL 1EZVY 5EZOH 1ZHLA 3VMPA 1KLUA 4F7CA 2A6KB 5ISZB 4JFYB 1BGXL 1T3FB 4I3SL 4F7TA 3OJDB 4G80A 4X7SL 3LHPL 3PHSA 3A6CH 4M61B 4YHMH 4ZSOB 3OTTA 3RWDB 1A21A 1IFHH 3GMMB 3T0XA 5I75B 4QRRD 1BM3L 2P5EE 5EH1A 5GJSL 3QI9B 3QPXH 3UTPD 1JGDB 4MWFB 2ZP0T 1G7HA 5IEKB 3BKML 2IH3A 1QFWH 5BZWA 3ULVC 4JM2F 2CSPA 3KJ6H 3FQNB 3CVHB 3OQ3B 4K2UH 3LIZH 4NSKA 3TVMA 1B88A 4Y4KA 1D6EA 4XPAL 2DQHL 5JW4M 4PB9H 4U6XB 4Q9RH 4FTVD 5A2IH 4FP8L 2W9LA 4Y4FA 5C0BE 5C92A 3OJVC 2F54A 2R2BB 1J1OH 1JBJA 4UU9A 1N3NB 2NY3D 5CIPH 4XNQB 1VEPA 3TN0C 5E00B 5K33A 3BGMB 2NCMA 1GOFA 4W4NA 5EG6C 4K8RL 3CZJA 4G9FB 4U6YA 1DLHB 4LSTL 4WWKD 3Q1SH 1U8OB 3ILPA 4EIZC 2J8OA 4P23D 1Q9WB 4IHOA 5KG9B 2XICA 3CGTA 5CHNB 3UJIH 2IPKB 4Y16D 2V7HA 4UT9L 2UV3A 1SVCP 4LSUH 1HYSC 2IJ0C 2XPGB 5DXWA 1PFCA 5ESAB 1X44A 5DA0B 3MV7E 5ADPL 4HS6A 1HHGA 2PXYA 2VIRA 5D9SA 2EDYA 3T1FA 1ACYL 2XQBH 4ISVB 2KKQA 3QHTC 4N0RA 5BMFL 3U30B 5AD0B 4HMCA 8FABA 4DVBA 4GT7A 2XG4A 4R2GB 4FFVD 4ODVH 4F2MA 3BZFB 4DEPB 1MHEB 1XFPA 2OTUB 4AM0B 1VENA 5D7LB 1TVBB 1S78D 4HJGB 5E7BA 1H3TA 2PW1B 1YNLH 4MXWL 4ZD3L 1N5AB 5EC2A 5GIRB 4GW5A 1YY9C 3WJLC 4PLOB 5D9SB 4C56E 2RGSA 2Q87A 5DJAB 3BRGC 2EIZA 5EU7E 3DVNB 3G6JA 5EBLB 5T33L 4K3HA 4K71C 2AVGA 3QFJE 1IGTA 2R4RH 4ODHH 3DX8A 5GISH 2P8PB 4MQXC 4OCYL 1JI1A 5E5MB 1LO3L 3L3OB 4KUCF 1A5FH 5I17B 2VZSA 4NKQB 5ABDE 4ETYA 4MYWB 3B9VA 4LFHG 5HTSA 3B9DA 3UZVB 5IVXE 4UNTA 4XMLH 1IMHC 2WQ8A 4FQLL 5J6HA 4PRID 3CSPA 5GSVA 3QXUA 4DK3A 1BJ1H 5IHUH 4X6BA 2XFXA 1II4E 5D1QC 3CFKA 5KSBB 3VXNB 3HZMB 4IIQC 5KSUA 4IRJC 1GYAA 1KC5L 2VLKA 2AJ3B 3BN3B 2AJSH 5LBSH 1DBKL 3WUWA 5F96H 2IAMC 1P7QB 3UPCA 4F7PB 2W60A 1NCTA 3MV8A 4P48A 3UTQA 3VXTA 2W91A 2NMSA 1TCRB 3SDXE 3DUSB 4PJAF 4RZCB 5HHMD 1IGCL 5IROA 5CZXD 1RSFA 12E8H 4GRMA 4TUOA 1PAMA 1UWEH 1MREH 5IJKC 4PRPE 1NCBH 4G8EB 4J3SA 4PP1D 4NT6B 5FUCE 1QEWA 4CVWA 5I9QB 1MJ7H 1T5WA 3RVXC 1KTDB 3LH2H 3SKUD 4QHLA 2ITDB 5I16A 1A2YB 1YA5A 2I60L 4NKIL 3IDJB 5K59F 3DMMB 3MOAH 5CJQH 1UM6H 3KYNA 5LWYH 2CO7B 4ZUSA 4LMQE 4XPTL 1C5CL 1LVEA 3VXRD 4OCRH 3LVEA 3AC0A 3BKCL 5F96L 5FF6B 3SDYH 5JXED 4PLJC 2Q7NA 2KPNA 1WVZA 3DYOA 2HTKC 3B5HA 5INDA 3TBYB 3J7HA 2YZ8A 5I74B 3U0PB 5L9DL 3IFLH 4NCC2 1EFXD 2HLAB 3ELAT 1CFSB 3KYNB 5IQ7H 1BZQK 2HLAA 3VGEA 5EU6E 1XR8A 1KPVB 2X70A 2NY2D 3V4VH 2X9YA 1FGVH 2Q8AH 4QHNA 5MENB 4H25B 2VXUH 3BHBB 4QRTB 1EX0A 5DHVH 1MIMH 4JGJA 4XZUA 3VXMD 1IGJB 5KVGL 3G5XA 2VC2L 4JFEB 2BP3A 1S9YB 4LF3B 2FJHA 2N7AA 4HUUA 1QVOB 1HHJB 1GGTA 2NNAB 4ODHL 5F7FA 2NNAA 3TH2T 1W2KT 4KQ3L 4UMGA 1BWMA 3C09C 3RWEA 2ILLA 4PS4L 1UCTA 2VDKL 5E4IA 4LSPL 4ZFFA 3QB7C 1LP9F 3HMXA 3QRGL 4OQ1A 4NNPH 5C0NC 1NUFA 1ZTXL 4ZD3H 2NZ9C 1M7IB 2NLJB 2NY0C 4L9LB 1VESA 5CP3A 5CJBA 4GBXA 3PL6D 4WV1A 4BFBD 1N26A 1IGMH 1RUAL 4P5KA 5FO9B 3VW3L 2Z92B 2X4UB 3IXTB 4NZRH 2OL3L 3GSWA 5ANME 1KIQB 4WEBH 4EUPB 4RMSA 2UVFA 4HUNB 4HIEA 4NQEE 3O2VL 2GAZB 2GSGA 4ZAKC 1MFBH 3QRFM 4KJQD 5BW7A 2H1PL 5DHVA 1FO0B 3Q5TA 4JCMA 2Z0BA 2GHWB 1AHWA 3KXFA 4Y2OA 1NDGA 4DTGH 1V5JA 1CDBA 3FQWB 2EC8A 2QQNL 1J0KA 4WFFE 1C1EH 1WBYA 1TTUA 3GJFK 2EE6A 3NFPB 2P48B 4LNRB 2JELL 4JFOA 1MH5B 1WIUA 4HUWB 1KNOA 3QWRA 1PX4A 4P4RB 3RL2B 4JO4L 3LKRA 2WANA 5TE7H 5T1KD 3BEWA 2R1YA 4N0UE 1BF8A 5EUOF 4TRPL 3C87A 3HZYB 4G43B 3MRBB 4KVCL 3TBTA 2HRLA 1TZHB 2Z91B 4NO3A 1UEMA 4U6HA 1PD6A 4FABH 5F9WC 4I3SH 2OM5A 4YUEH 2XWBA 3SDCC 4OCSH 2BC4A 1SY6A 1S7VB 2X4RB 4X9HA 4NCDA 1QOKA 4BK5A 3KAAA 3BRFA 4O4YH 1EBPA 2O5YH 1DLFH 1TNMA 4X80L 3IVKB 4G9FA 3FAXA 4Y88A 5ESAA 1LEKA 4U1HB 3GI8L 3IU4H 3FZUD 5LVEA 4NNXA 1QKZH 2XN9E 3QFJB 3D0VB 3O6FC 4X6EB 4WGWB 4M62H 1RJZB 1WZ1L 1YEIL 1RHFA 5GGVL 4IEFB 2BZDA 4D94A 5IW1A 3TNNA 4GSDL 1Z0NA 1NCCH 1C16A 4LCWB 3ULVH 3TPUB 2NY4D 4MA1C 4KU1A 2NW2B 4MJ5B 1KCVH 4RWHA 2J6EL 3IJHA 5C6WH 1TPXC 4IOIA 3MLZH 4BZ2H 4HUWA 1I7ZB 5EU5B 4BQ8A 5FGSA 1BOGA 1YJDL 3C09B 4HKXA 5JOPD 2NXYC 3EOAB 2OR7A 5FUOL 4EDXA 4NRXA 4KRNA 3LN4B 3PUCA 1X4ZA 2XTJE 1WAAA 1WCQA 2QKIA 4HLJA 3ISWA 3VWKB 3PL6C 1VFBA 3ULUC 3EYQD 3VGAC 4LSRL 2BK8A 3RWIA 1CFQB 4MD4A 4LHUG 1CD1A 5HXMA 1G9NL 2N4IA 4GS7C 5HHME 3UTOA 3QISA 1YDPB 1MJJA 2ZZUT 3OGOE 4A6YL 3TO2A 1XGRA 4OJFH 2VXVL 4FXKB 2ITCA 5HHQA 1TJGH 2ZUTA 5DMIL 1KJ2B 5C0IB 3VFSA 5B8CC 4NQDD 3BPCA 3LPWA 3ZYOA 1YPZA 3CFBB 1ZHKB 3LKSB 2DWDA 5ID0B 5DFTA 5K9QI 3FHQA 4MHHG 4XTRC 5I8EA 1PDKA 5C0DA 3PF2A 4K23L 1P4LB 2XTJC 1I4FA 5HVHB 5J3HC 3EDDA 3U4BH 3U0WL 3MODL 4MJ6A 2IPUG 4AEHL 5KAQG 3W9DB 1RU9H 5HDLA 3EYQC 1QUNA 3QDMD 4OCLC 4HWZB 2MKLC 3FN0H 3RWEB 1MAKA 1XF5A 2QADC 2CDFB 5C3TA 3MA9L 3SQBA 1EVTC 4KY1H 5HHXH 3WFCH 1KJVA 5DJ2A 4JZNA 2RB8A 2CGRH 2P5WD 4GAGH 1LEGA 4L5FH 2F74A 4W6YB 3WEXA 3N1PC 1D5BA 1HWGB 3CDYA 5I15L 3HC4L 4LHUA 5HYJE 1T5XB 2ZNWA 4K3EH 4XX1G 4FQ2L 1T21B 1HHIB 1NLDH 1X5JA 4C54A 2VH5H 4L3AA 3SDAA 5IJVB 2VAJA 4U49A 1XGPA 4CU7A 1XR8B 4OI8A 3BYYA 4HWBH 1YYML 5C2BH 4YHZH 2D7PA 5I1HH 5DQJA 3EW3B 4JFEE 5F9OL 4KK9C 5KTEL 2A73B 3R0MA 1MJJB 5B21A 1RPQA 3R1GL 4LLVA 2GY5A 2W9DL 5JO5B 3MJ9A 1TDQA 5ITFB 5K9KB 2CIIB 1NFDA 3L3HB 4JHZA 3OJ2C 1JGLL 4YFLI 5HDBF 4NQSA 3MV9D 2X7LB 3WMSA 4HJJH 4R90L 1JV5B 4YHKL 2BOBA 4ZPVA 3MLPA 1HH9B 3AB0B 1U41A 1XCQA 4JO1L 3HNTL 4HBCH 1MFEH 1C12B 5D7JA 2O26U 1EUTA 1HSAB 1NCWH 1FZMB 1MVUB 4MQ7A 3ZL4H 2AK4D 1ZWIB 5F7NC 4PRHD 5HHPA 3CXHJ 3DTXB 1CDCA 3QIWC 3PP3K 4MAUL 4YIQB 4NQXA 1DCLA 1S7TB 4WW1B 3GSOA 1DQLL 4QNPE 2GI7A 1TJIL 3D85B 5KVFH 4QTHB 3T0EE 4F37F 3KNBB 4KROB 1TNNA 1MNUH 3FO9B 2FATL 5C0GB 1CLYH 5SWZA 3GJFA 1FDLH 3CFDA 5IV2A 3OKEA 4NCC1 2GSIA 2QQQA 2LAAA 4GQ9H 5CJ8A 4X6CB 3WCYA 1CK0H 1CGTA 2ICWJ 1X9QA 3T09A 3MBXH 2FIRT 3HHRB 1NGYA 1JGVH 1QG3A 1UJ3A 1CFTB 3MYJA 5FGBC 1J7VR 4FQ1L 3JV5A 2VLMD 3UTTD 2DQEL 3CXDL 1J5OH 2ZG1A 3GJFB 3T65A 5HY9B 3NFSH 5TF1L 1D5XA 5E24E 4S1RL 1G9NH 2VLLA 3SHSA 3V6FA 4J2XA 1SY6H 1U8NA 5IT2L 2F19L 1UJ3B 2NY6D 1AJ7H 4NWUL 2MQCA 2RJMA 4OD2B 3FT2A 2DQJH 4TSAL 1JWUB 1KJ3L 1I7RA 4AG4H 2CMRH 5ITBH 4OCMC 1KIPB 4D9QD 3OZ9L 2V5MA 1OTSD 1D5ZB 4MNHA 1I7TB 3OB8A 3HE7C 5D7JB 3FO9A 2DLIA 1Z9SA 2HKHH 3D0VA 4XP5L 5D7SH 4ODXB 4JDZA 3NA9L 3OF6A 4MCZB 4U05A 3WFEL 1MAJA 3WXWL 4JM2A 4AQ1B 2YD4A 3HI1A 1TMCB 4YGAB 5E1AA 2L4OA 2OTUA 2XRAL 3G6JF 2OZ4A 3VD3A 5JW4N 4JFEA 2LQRA 4KUZL 3VRIA 1NCCL 5TQ0H 3TNMB 3RWJB 4ODUB 1AGEB 2GJJA 3MLWH 3V6OA 4YDLB 4HS3A 2VQ1B 3H2WA 4ODSH 5DWUH 3K8MA 3MNVB 2DI7A 5EZJA 1OPGL 4Z7UA 3LQMA 3WHE0 3C2AL 3QCTL 3BIKA 4JFHE 4D8PA 4JGUA 2YK1L 2BXYA 2V7HB 3WKMH 5BCAA 4IDJL 2BMKA 1A64A 1KXQE 1ZGLP 2HKFH 2A74B 4U1IB 2DOCA 5D1XA 1W72A 4AG4L 1CT8A 1A6AA 1QBLH 1XGYL 4YUEL 4ZYKA 2BXZA 4BSJA 1AJ7L 1U8OA 3ILPB 7CGTA 5D96B 2EIBA 3UTZA 2ZSWA 2I07A 4TQEL 1BECA 1RZ8A 2D03H 3ARGD 3HMXL 4KJQC 1YMMA 2AK1L 4AL8H 5DRZB 4Z7NE 4JQVA 2LU4A 4JR9L 1I1YB 2O61B 1I1AC 3G5ZB 1D6EB 1QEWB 4Y19D 3W39B 1CK0L 1CGSL 2D0GA 1A6UH 5EIIA 3IDNB 2C3WA 1VACB 3V4PH 3FCTA 3VG0H 3ALXA 3E6HB 2OLDA 4JY6B 1F58H 5EBGA 1JVKA 2IG2L 1T7ZA 3PV6B 3FO1B 5E9DE 1CLYL 1IQDB 2R1WB 4YQXH 2D7MA 1VGKA 1L7TH 4I0CC 5K93A 2YA0A 5MI0B 5F1IB 4KTEH 4JO3L 4JPKH 2BVUA 1DDHB 4D0CA 4AH2A 4JREC 4LASL 1JNLH 1ZHKA 4NZUL 4R0LC 5H35B 3ARGC 1M6OA 1A4JA 2R39A 5C07B 4CU8A 1UM5L 1VFBB 1BZ7A 5F1IA 3ULVF 4JFDE 1OGAD 4TUKL 5DK2A 3LS5H 3TBVA 2Y07L 3V52L 4LK4A 1I1FA 1VA9A 4F3FB 4GRWE 5AZ2H 5E2VL 1VADB 2BVOB 4FTVE 4P9ML 2ZSWB 1AGDB 5EIIB 2GTWB 3CUPA 3O8XD 2PW2A 1OSZA 2IMNA 4TUJB 1T1WA 4G8IB 5AUMB