1IGTA

Structure of immunoglobulin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
214
structure length
214
Chain Sequence
b'DIVLTQSPSSLSASLGDTITITCHASQNINVWLSWYQQKPGNIPKLLIYKASNLHTGVPSRFSGSGSGTGFTLTISSLQPEDIATYYCQQGQSYPLTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A INTACT ANTIBODY - MAB231
publication title Refined structure of an intact IgG2a monoclonal antibody.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 41
structure length 214
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 1996-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igtA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igtA01
4R90L 3O4LE 2VKXA 3P77B 1X4XA 3W39A 2ICCA 4OJFH 1BD2E 4XVUC 5FO7B 1MUJB 4PRHA 3GBLA 3CFIC 4JFHD 4PTTA 5HHQA 1B9ZA 3DMMC 1PVHA 4NQCD 3L9RB 3RVVD 1R0AH 5EBGA 1YJDL 1KCVH 1QBML 3SKJH 1XGUB 4G6ML 1FNLA 3MXWL 2VDKH 4FZEL 4RFEB 5DFVD 1QSFE 3SJVD 4Y19E 3ZTJH 4GMSH 4QY8A 3BGFB 3BISA 3EGSB 1G0DA 2F5BH 2BOCB 1TJGL 3OJDA 5J12C 5FUOH 1T83C 3OBAA 2VZOA 4OFPA 2YS4A 4P4KB 2WIIA 4H20H 2HN7A 4HIJA 1KXTB 3T65B 3LAFA 5F9OL 1MCPH 4QOKA 3OGCB 1FDLL 2RFXB 3MJGX 2E6PA 4F15B 1UH3A 2V7HA 4JFZH 1XGQA 4RZCB 5JDSB 4KQ3H 5L7XH 5GGRB 3NA9H 2XRAL 2YWYA 4DN3L 2W9DH 3JUYA 4KZDL 4EI5B 3M17B 4HWZB 5IV2B 4XTRC 4WI6A 5E6ZA 1KPVA 4AMKH 3E6HA 4JRYE 1A4JA 5H94A 2NXYD 5DJ0A 3MRCA 3RFZC 1IL1A 4W4OA 2DWEB 1ZVSB 1U41A 2R9HD 2A38A 4QRSA 1T1WA 1S78D 5ESQA 2HJLA 1K5NA 3QJHB 3BKYH 3IKCA 1NGZB 3RWHB 1DBKH 3PHSA 3FQRA 2LU4A 4ELKA 1KT2B 4ODHL 3MJ6A 2DICA 4R7NA 2Y07L 3L5HA 5FYLD 4QRRB 2DYPB 4Z0XA 1KN4H 3WFBH 4S1RL 3L95A 4HF5H 1FZJB 1E4XH 4RGNE 3KYMB 1N6QH 4Y1AE 4JN2A 5IBTH 3ARGA 4X6CA 1OGTB 2A83A 3VH8B 3CLFH 4KV5E 1FYHB 3OF6D 2QEJA 1T2QH 5ISZD 2AERT 1KOAA 4YQXH 5DA4A 4XMPH 4IOFC 5L9DH 2X89A 1TPXB 1R5IB 3MGTA 4LLQA 3MO1B 3H9SB 4X80H 4Z7UA 1PQZB 5JQ6H 2R0WH 3QO1A 4YXKL 2UWEF 3RL1A 4JFFD 1FLRL 4HKXA 5BRZB 4NO0B 3DXAE 4YXHH 3H0TB 3JVGC 5CMAB 5HYJB 4S0TD 1AIFB 1MVUA 2VLLA 3GSXA 4WI3A 1P5UA 5E2JA 4X0KA 5DR5L 4WU5A 3BWAB 5HDBE 5D1QB 2EYSB 3RIAK 4NSKA 3CVHA 5GRVL 4Q6IB 5T3XD 3NAAH 5JXAH 4EEEA 3OZ9L 1M6OA 3P0VL 5ILTL 5E1AB 3B9KA 1ZS8A 2FB4H 4X5WA 3E3QC 5I66A 5CJ8A 4ZS7L 3MFFB 1ZA6B 1ROWA 3RJDA 4GW1B 3U0TB 4E41A 5I73C 3MLVH 1CD8A 3B9EA 3TWCH 1IKFL 3HE7D 3VCLB 3EYUL 4HIIA 1GZPA 4X6FB 4EXKA 3G6JE 3QUYA 2ARJA 2B1HL 1S7SA 4GKZA 2AV1B 3C08H 4L4JA 3D18B 2P8MB 4DKAA 5LAXA 4NKQB 1XZ0B 2Y4SA 3SDCB 2P5WA 3QXAB 3CVIH 2BVEA 2XZCL 5DJCB 5CZXC 4HG4K 5DZLA 5EZLA 4DGVL 2C9AA 1MWAB 1NAKL 1N4XH 1B2WH 1AKJD 3TNMA 3VXOA 1SYVA 3HZVA 3TVMB 4MD4A 1LQSR 1CFNA 1CDCA 4ODVH 3LMJH 1HQ4B 5GZOC 2Z31A 1IAOB 1FNGA 1JNLH 4JHAL 2DI8A 1E28B 3BGAA 3UTQB 3SDYH 1MHPL 3G04B 3RWIB 4GRMB 1KG0B 4MB3A 2QHLA 3HB3D 3UJIH 1FORL 5I1EL 1DQLH 1F2QA 2MCPH 4RFOL 3CSBA 5EOCH 5ADPH 3KR3H 3SGEI 1R5VB 1VHPA 5I8CB 2BXYA 3WL9A 3S35L 1T5WA 4E42A 4R4ND 4G9FB 4XP6L 3OAYK 5BO1L 1UC6A 4TUKH 3CDGB 1XFPA 5T1KA 4YEFA 2DDQH 5DD6A 1VFMA 3NZHL 4DJMA 2J7LA 4ZTOL 5EO1B 43C9B 4LCWB 4J6RH 5C8JA 1J05A 2R0LH 5GRJL 3HS0B 1M1SA 2VABB 1F4XL 2C1PB 5C0AD 3RTQD 3A6BL 2AK1H 1D5BB 3HPLA 1CD1B 4JKPH 2CLRB 5D7IE 1R3IL 2A6IB 1T3FB 1CR9L 4YHKL 4CAGA 3T3ME 1P84J 3IVKB 3KPRB 5GSVA 3FAXA 3A67H 4K94H 2CPCA 1WFOA 3V6OC 4TNVK 3KPLB 5L2JA 3RWGB 1KEML 4LAJH 4Z7UE 3VWKD 1EZVX 2SEBB 1C7SA 4JB9H 4JFOA 2WQ8A 3QFDB 4IEFB 2PYEB 4X6DF 5F7NC 1FO0H 4BQ6A 1O5DT 3PWPA 3WUWG 5LXGH 5DS8A 3LQAH 1MF2L 3KPTA 4QKXB 3V6FB 2WANA 3V0WL 1PD6A 4P23C 3V4VL 2Z91B 1J7VR 1J9CT 5IM7A 5TFSL 4WUUA 1RZKH 3PP4L 5EU7E 1P9MC 2XPGB 3UJTH 4KMTH 5L6YH 4KU1A 2YK1H 2NY7L 5FUCE 1JF5A 4NRXA 2DQJL 1VA9A 5F3BB 4WO4A 3RZCB 3P9WB 4HAFA 5HYFA 3DRTA 1I85A 1ADQH 2GT9B 4PRIA 6CGTA 3LKQB 5DC9B 3QCTH 2DD8L 5ITBL 4E41E 3I02B 3LQZA 1CD9B 4IRSC 1U92A 3D2UB 5JORB 2G60H 2ICES 2PXYB 2H41A 2FX7L 4LCCC 1FSKC 1O0VA 1NGQL 2CIIA 4I2XA 12E8L 5D2NB 4C83A 5CJOL 2AAVA 4DKDC 4U31A 4V1DD 4UMGA 1CFVL 1YNLL 4JFYA 3WIHH 4PD4K 4RIRB 1GJIA 2P5WE 3GMOA 3EZ8A 3M8OH 3QO0B 5F1NA 5EA0H 3RWCB 1RZIB 3Q5OA 4Q9BA 2Q86A 4RDQG 3WLWC 1IGML 2X42A 1Q9WB 1TFHA 3QUMB 4FQPA 2AI0H 3AUVA 4GJTB 1E6OH 3F58L 3BAEH 3C8KA 3S4SG 4EKXA 3Q5YA 1HHIA 5AZ2L 1OGAD 3HRZB 3L3DB 4JHWL 5I17A 5JW3H 1ZXQA 4MB5A 3MJ7B 2BSSB 1IQWH 3L3GB 5DQ9B 3OHXB 1S7VB 2EDYA 4XXDA 2ADFL 5JW4M 4QRUA 2OJZL 1IRAY 5EH1A 2X09A 2QL1A 1DUYA 3P73B 1LDPH 3R0NA 4PGEB 2B39A 4LU5L 5DRWA 5C0DB 2YHGA 4I0PD 3EYVB 5IB1B 2PF6A 1FL6A 3QXTA 1JNNH 1DP0A 4ZD3H 1LVEA 3MR9A 4JO2L 1R3HB 4Q2ZB 5I1HL 3UTSE 1F42A 1DVFA 2DJ4A 3GMNB 4DAGH 5J57B 3DGGA 2C3XA 4KC3B 3SHSA 5B38G 4E5XA 3PP3K 1PAMA 1EDQA 2ADJA 2BX5A 1HHJA 3E1F1 1QLRA 1ONQB 1T20A 1GGBH 4KK8D 2EXYC 4N5ED 4MXQC 4RAUA 3LB6C 1FO0A 3L6FB 5E2UL 3ULVH 4GMTH 3RWFB 5FIEA 3CSPA 2BVUA 1MSPA 5FA4A 1LO0H 3B5HA 4UQ3B 2Z92B 5D8JH 5DO2C 3X12B 1A0QL 2DQCL 3BESR 5HDOA 1A22B 2YD7A 3BKCH 4M3JA 1WT5C 1X4YA 3HHRB 1TZGL 4KQ4L 5IMOA 3OPZH 3FO2A 3FMGH 5C0CE 3TCLB 1WCBA 1RVFL 3PWPE 2NYYD 3BGFC 4EBQL 2EIZB 2JKXA 2OS7A 1DLHB 1ADQA 1Z0NA 1IM9D 2JE8A 1UCBL 1NBQA 3LEYH 4Z0BH 3T3PF 4W6YB 1YEIL 2R2CA 4HXAL 4YUEL 4GS7B 5DZNA 4AT6B 4N1HB 2HT4C 5C09B 5TF1L 2KZWA 2X1PA 3RVXD 3WLBB 3KJ6H 4WV1C 1XH3B 4FQQA 1OAYH 2VZSA 4JRXD 4F15C 4EUPG 1T1YA 4ODSH 5L0QC 3ZDXE 4PGCA 1FZKA 5I1CH 4DGIL 1N8ZA 3QEUB 5JPMB 2IAMD 5E2VL 2CK2A 4PRIE 2FJGB 4HK0A 3FT2B 3WD5H 3G6AB 1DBMH 4PG2C 3MJ9H 4NQDB 1IEAA 3O0RL 4XZUB 3R8QA 1J1OL 1I3RA 1F3JB 2R1YB 3F6LA 3PUCA 1X7QB 4LBEA 3TT3H 4LF3B 4O4YH 4S0SD 4YZFE 4CNIB 3ORJA 4I2XE 2N4IA 4NHCH 5BZDA 4JQVC 5ACLA 1AJ7L 4JFED 4TVSa 1X5JA 3QUXA 1MCJA 1XIWB 1LO2L 4M9OA 5D2LA 1MQ8A 4X99A 1AQKL 3FT3A 4R96A 3BHBB 1R3LB 2DQDH 1EV2E 5CEYA 4WWKD 3QIBB 3NCYS 5ECJE 3PDDA 4M6NL 4KAQH 2ARWA 2H9GA 1WV7T 2IQ9H 1FCCA 3CSYA 5DEGA 4U7KA 3FONB 2F19H 4EOWH 4NBXB 4M8QB 3TF7C 2P7TA 5DYOB 1WZMA 1J8HA 3MLTB 1ZT4B 2B4CH 1TPXC 1D5ZA 4PJ8B 1I7TA 3NH7L 4XHJC 3MSPA 2LE9A 1OTTD 4HT1H 4JY4A 3GNML 4ODWA 4LCIL 1EJOH 1Q38A 3DETD 1IGJA 5HHOD 4NNYA 2BSTA 1FAKT 2OX5A 5A2LH 4CADA 4RAVA 2DBLL 4D9LH 4ESKA 2W60B 5J6HB 1F6LL 3FHAA 2Q7YB 5IEHB 4UT7L 3NGBB 5GJTH 3ULUD 1EVUA 3BPCB 1UKTA 5D1QC 3W0WD 5JHLH 1GGUA 5EN2B 1Y18A 5IK3B 4DGYH 5IIEB 1RMFL 2DMBA 3GSWB 4M93B 3FO9A 1KCSL 4OCNC 1FG2A 5FHAL 5TDPB 3EYQC 3T0ED 2IANB 3SGDH 5DMYA 4WHCA 4F8QA 4JGJA 5AWNL 3J7HA 1BFOB 5KSAD 3QJFA 2C5DC 2OP4H 4LPCA 3D6GA 4KJWC 4QGYA 5CGYD 5DFWH 4UINL 3S7GA 4JPKL 5D72L 3UBXB 5CCKH 2I25N 3KLAB 4LPTA 4QRQB 3GSNB 5DJAB 1CL7L 1UJ3A 4LHUB 1D7FA 3ETBF 3MCG1 2X9WA 1NBYB 4UAOB 4XCNB 3U82B 1J0KA 3HA0A 1XT5A 3MV9A 3D3VD 2AXFA 3O6ML 1CXLA 3HLAA 2I5YL 3IRPX 3RAJH 4XP5H 1SY6H 5DRNB 2CXKA 1L4IA 4WFHE 3VXRB 3H9HA 4JY6B 4M7KH 4P5TD 4YIQA 3LKNB 2MMXA 2CR6A 4AYFA 5A2KH 4PIRF 3SBWC 4FZ8H 1BBDH 1NL0L 3MNWB 4LSSH 4LLWB 2R39A 4PPTA 4LLMB 5D7JC 3RWDB 1NMAL 2CKBL 3TH3T 2EDBA 3QEHB 4HX1A 1F8TL 1A6ZB 4QHLB 4Q6YA 3LH2L 2P5EA 1DFBH 4OB5L 1IKNC 3UJJH 2QBWA 4WRLA 4DKEL 1J10A 1YMMA 2K7QA 1ZAGA 5FDWB 1P7HL 1UJTA 3I6KB 5IR1B 4LVHB 4ZOCA 4WJ5A 5F7HA 3RHWF 1N5YL 3QT2A 4KROB 3WS6C 4PYGA 4NO5B 3NFSL 5J1TC 4R9HA 5I15L 3NBNA 4IMLB 4X8JB 2NXZD 1I1AA 3HZYB 5CILH 1U8QB 1ZANL 2NLJB 1ZE3C 3ZL4L 3HI5H 3T8XB 2VXUH 3O6KH 3DX9A 3HFMH 3EFFB 5D2LE 3CJJA 4NCC1 5HYSG 1RJCA 3N0PB 1BLNB 4JO4L 4A6YB 3ZYJA 1L0QA 1FVDA 2DQTH 4FFYL 3QCUH 4ZYKA 2YSSA 4UT9L 4M4PA 5ANMB 2Y7QB 3HRPA 5D1XA 1N3NA 2DL9A 4WDIA 4NQUA 1H8SA 3C8DA 3HN3A 4HQQL 2A1WL 2XN9A 4LIQH 1JGEA 4ODXA 1CFBA 3N50A 5FYJH 4XNYL 2X7LA 2Y6SC 1HXYA 4M5YH 4EQ2A 1U91A 2H1PL 1S3KH 1MAJA 1DR9A 3PGFH 4CN1A 2QHRH 3HUJF 3TFKC 5SWQB 4GRLB 4MNGE 2BY3A 1DL7H 3OGOE 1VKXA 2QQNL 4HZAA 3BW9A 2OJEB 4J8RB 1QYGL 4FQCL 3EOAA 3ULVE 4ZFFA 3ARED 1S8DB 4P2QD 4QF1A 5IUSA 5JXEC 4CUCA 3KLHD 3MYJB 2XZQL 2NW3A 3IS0X 4L4VD 3MRLA 3V4UH 5KAQG 5FKAB 3V7AE 3KPPB 4WHTA 3C6LD 5KVDH 5KN5A 5DDHB 1UQSB 2Q6WA 4P3WA 4RMWA 3KXFD 3QUKB 1LE9A 2GUOA 2IMNA 4IS6B 1SY6A 3KDMA 2D7QA 4OZGB 1KIUA 4TOYH 1ZMYA 4HS3B 3PQYE 4CU6A 4I4WB 3KNBA 3QI9C 5INCA 4HWEH 4ELMA 3U0PA 1FFNA 1MHCA 3PV6A 5K59F 3V6ZA 5I1JH 3HR6A 2YD6A 2ZUTA 3ZZ1A 4GQPH 4LEXH 3ESUF 3IDGB 3MRPB 4K3DL 5FV2A 2NY4C 3FL7A 4PREB 4Z7WF 3IFOA 1ND0A 2ZSVA 3MRGB 1K4DB 1AGCB 2D03L 1O7VA 5KS9A 1UM5L 4ZG1A 4WW2B 1V05A 3SQOL 5T3XL 4ZAKC 5DURD 1NC2D 2HFFB 2R8SH 3F7QA 4LLDB 4ZPVA 1LO4H 1NUFA 4LPXA 5F8RC 4PJ7F 2W91A 5GS1A 3SGJA 4PJBB 1I9JL 2ED7A 4YR6A 5GRXG 4BSWA 5LWYH 1JWMB 5BVJB 2P5EE 3TIEB 4LNVA 1MQKL 1BD2B 1XF3A 4Z7VB 5HHME 2X4OB 3WKMH 3VXTB 3DNKA 4WFFE 1CLCA 1URLA 3A6CH 4P99A 5F88A 3UDWA 1H3WM 1NCDL 5EOQH 1NEZB 2C3VA 2OL3L 3VWJC 2YC1A 4YLQT 7FABH 2ID5A 4OD1H 3QHFH 4I77L 4J3TA 5DD1H 1QR1A 1IGTA 3G5XB 4GW4B 3LS5L 2ED9A 1BQLL 2NTSP 1QSFB 5F8QC 4KTDL 3W11D 1AGEA 4MA8L 2A0LD 4X7EC 5ID1B 3MV7B 1JK8B 4QYOA 3DWTA 3C60D 1FVEA 3F7YA 1G7HA 5C0BB 1OARL 4M48L 1KIRA 3IFNH 1WCQA 3UZEA 1FGNL 2FJHB 2VISA 4U1SB 3EIFA 2HT2C 1NBZB 4GAGH 3EO1A 4KXZI 4S1DC 5IT2H 2NY5C 1VACB 3O41A 4JFDD 5IMLB 2VH5H 4QXTB 4R7DB 2FBJH 3LHPL 4U6YA 2HFGL 2XN9E 2I60L 1OD9A 1A5FL 1I3GH 1MRDL 3C5JA 5IB4B 3H3PL 1YYML 4YHIA 1BIHA 2OTUA 3U9PL 4LAQH 4J23A 4UBDD 3WHXB 1WZ1H 1XCTA 5GISH 5JW4Q 3DHMA 3O3AB 1F6AA 2BY0A 1RSFA 1BFTA 1A6VH 1P6FA 1D9KB 5C0NC 3MRNB 1JFQL 4OLXL 2F58H 5IWLC 3RKDC 1K2DB 1RZFL 4UOJA 4KUCD 3F62A 1EEYB 1I7UA 4H5SB 1HHGA 3QDJA 4QHUB 3W2DL 5F7MC 5HYQB 3SE3C 1UM4H 2ADIB 3NFNA 1RK0A 3GEWB 3WNMA 1IAII 3FFCD 3SE8L 3BIBX 5F96L 3SDAD 5F7LB 5BJTA 3V6BR 3RVWD 2BNRE 2V17L 5BQ7A 1VSCA 1A3LH 3UTTA 3EO9H 3IDYB 5F7EH 4JDTL 4OLUH 4MHHG 3FB5B 4ELME 2WUCH 2X4PA 4MA7H 2DL2A 3E6FB 2UV3A 2NNAB 3QQNA 4X7CC 2APVA 4KVCH 3WUWA 5FF6A 2VLJA 1BOGA 4YHPA 3GBMH 3FQNA 4HKJB 5F9JA 1FVCA 3H8NA 4JR9L 4PJEB 4GG8A 4O2FB 3VFGH 4EN3B 3ARBA 3DYOA 1AXIB 3PJSB 3QDMB 4FG6D 3QIBC 1LP9F 1A4KB 2IJ0C 4KI5D 43CAA 3QG7H 2VLKA 2A9NL 1IAMA 3O3UN 3TP4A 1RZ7H 2NZ9D 2V5TA 1LK2A 4I1NB 4YDKL 3X3GH 4FQIH 4F7CA 3QNZB 1M05B 1LDSA 2BSRA 3LPGA 4HUNB 2HRPL 4HMEA 5DD0H 3RPIA 4P9HH 1I1FB 5DVLA 5EFIB 3MRRB 5EUOA 1NCUA 1IGCH 1KLUA 5IBLD 1ZT7B 1E0OB 4QHKJ 1GL4B 2QKIB 3G6JB 4JFPB 4KKAC 2GITA 1T7VA 2DQGH 3LRSA 1U0QA 1M7IA 4EUPH 3JV0A 4G3YH 1RJZA 1A6AB 2PNDA 5GGUA 2J5LC 4NRYB 4P2RD 3VGGA 2IQAB 1CG9B 3PWVB 1J0YA 1K6QH 1KJ2L 1S9VB 3H42L 3VRLE 4J3OC 1GXEA 3QQ3A 1C5BL 1PLGH 1G0YR 5C9JB 5FYKL 5A2IH 5DMGC 4XRCA 4W4NA 3CSGA 4FQ1L 1OTUC 5BV7B 5T3ZD 4P46B 1HHHA 1LK3L 4YX2L 1JN6B 2D9CA 3UTPD 4U05A 4X7SL 4M93C 4LIQE 5FYJE 3RU8H 1AI1H 2IBZY 2XKNB 3S4SA 4KK6C 3QIWD 1V7MH 3IDXL 3WUZA 3GSVA 1U8NB 5J89A 1OAZH 5DJ6B 1T03L 4ZPTA 2FGWL 3D85A 2GSGB 3QQ9D 3HMWL 2EDQA 2VR4A 3PNWA 1FC1A 3V95A 4NHUA 3KPQA 3GMPA 1OAQH 4JQIH 1NPUA 3T4AA 1J0JA 5GGTH 4UAOC 4Y5YB 8FABB 4YE4L 5CD5D 1XF5A 4NUJB 5DHVA 3NABL 2PTUA 2NXYB 5J9PA 4OZFA 5E70A 3U46A 2CK0L 2PTTA 3PWUB 4C54A 3BT2L 3P4MB 1INQB 5CIPH 5ELIA 3Q6FB 3QXDA 5IW1A 3BVNA 2XTLA 4HFUH 4M00A 1QP1A 3VRIA 2H2SC 5I71C 5IKCB 4NGHL 3EYFB 1KLGA 4PY8J 3BO8B 1KC5H 4ETQA 5HGDB 1U6AL 4MA3A 5FGBC 5IHZA 3N85H 4WI7A 1I4FB 2BOBB 4GKSB 1CYGA 4CMHB 3N1FC 1TMCB 5E94B 2AEPH 4KRMB 1TZHA 4TUOB 5ISZB 4E0RB 4KDTA 2GHWB 4Y4FB 1MRCL 2RCSL 3UTTE 5C6TL 5K9KA 3BEWB 4FABH 2X2YA 1XF4B 3MRIB 3UTOA 1CLZL 1OHQA 1T22A 2VDPL 1D5IH 1W0WA 2X9XA 5E7BA 3SCMD 1DLFL 4JFFB 5IFJB 4LOUC 2NTFB 2VLJE 1MJ8H 4G42B 2H6PA 3QPXL 1LO5B 4Z5RB 5DHXB 1KN2H 4I5BA 4MJIA 4PRHD 3JWDL 4ONGH 2AJVL 2YUWA 5IMMB 1FRGH 3CFEA 4TULH 4EUPA 1I75A 3B83A 2VLKE 1RUPL 1VDGA 2HFEA 4DZ8A 1DDHA 3G9VA 5JNYA 1EIBA 5HYIA 1RUQL 1EXUA 5CGTA 5JR1L 3NN8B 4PJIE 4YHLH 4D0CA 1EZVY 2Y72A 2V2TA 4PTUB 3ZT5A 4O5LL 1V8HA 1S7TA 2DLTA 5EUOE 1EO8L 3MBED 2GCYB 4QXWA 4JVWA 3EYOA 1WICA 1NC4A 1N7MH 3CXHJ 4U1LB 3G6DL 4APQD 5BS0A 3VFTA 4R4FL 4LLVA 1CT8A 4QOKD 2YWZA 1RJYA 2APTA 1OD7A 3MACH 4WFED 3HNTL 1B6DA 1GHFL 1V3JA 1KB5L 1F3DJ 4LGRB 3WDIA 4NUGL 2UYLB 2HJFB 1ZWIA 4OZHB 1I9IL 5GGTA 1RV6X 3U30B 5GZND 4HULB 3MNZA 3SO3B 4EI6A 1GRWA 1Y0LB 5ERWB 1AKJB 5EO0A 2C3GA 3TBSB 4JZNA 4DQOH 1YY8A 2Z93A 3BZFB 3QULB 1ZLSL 4HUWA 1C12B 5CIPA 4OCSH 1RURL 1LE5A 3ARSA 3U36B 5EB9A 2HMID 1A21A 3BP4B 1RUKH 3LVEA 1DQQA 4RMTA 4PJHB 3MV8A 3QWRA 4HWBH 5A43C 2HLFD 3PL6C 1P4IH 3QUZA 2NY0D 5EPMB 3ARGD 5DD3H 4Q0XL 5L8JB 3DV6B 3MX0A 4PJHF 3GJEB 5HPOA 3EDFA 3QRGH 4G6FD 2XACC 1A7QH 1GCFA 3DIFB 4V2BA 3O2VH 2VLRE 5JPNA 1MCWM 5EZOH 2L7JA 3UTSB 1NCAL 3QCVL 4BH8A 1BFVH 1UA6L 4N0UB 5CP7A 1TTUA 4PS4L 5C0AB 3RTQB 1ITBB 1X5KA 2WWMC 3L3JA 5EU4B 3UAJC 4HS8L 4KUZH 1YNKL 3GJFK 3OWEA 4G8EB 4NOBA 2MFNA 3MRDB 4TNVF 1S7QB 1E4KC 3QWOB 4L3CB 1R3KB 5SWSA 2P42B 4PRDB 3TYGH 3CLEL 5HYEA 1P84K 2X4SB 4J4PC 4G80B 5C0EA 2BFVH 1T1XB 1C1EH 5C0CB 3VWKB 1U3HA 4ZNEA 1ZGLA 2CRIA 4PGBA 4X6EB 1GOGA 3O3DA 2YOCA 3MLSH 4FQ2H 4LCYA 3ROOA 3SE9L 2XG4A 4PV9A 4HLZG 1BWWA 5E9DD 2R4RH 2EZ0D 3FQWB 3GSQB 4MJIE 3RWEB 1HWGB 3KGRA 1HOCA 8CGTA 2YPVL 4QT5B 3QUYD 5MP6H 2X70B 1U95A 4WUKL 4LFHD 1RZ8A 1JV5B 1IILE 3QDGA 3U7YH 1CICA 1ETZA 4DCQB 4MJ5B 4N0YL 3VGAC 1HSBB 3G08B 3RNKA 3KWWA 1I8KB 1CGVA 1YEHH 4Y0GA 1NCNA 4RNRA 3T04D 4BFGA 3V0VA 3VH8G 1A1OA 3B4NA 4NZJA 4ZUUB 3EJYD 3NZ8A 5E8NA 3NIDE 3V52L 3RNQA 3VI4E 4PJDA 3BKML 3BPNB 3TGXA 4ZS6C 4AEIH 4XCCL 1BJ1J 3T0XA 1D9KC 5I18H 4I3SH 2Z31D 5C07A 3V5DB 1RHHA 4V1DB 4JANB 1F4WH 2HFTA 1NFDA 5EU6A 2PO6A 5KG9A 4ONHB 5IVXB 5TQ0L 2YD3A 5HYSA 2HA1A 1JZ7A 1NGPH 4JM2A 2XTJD 1A7RH 4XNQB 25C8L 3EOTL 2JJWA 5BVPL 2VTFA 4MCZB 4LL9A 3MMEB 4BH7A 3T0VA 2YBRA 1TIUA 3FJTA 2CMRH 4TVPD 2XWJB 1OSPH 4L8SC 2PW2A 1U8OB 3RL2A 2FWOA 1OGAB 4Z7QF 1QR4A 2UVFA 3UROR 1AXTH 3IDYC 4LSQH 1Q9OA 4XC1L 4NQXB 3HNSH 1OSZA 3RGHA 4M6ML 1XGPB 2V6HA 4PRPD 3O2WL 2AJUH 4Z77A 2Z4QB 5K9QI 3DURB 2A6DB 1N59B 2FBOJ 2IPKA 3P9MB 2R1XB 4EN3C 5CEXB 2HH0L 3CXDL 5DTFB 3OKEB 4F8TA 3RGVA 5I1DA 4I0PB 1NGXB 5D1ZD 5KVEH 2E7LA 4LGPB 2B20A 3UMTA 4ORGA 5TE4H 5FOBA 3BP6A 4FQLH 1YNTB 1AR1D 4RMUA 1KYOJ 3UTZB 1WIUA 2D2OA 4UDTA 4NC2B 4QRTB 1DBJH 2XIDA 3DBXA 4IRJA 2R56H 3ARDA 3GI9L 1TETL 4EIZC 4HBCL 4WUUD 3IFPA 1JGDA 5DUML 1UACH 4Y4HA 4MX7A 5MERB 3DX7B 1RD6A 4PG9B 3B9AA 4ONOA 1KTDB 1JWSB 5C1MB 4WEBL 2VZ1A 1AFVL 2D4DA 5DFVC 2FATL 2ZWLT 4G6AC 5BV7C 5ICYA 5E08H 1KENL 4O2CA 2H45A 5J56B 2J88L 1NKRA 1XEDA 1IM9B 4G8IB 4M61A 1RULH 1G9EA 1EO7A 1A9EA 1RQ5A 4HKZB 3BGMB 1INEL 3CC5A 5HHPA 15C8H 5E2TL 2O5XH 4B7IA 1YUHB 4BFBD 1B4JL 4JRXB 4H25A 3ME0A 4QLRA 2E27L 2IAMB 2XA8L 3L1OH 1JGUH 1T80A 1HXMA 3U0WL 4LNRB 4BKLB 4OLEA 3TIDB 4XCYB 5FCSH 2W0FB 2NXYC 3SPVB 2Y06L 2FIKA 1UM6L 3DYPA 2R9HC 1GC1L 2G75A 1S78C 1KJVB 1QFUH 1DEEA 5C07E 4GH7B 2E8YA 5LGHH 2GAZA 4JFEB 1MEXH 1NFDE 3C9NA 2O61A 2OSLB 3F5WB 4Q9QH 1NKOA 2F53A 2GJ6E 3MLPA 4EDXB 4XXCA 4L5FH 4LARH 4G5ZH 4MNHA 4U0RB 3L3OB 5IGXH 1KIPB 3AU1B 4OD2B 4WWKB 2VN4A 2JCCB 3OAUH 3O3EB 3LN4A 1N26A 3VA6A 4XVSL 3VXNB 4FNLH 4GT7A 1YECL 3GK8L 3OR7B 4N1EA 4QHNB 4CMHC 3VFNA 4BZ1L 3RVUD 3MCLH 4BSJA 4ZFZB 4BQCA 3TA3A 2AEQL 1NANI 4QNPF 5A16A 1KEGH 1OB1A 4PY7B 1CLOL 3CDFA 5I1IH 3MROA 2YPLA 5ETUA 3G9AB 4P5MB 4FFZH 1OAKH 1DVFD 3FAWA 5GSRA 5GS0D 3KYKL 3L3HB 1HDMB 2DIJA 2DQIH 2IGFH 1ZHNB 1RUMH 4JAMB 4HD9A 4MNGB 5HHOB 1H0DA 3DGCR 1GPOL 4LVOB 4NT6A 1KJ3L 3S3PA 3SE4A 2JJUA 4NQEE 4POZC 2NX5A 1R3JB 2JB6B 4QRPA 2HAZA 3LD8C 3N9GH 4TQEH 4X98B 3I9GH 5GHWH 3MNVA 4IIQB 3W0WB 4H8WL 5I8OH 3H7BA 5DK0B 1DN2A 1WQVT 4GW5B 4JHBA 4PB9H 3CUPB 3I3BA 3QG6A 5IF0B 2OCFD 3OB0H 5IG7A 1U8LA 2E7BA 2P24A 4PJFB 1L6ZA 3T0EB 3VXQA 4JDZA 1QFWH 5GIRB 3U7WL 1VGKA 1DSFL 1OAXL 2VQ1B 3HE7C 3O3BA 3PQYB 1YEKL 3WFEL 5KSAB 4Y2DC 1P1ZB 2NW2B 3C5ZA 4PJFF 2B5IB 5IW6B 4PLOB 4PBXA 2VIRA 4G9DA 4PJGA 3TBWB 2M8XA 2A74B 5ESAB 5JUEH 3BZEA 3ARFB 5CJXA 4RRPA 1C5DB 1FYTD 4PJCA 3VG9B 1MFEH 5JDJA 3NTCH 4CVZB 2F74B 4HUXB 1WC7B 3B3IA 4FP8H 4QGTA 4WFGE 1BZQK 1JGLL 4TSCL 4DW2H 5KVFL 3VI3E 1YEJH 4YBLB 2NY6C 3S96B 1G6VK 1BZ7B 4MJ6A 1H15B 1QRKA 1IC5L 3GO1L 2A9ML 3U30C 5F72S 3PGDA 3SO3C 3WO3B 4D9QE 5AYUH 5EBLB 3WSQH 3QEQA 2DQFA 4HDIA 3GMLA 2JIXA 5TJWK 1OP3H 4G7YL 3QWQB 4N90E 3ECBA 5ADOH 3PHQA 2NY2D 2X4TB 4U1HB 1AQDB 4PBVC 4RISH 2Q8AH 2ZG1A 3JBG7 3HB3C 3BP5A 3GSUA 4PJ9B 4Y4KB 1MFDL 3KPMB 4R4NC 4PJXF 4XVTL 3RUGB 1CGTA 3ZYIA 4QEGA 3L5WA 2XQYG 5AUMA 2NXZB 1J8HD 3K1KC 2EDKA 3UXFA 3DX8B 2F53E 3CPLA 1PG7H 4GG6B 3PGCB 2WIMA 4R3SB 5JIPA 4NO3B 3GSRA 4S1QH 1TVBB 4PV8B 1M7DB 3HC4H 3D39A 5E5MB 3L3IB 3FCTA 3X17A 2IFFH 2P45B 2YD1A 4ORZC 1F4AA 3PIQB 4FQXA 4KRPD 2A6KB 5DQDL 5CEZH 1ZK9A 1UENA 3FRPG 2YPLE 1V3LA 1SVCP 4X5XB 4JQXA 5J1SC 1FFQA 2M26A 3HMXL 5DQJB 1BWMA 3UEZA 1AGDB 2MTPA 5DD5H 1FNAA 2QQLL 1KXVC 1QBBA 1Z3GH 3K8KA 4P2OC 5DJYA 1QO3B 2EECA 2J8UB 4ZSOB 3SKNA 2H32H 4P57A 1PW3A 1R5WB 4P9ML 4QRPE 4GO6B 3ARYA 1YC7A 4HJGA 1NUDA 1U3JA 4P23A 1F58L 1WBYB 4P2QB 3QPQC 3P11L 4XNZB 3PWLA 5L88L 3MV9D 1P9MA 4TSBL 1W0VB 3G5YA 4L4VB 5FK9A 3C5SA 3M1BA 4JPWL 1MREH 2ATPA 2VDNL 3C6LB 2X4QA 5DWUL 3ZO0A 1WBXA 3SGKC 2Z8SA 4GAYA 4TNWK 3DX6A 3KXFB 4G8FB 3VE0A 1J86A 5TGBA 4K3JH 1P2CB 4XBGA 4RCAA 5TDNB 1JRHI 4J2XA 2J6EL 4NKDA 2I24N 5B3JE 3BPNC 4MCYB 2ITCB 3ZSSA 1OLLA 5IQ9A 3ZHLA 4PJGE 3GMRB 2J4WL 5D7SH 4J1UB 4LCCA 4UTAH 3S34L 3SDDA 4CVXA 4DVBA 4L3EE 5KW9H 3BIKB 4M02A 3OKMB 2KDGA 4YBHA 2F54A 1WF5A 1MRFL 1YMMD 2VDQL 1AHWC 3QFJD 5E8OA 3NCFB 1YC8A 2Y5TA 5TH2B 4CBPA 5CSZB 1P69B 1EGJH 2OR9L 3WLWD 4CVWA 1CBVH 3VA2C 3OAZK 1J0IA 1I3UA 4OF7A 3BSZL 2W0PA 3QEQE 4OQTL 3T1FB 3BZDA 1F11A 1N64L 3DI3B 2X5PA 4Y5XA 1OT1A 5DURB 3TT1H 4HLZH 4GSDL 5E95B 3VGEA 2ZCLL 3GIZH 1JVKA 2D3VA 1KCUL 4Q97A 5KZCB 3Q3GB 3WJLC 2FX9L 4RMQA 3UBXG 3HI1A 4XWGL 3CZJA 4HZLA 1P7QA 4LHUG 3WFHA 5I19L 4JJ5A 4BSVB 3ZYOA 3FQTB 3ROLB 1TCMA 2QLVB 5EBWB 2RAMA 2GJJA 5SX4I 4CW1A 4I0PC 1IM3B 4JFQA 2UUDH 3STLB 4M1DH 3DV4A 1TJHH 1KFAH 1RU9L 4F3FB 1EPFA 3C60B 1VB9A 2K9UA 5E2WH 1T0MA 4MD0B 4KK8C 3HR5B 1M7XA 1SJHA 3D39E 3OJMB 5MENA 4NN5B 4MXQD 1YPZF 3P77A 2WK2A 5C3TA 2O5YH 2EH7L 1S7UB 3MXVH 2CUIA 4OLWL 1DQML 3OKLB 4OFYD 3FOLB 1EMTH 1YYLL 3VG0H 1MUJA 4U1JB 4PJAB 4UB0L 1ZLUK 2ZP0T 1K8DB 1FC2D 5AZEH 3VFVB 3L9RA 1H9VA 5ENWA 1NJ9B 3MUZ1 1XGUA 2R29H 3EOYG 3VXPA 1HYRC 5FUZH 2NYYC 4OZIB 4M4RA 4RFEA 4MLIA 4KDWA 1PYWA 3AXLB 3D0VB 1XR8A 5C0RL 3T2NL 3MCKB 3EGSA 5IHUL 4OM1L 4K3HA 2BOCA 3JWDC 3WEXB 3OKOB 4P4KA 4EXPX 1HKFA 3SDXB 5CJQH 3O6FC 5C2BH 3T65A 3DSFL 1XF1A 3KPNB 1Y6NR 1BOYA 1MLCB 4G7VH 3OGCA 4K7PH 2RFXA 3KPSA 2FZ3B 3FFCB 4YHML 4RZCA 4Z8FH 2ITDB 5GGRA 5DRZB 4ZUTB 3SDAB 2OK0H 4L9LB 1FH5H 3CVHL 2ICWB 3FRUB 1Z2KA 2EKSB 4EI5A 5L8KB 4HWZA 5F97E 5IV2A 5LGKA 1MIMH 1MWAH 1EGJA 1KIQB 3QNYB 1V7NH 1XCQB 1R0AL 1P4LB 4KY1L 2DM2A 1KCVL 2DWEA 3CU1A 3SKJL 4AENB 4YDLB 3BJLA 1CZ8L 2YUVA 4LSUH 1BVKB 1E6JH 2DIBA 1PY4A 3QJHA 1EEZB 4O58H 5J8OA 4GMSL 2B2XH 5F1SA 3LDBB 4JQVA 1NGZA 5EUKB 3E2HB 3RWHA 1WAAF 4UV7L 2YRPA 4H88H 2F5BL 2HKHH 4U0RC 3MLUH 5AEAA 5GGVH 4PRBB 5FUOL 3F12A 3V8OA 4XMLH 4WWKC 1ZHBB 2BVOB 3FB6B 4QRRA 5EZJA 1ORQB 2DYPA 2F8XC 4H20L 1FZJA 4PP2B 1OW0C 3REVB 1KTRL 4GXUM 4NZDA 4JFZL 1OGTA 2ZCKH 3CNKA 3VH8A 3W5MA 4KQ3L 1D6EA 5E6ID 2W9DL 3S5LB 4KI5F 2OZ4H 4K3GA 5C0IA 4QO1A 2XQBL 3AMKA 3T4YB 1TENA 1BM3H 3VW3H 1OTTC 1R5IA 3MO1A 3H9SA 5I1LB 3DETC 1PQZA 5EU3B 5I1KH 1G9MH 4YDIH 1R6VA 3MA9L 4NO0A 4OFKA 3H0TA 1YY9D 4KHXL 3QSKB 5CMAA 2YXMA 5HYJA 3BKYL 4P2RB 4NKOB 1AIFA 4P3DB 3IFLH 4NWTL 1DBKL 1IC7H 5FGCB 2BDNH 1FJ1B 3CFDB 2UUDK 3ULUC 4IIQC 5CEZE 3BWAA 1H3UA 4PRNB 5F21B 5D1QA 3UPAA 1GVIA 4Q6IA 1MFCH 1T4KB 5F9WB 4HF5L 4OFVA 2M2DA 1N6QL 2V2WB 3INUL 4OUOA 4WEUD 5IBTL 3T0EC 4TVPL 2QTEA 3QIWB 5E1AA 3EYQD 5MENE 3BH8A 3CLFL 5FO9B 1GIGH 4JCMA 5E8PB 4OCWH 1N5AB 4O9HH 1J88A 3MFFA 4DZBB 5KSAC 4XMPL 5CGYC 1HK6A 3VCLA 5L9DL 2B5IC 3AS2A 3QDJD 3T0BA 1UWXH 4X6FA 3SOBL 3ZKMD 4X80L 2YXFA 5JQ6L 2GKIA 3LS4H 4YFLI 5CD3B 3U4BH 3VG9C 2AV1A 1NEZG 3MREA 3D18A 2P8MA 1C08B 1QLEH 1UADC 4HG4J 3MV01 5FFLA 4NZUH 3BP7A 3DRQA 4NQTA 1XZ0A 3SDCA 4R90H 1Q9KB 4YBLC 3P0YL 4MQTB 3MRBB 4Y7MA 2E3VA 3IRZA 4P5TC 5DJCA 4F9LC 2IH3B 4KV5F 1U42A 1EHXA 5JXAL 1X5FA 5E8EA 4NYLB 2EDLA 4W6XB 5HHXL 3I6LD 2FB4L 5MHSE 1BFSA 3TVMA 5D7JD 1JPGB 1FZOB 1HQ4A 4G6MH 3MXWH 1IAOA 3P4LA 4FZEH 3MLVL 2MQ3A 4FTVD 1E28A 3UTQA 3FKUS 1OAUH 3G04A 3RWIA 1UXSB 4GRMA 1KG0A 2YKLL 2A2QT 1VFOA 3UX9B 1CXIA 5I76A 1R5VA 2A73B 1QA9B 5I8CA 4GXVL 3LKRB 4G9FA 4URTB 3WNPA 2CIKA 3SY0B 5HDBF 3V4PL 3K8MA 3SCMB 1A47A 5TPWL 2XZZA 3PWJB 3S35X 2V9TA 1FDLH 2HWZH 5I0DA 5EO1A 43C9A 3PABB 4L8BB 3CVIL 2XRAH 3O9WD 1A9BA 5IEKB 1T66D 3HS0A 4PRHB 2C1PA 2ZPKH 3MRQB 1WIOA 4PJ5A 1EHLH 1B2WL 5B3NA 4UIKL 4ZOEA 2CLRA 5FM4A 1I1YB 1T3FA 5HSFA 1WZLA 3LMJL 2LTQB 1JNLL 1XGYH 3K4ZA 5HHNB 3IVKA 3KPRA 1SBSH 1MPAL 2CLVB 4MXWL 1J11A 4LASL 1FFPB 1DQLL 5ADPL 5EOCL 2MCPL 3F7PC 5GXBB 3KR3L 3KPLA 2Y6SD 2ARJQ 2CSPA 3MBEB 3H9SE 3RWGA 2Y07H 1E4XI 4HGWA 4YHOH 2SEBA 4TUKL 3QFDA 5IFHL 3QEGH 4M43L 5GRYA 4APQB 5IQ7L 5BRZE 1DZBA 5DZOA 4QOKB 2R2BB 5HYJE 3R06A 3WFCL 1XGQB 1A14H 4XBPB 1KB9K 3V6FA 2WMPA 1EFXD 1T21B 5C86A 2R0LL 4POYA 3AREC 2CGRH 2VZTA 3L5XH 2NY5H 4I18B 2Z91A 4MS8C 4J7RA 3U4EB 3KLHC 4NM8L 2AK1L 4LKCA 3RA7L 1A4JB 1BJ1H 4UOW1 5JXEA 2XPGA 3IJSB 3O4OC 3AS3A 4IBLT 4XNXH 4JKPL 1K85A 2AK4D 1FLRH 3RDTA 2NCMA 1CK0H 5F3BA 1F13A 3RZCA 1GGTA 4TYUA 3LKQA 4NJ9L 3A67L 4X4ZA 5JIKA 3I02A 4GUPA 1UWXK 3B9VA 3QI9D 4PD4J 5C0JB 2NQCA 3D2UA 2FHCA 4N1CA 1UXWB 2PXYA 1NDGB 1I9EA 4LGSB 2AJ3B 5B4MD 3HE6D 5D2NA 3TO4C 1JPST 2NY0B 4ODUB 1FO0L 4HUUA 4JN2B 3P0VH 5ILTH 3LQAL 3ARGB 4RIRA 3HG1A 5DJDB 4JG1H 3GJFB 4ZS7H 3TJEL 3OKDB 3QO0A 2NY4D 4G6FB 3RWCA 1RZIA 1RZKL 3U9UB 3GM8A 2QSVA 3QUMA 1Q9WA 3T3MF 4X6CF 3UJTL 3CD4A 3I3EA 2R4SH 5L6YL 2YK1L 2WLZA 3DTXB 3IJHB 3RL1B 4KK5D 2B1HH 3WMSA 1A6TB 2YA2A 3HRZA 3L3DA 1ADQL 1MVUB 2VLMD 4YGVA 3QCTL 4RGMB 4OM0H 2EDTA 2XKUA 4Z7UF 4Z76B 3AAZB 3MJ7A 2ERJC 2BSSA 1D6VH 2VE6A 3L3GA 3OHXA 2G60L 3CVHB 2XZCH 4NSKB 4LSPH 4OCYL 2CO7B 3B9DA 1GC1C 3CX5K 3ISWA 3P73A 4G9FE 5DEZA 3VWJD 1TLKA 2IC2A 5IVZB 1ZS8B 1MLBA 1OLZA 4X5WB 3TNNA 4F57L 5C0DA 2GY7B 5I66B 2N56A 1ES0B 4KMQA 3EYVA 2PCPB 3V5HB 3W11C 3M8OL 4LCWE 5EA0L 5TF0A 4JHAH 2A0LC 2AW2A 5E9DB 1MHPH 4Q2ZA 1RZJH 5J06A 4PGJA 3C60C 3GMNA 4RFOH 5BS0D 2LAGB 2ARJB 4K55A 1HILB 3V8CA 3BAEL 1MIEL 1FFRA 1UT9A 1ONQA 2GIYA 4K71C 3NCEB 4G8GD 5BO1H 4JZJC 2ZSWB 4HEME 3PG2A 5I1GL 3RWFA 1F2XK 4ZTOH 1G6RA 4UQ3A 3KPRE 4JO1L 3X12A 1IQWL 1EK3A 1YN6A 3CK0H 4X6DE 3MLZL 2FR4B 1VCAA 3A6BH 1LDPL 5DJXB 3TCLA 1R3IH 5H2BB 2PYEE 4HIHB 5EORH 1CR9H 1YEDB 4YHKH 2EIZA 2YZ8A 5C0ND 1DLHA 1JNNL 4EJ1C 2KZ1B 5FOJA 4ZD3L 5KSBB 2RGSA 4W70A 3MV8D 3FB8B 4M5ZL 4JJHA 4AT6A 2O5ZL 1I7ZB 3QUZD 5C09A 4XAKD 3CX2A 3WLBA 4E42B 1KEMH 1XH3A 2YD2A 1I1RA 2L4OA 1BX2B 1B90A 2FEEL 4MAUL 5DD6B 5EC1B 2CLZA 1FZMB 1XGTB 2ZUSA 3T08A 3QEUA 5JPMA 1KF9B 4L9LC 1MF2H 1QLFB 3RVWC 2FJGA 3FT2A 4NN7B 3G6AA 4KMLB 3VXUE 3V4VH 4NQDA 5A40E 5GRVK 4XZUA 1JI2A 1F3JA 5TFSH 3OPZL 2R1YA 3Q0HA 4NZTL 1X7QA 3PDOB 4PRPB 3FMGL 4YDLC 1FNEB 5DUPL 3CMOH 1UZ8B 5IJKC 3LDBC 4YXLH 2DQJH 3RX5A 3JSSA 1ZTXL 2WBJD 1XIWA 4XT1C 3U4AA 4MJ4A 1ULVA 5E00A 4K8RD 5SWSD 4FG6C 1Q72L 3BHBA 5D1ZB 1R3LA 4MNQD 1OM3H 2ESVD 4KI5C 3KJ6L 5HI4C 3D0LA 2NZ9C 4ODSL 12E8H 5CJOH 4QWWC 5I1CL 4HEPG 1CFVH 3FONA 5DS8B 3OR6B 2DQUH 4M8QA 5DYOA 4D9RD 1EFQA 3MLTA 5DSCB 2OR7A 3WD5L 1ZT4A 3MJ9L 4PJ8A 3VXSE 1AR2A 5IBLC 2I9TB 4A6YH 2FO1A 3TT3L 3QDGD 5F3HB 1CICD 3K2UH 2OI9B 3JTSA 4JDVB 4MZ3A 4KFZC 4NHCL 2C1OA 3F58H 5I2IB 3GMMB 4NRXB 3P40A 3DMMB 2JB5H 1DQTA 1QACA 5AZ2H 2W60A 3CH1B 5J6HA 2Q7YA 4F33B 3DRTB 5IEHA 1NDMB 5B8CB 2QQKH 3W9DB 3STBA 3BPCA 1NSNH 4R4BB 5EN2A 2DQDL 3MRMA 3ZDXF 5F9WC 4S10A 5IK3A 5IIEA 3UC0L 3GSWA 1C16B 5J12B 1H8NA 3IDMB 2OJZH 2D7NA 4KAQL 5TDPA 5EIQA 2IQ9L 4UTBH 5KVMC 4OTXH 1KCLA 2IANA 5EU6D 2F19L 4EOWL 2PO6D 3QQ9C 2DI9A 1EBPA 4PRAB 1WITA 2YZ1A 2VDRH 3QDHA 2B4CL 1BFOA 3P2TA 4YZFF 2J8HA 3UBXA 4P48A 5JHDD 4FXKB 3L3KB 3GSNA 5DJAA 5CD5C 1EJOL 5I1HH 3OTTA 4LHUA 4RGNC 2VDOL 1OF2B 2Q8BL 3AVEA 1ZT1B 5I17B 1NCCH 5DRNA 1NBVH 5GJTL 1MCRA 5JHLL 1G1CA 3VXRA 1HEZA 4HMDA 1JPTH 4JY6A 5E99H 5ACMA 2LFGA 3QQ4A 5J3HD 2J2ZA 2LVEA 5E7FA 3KLSA 5C09E 3QP3A 3MNWA 5KJRH 3QAZC 4U1NB 4LLMA 4UZGA 3RWDA 3QEHA 2VO5A 1A6ZA 4QHLA 2VQUA 5DRWB 1Z0MA 4LPWA 2Q7NA 1FL6B 1QEWB 4ODTL 4U1GB 5CCKL 4ZDHB 1EHAA 2VDML 3OKNB 3MLXH 4NQDE 3DGGB 2KKQA 2APWA 1QLRB 4NO5A 4XH2B 4IMLA 2VL5B 2D7MA 3RAJL 4RAUB 1EBAA 3ARDD 3HZYA 2B7DT 2CKNA 4XP5L 1SY6L 1U8QA 2NLJA 3T8XA 4LQFH 5FA4B 4FHBD 1XF2B 3GUTA 2D31A 4M7KL 4OD3H 4Y4HD 5C2UB 2X4UB 3EFFA 5FHBH 5F7DB 1BLNA 3O0RH 3SKUD 4A6YA 1JRHH 1J0HA 1BBDL 2LTQC 4AH2B 5ANMA 2Y7QA 3GM0A 1JYXA 2H8PA 1VENA 1DFBL 4XAWL 2VSCA 3UJJL 2PUQT 2VXQH 1DANU 1AQKH 3LKPA 5I73B 3BH9B 3MRFB 5D5MB 4KVNH 5JTWA 4IMKA 5ICZA 4APQC 3WE6A 1MCOH 5GRWA 5SWQA 3WHE1 1ED3B 4GRLA 4M6NH 1FYTB 5CILL 3VFWA 3W9EA 1Z9OA 4H1LA 1N8ZB 2OJEA 4L4TD 1U93B 3HFML 4J8RA 5T1DH 5I1AB 4I18C 5JLZA 1G7IB 4MAYD 1S8DA 2AGJL 1VADB 3MYJA 4R2GD 3HNVH 2DQTL 3FO0L 1XGRB 3JZ7A 4LBEB 3GNMH 4NPYB 5GZNC 1PG7X 3P30H 5FKAA 2D7TL 2VRAA 3TZVD 4KWUA 4HGKC 3QUKA 2DBLH 4IS6A 3MJ8B 3OG6B 4OZGA 3X3FL 1JMZA 1TCRB 1YN7B 2NY2B 4LIQL 4HS3A 4UT7H 4X99B 5FYJL 2HMIC 3FT3B 3TBTB 5IJVA 4M5YL 4MQ7A 1S3KL 1RMFH 1VEPA 2HLFC 3TPKA 5D7KD 2EC9U 2QHRL 1U8JB 3WDHA 3MUJA 1KCSH 4NKIL 3RJQB 2WINB 5FHAH 5D2LF 3ARGC 2GEEA 3K1DA 1A8JH 4LLYA 3TA3D 1F90H 5F6HI 4ZO8A 4OLYH 4OIBA 3LKOB 4JCLA 4X9HA 4KKLC 1J8HB 1RIUL 4PREA 1I7TB 3VFSB 1K4DA 1AGCA 1E27B 4N8VA 4O51B 4JPKH 5D72H 3THMH 3LV3B 4JY4B 4ODWB 2EDJA 4WW2A 2EIBA 3MOBH 1CL7H 2YUXA 2HFFA 4DUXA 3UAJD 4LLDA 4GAJL 4PJBA 3O6MH 4RAVB 4RGMC 5E4IA 4NN6C 2NX5D 3ZE1E 4ZUVA 5HDQL 1JWMA 5BVJA 2GTZB 3TIEA 1CXEA 4TOYL 2P4AB 1BD2A 4Z7VA 2X4OA 4KRPB 4NZRL 2BK8A 4HWEL 1Z5LA 4NOFA 3VXTA 1NEZA 1FG2B 3B9KC 5I1JL 1QFPA 3QXUA 4UQ2B 5HI3C 2E9WA 1NMAH 4LEXL 4GW4A 3BZ4B 1QSFA 4Y19A 5I74C 2EZ0C 4G6JL 3QJFB 1TQCC 5ID1A 3MV7A 1JK8A 4OI8A 2G9HA 2JJSA 3QUYC 3CFBB 1H3PL 2MPAL 5C0BA 2E6JA 2BC4B 5DJ2A 1WLHA 2R8SL 2AJSL 3MV9B 4XNUH 3T77A 4U1SA 2CDFA 3PHOB 4UT6L 3HLAB 5ANME 5JO5B 1IARB 1HE7A 5LWYL 1NBZA 1JYVA 4A2MA 3ZL4H 3IETA 1MNUH 5BV7H 1VACA 3HUJE 4YO0B 5IMLA 2AQ1A 4QXTA 4R7DA 1LWRA 3QH3A 1M71B 3LPWA 1ZGLM 1CGSH 1P5VA 1UWEL 5L2KD 4JO4H 4IRSB 1CQKA 3BN9C 7FABL 4OD1L 2JIXD 4FMKA 3WHXA 4ZS6D 3K3QA 3O3AA 3QHFL 5DD1L 1U58B 2Z31C 1U8IA 1AD0A 1D9KA 3MRNA 3ILPB 4QTHB 4I8DA 4U1MA 1CXHA 3VFPA 4F2MB 5LVEA 4GFTB 1YMMB 2XTJC 4HQQH 3QFJB 1EEYA 2C4FU 4H5SA 1CDBA 4QHUA 4D2NA 5HYQA 4PLJD 3IFNL 2ADIA 1CE6B 1CD0A 4HH9B 1QRND 1DBBL 3MODL 2E8ZA 3MFGB 5IT2L 3QIUD 2NY1C 3DX9B 2VH5L 5B39B 4LMQE 1D5XB 1QYGH 4OZGE 2FBJL 5D7LD 3FB5A 4RA3A 2ICWJ 3GSOB 2BHUA 1MHEB 5FYLH 1WZ1L 4Z7WE 3DXAA 4ETYA 2IADB 2DKMA 4XBEH 4FQXD 4HKJA 4WDIB 4PJEA 2DLFH 2F58L 5HI5C 3BEVB 5D1ZC 5KOVC 3DHJA 3PJSA 3QDMA 2FECL 4GBXA 1A4KA 1QNZH 1AR1C 1G9NC 4RQQB 1FPTH 4N9GA 2YA1A 1VKXB 4M7LL 2VC2H 4J12A 4PJBE 4H0GA 4HBQA 1M05A 3LZFH 4UNVA 2DN7A 3WYRA 2ICWI 3TEUA 1H3XA 5D71H 4K7PX 1I1FA 3EO9L 4Z7VE 2H32B 3MRRA 5F71A 4CJ0A 4QF1B 3N1MC 1ZT7A 1PX4A 2QKIA 1XR9A 1Q1JH 2OI9C 3G6JA 4JFPA 5FCUL 4OAWB 3MRLB 1PFCA 5T3XH 1A6AA 4KVCL 4RX4A 4WO4C 4NRYA 4KKNA 3GBML 4LPUA 2IQAA 3VXMD 1CG9A 3PWVA 4OQTA 1S9VA 2FRGP 2C4FT 4C56D 1YEEH 5B8CC 3U2SB 4B0MM 4G6AD 5K9JH 1MQKH 5GGSA 1E4WH 4P46A 4POUB 1JN6A 3MV7E 5CINL 4LDOB 5SWZD 4BFEA 1HN1A 5C0BE 1NCDH 3QG7L 3PV6B 4XC3L 1RZ7L 4R0LA 2OL3H 4HIEB 5JA9A 2EYTB 4WV1B 1U8NA 1Z9LA 2MNUA 5DJ6A 4ELMF 5CZVL 4I77H 2F54D 2GSGA 3ES6A 3LN5B 5L0QB 3LS5H 5DD0L 4MA1C 4P9HL 2UZIL 4JG0L 2Q76B 3UPCA 1IGCL 4MA8H 1J1PH 1ND0B 2VUOA 5E03A 4Y5YA 4NUJA 4HK3J 1UKQA 4WGWB 5IROA 1OARH 3C2AH 3DARA 4OUUA 5FA3A 4ZPVB 3PWUA 4HGMA 4P59H 3OAYH 1INQA 5CHNB 5EULV 5KS9F 3Q6FA 2XI9A 1PLGL 1YMHB 4UOW0 4MWFB 4IDJH 1NAMB 5GS2D 4XGZB 4FRWA 1BIIA 4Y8DC 2KQMA 2BNQE 2I60H 1A5FH 3EYFA 1MRDH 1AI1L 3BO8A 5HGDA 4YDVB 3BQUD 5C08D 1YYMH 3S88L 5D7IA 4RBPK 3GRWH 2R1WA 1KPUA 1S5IL 1JHKH 1I4FA 2BOBA 3RVUC 4GKSA 1QR1B 2AEWA 1IGTB 2APFA 2RQ8A 5E94A 1A7PH 4U1GC 2UWEB 4ZUSA 3KS0J 3OF6A 5F7WC 1OAQL 5E6IB 4TUOA 4JQIL 5ISZA 1DVFC 4E0RA 4Y4FA 2FECI 5GGTL 2FH8A 4QYOB 5GS0C 4WHDA 1XF4A 4O00A 3MRIA 5CKGA 4LSVL 3RY5A 5D6DA 3U6RB 4WY7L 1WWCA 2FD6H 4JFFA 5IFJA 4OLZH 2NTFA 3LQAC 2AJZB 4AQOA 4G42A 4HFUL 2P8PB 3SE8H 1LO5A 2LU7A 4AEEA 3WFDH 4Z5RA 1BZ9B 4PJEE 2AQ3A 4IHOA 4POZD 4LKXB 1JTOA 5FB8A 2V17H 4U6YB 1RZKC 2FO4B 3QDME 2CJUH 3DUUA 4JDTH 2DJSA 5IMMA 3EBAA 4F7TB 1CTNA 4MXVF 2JF1A 3UYOD 4HWNA 2PR4H 4Z95H 4Q74A 5EOTA 4WW1B 4L8DB 2VQTA 2FNBA 4JR9H 3NN8A 2IBZX 3OV6A 3TYFA 4OV5B 4W68A 4BZ2H 4PTUA 1YEFL 1KACB 3S37H 4Y2DD 2GCYA 3MA7B 4P4KD 5T33L 5JIHA 4OGYH 3IU3B 5CUSL 4U1LA 4M7JL 1D5IL 1NLDH 4JFHE 4NRZB 1PG7W 3NFNB 2A9NH 3KPSD 4X7TB 4NQCE 4YDKH 1KN2L 2Y36H 2EO9A 5BJTB 3FFDB 4EI5D 3SJVE 4K8RL 2JELH 5E5RB 4ONGL 1ACYL 2NY6D 3K8LA 1AXSB 3S97C 2HJFA 1N6VA 4OZHA 1FRGL 3ARTA 5TE7H 1JMXA 2R69H 4AG4H 5ERWA 2ZCHH 1AKJA 1FBIH 3TBSA 5AAMA 1GYAA 1NUNB 3EHBD 3QUXC 3QULA 5DI8B 5GPRA 4M7ZB 4FS0A 1L7IH 3QXWA 1JPFB 2D7PA 4XP1L 5D7JB 2R2HB 1A7OL 2NY2C 5IOPA 3KHQA 2PW1B 2BHZA 2H26B 3HC0B 5CLWA 4FQ1H 4YGAB 4FTVB 1LK3H 3IKKA 1HQRA 1N7ML 4QRRD 1W8NA 1EAJA 3KJ4C 5J7CC 3DVFA 3GRWA 1LK2B 3MACL 3IDXH 3BD4A 3GJEA 1T03H 2QADD 3DIFA 5DUBB 4C4KO 5CSGA 5MEQB 5DVMA 3UTSA 3O9WB 1J1XL 1OP5K 2GITB 2JK5B 3MOAH 5C0AA 3RTQA 2JJTA 4GQ9L 4U6XA 2DTML 4YNYA 5EU4A 3PP3H 5FYLE 4DQOL 1UWGH 3NABH 1DQJA 1WTLA 3RKPA 5EUOF 3CIQA 1K8IB 3C2SA 5KSUB 3VDBA 2IMMA 4OCSL 1WEJH 3QQ3B 4KRPC 3MRDA 4Y88A 2MJWA 1S7QA 3QWOA 4L3CA 1RUKL 4YEEA 1LNUA 4KRLB 5ISZE 1UKSA 4ZUWA 4X6DB 1N0XL 1HSAB 5BW7C 5I8EA 2X4SA 4U7SA 1T1XA 4ACPA 5C0CA 3VWKA 4RDQF 3CCHB 4X6EA 5JA8B 4JFFE 5BZWB 3ARWA 2N7BA 4P2OD 3VGDA 4BUHA 3O11B 3TV3H 1A7QL 2C4XA 3FQWA 4YJZL 3O2VL 3GSQA 1EFXB 3KPQB 5EZOL 3RWEA 3GMPB 4HC1H 5HVFB 1BFVL 2VXTH 1MRCH 3MPCA 4QT5A 5C6TH 2X70A 1KPRB 5I75B 3QPQD 1JV5A 1CLZH 5HJ3B 4KUZL 3OX8B 4MJ5A 4OZFB 3G08A 2WP3T 1NUGA 5T3XE 1I8KA 1A2YA 2AK4B 2VR5A 1W72B 1MAML 4J3SA 1Q0YL 5LQBL 3SGKA 1F4YH 4ZUUA 3S5LG 3VXUB 1X5IA 1JTTA 3DUSB 5FXCH 3JWDH 3QI9B 2AJVH 3TYGL 2MHAB 32C2B 3NA4A 4QXGH 5LCVL 4EVNB 1JUFB 4MA3B 1JTPA 5IHZB 1T89C 3HE6B 3MLSL 4FQ2L 2BRRH 1JF1A 3V5DA 2H3NB 4JANA 4LLAA 3PWNB 4J3XA 5IVXA 2R4RL 1GOFA 1RUQH 5FYKD 5JR1H 4HXBH 3HTLX 4MSWB 3U7AA 1U9KA 2NY4B 1IC4L 4MMZC 4XNQA 1BECA 3GGWB 4OZHE 1FG9C 2WWKT 3BWUC 2APXA 3ZDZF 4MCZA 3O2DH 5D96B 3MMEA 3DI2B 1I1AC 4Y5VA 4R4FH 1YEHL 4ZAKB 4BELD 1I8IB 2XWJA 1G7QB 1AC6A 4WNQB 2JTDA 1OGAA 5T5NG 2B4CC 4HMCA 3RY6A 3VXSB 1GHFH 1LILA 1MFBH 4RAHA 2VZ3A 4NQXA 2HKFH 4KJYB 4PJ5D 3F7VB 5GGQH 4PJHE 2OTWA 3CFEB 4AEIL 4Z78B 3AB0B 3DURA 4F7MB 5I18L 2HFEB 4KKCC 4I3SL 2A6DA 5E4EC 1N59A 3VWJB 1ZEAL 1F4WL 3IT8D 3P9MA 2R1XA 5CEXA 1KULA 1S5HB 2A6JB 2Y1VA 5DTFA 3OKEA 5D6CB 1RURH 3I2CH 1NGXA 2QQQA 1NGPL 1OQOA 1A7RL 1ZV5A 1IZKA 1S7TB 4LVNB 3NCCB 1RIHL 4N0UE 2WSKA 1YNTA 5C0AE 5BS0B 2CMRL 4QRTA 1W2KT 4G8GB 2V5YA 1JJUA 3NIDF 3ZLQC 3FHQA 2DTSA 3VI4F 1AXTL 4UV4H 3MRKB 4BM7A 2DIAA 4LSQL 5C71A 3GMQB 1I8MB 1FL5B 4QTIH 3ULUH 3HNSL 4WI9A 1KELH 4LSRH 3T2PA 2WUBH 4RGOL 5MERA 4HC1A 1IFHL 5DHYA 1MCEA 1G7LB 4PG9A 1MCIA 5ALBH 3RDTD 2VITB 1KTDA 4G43B 3WCYA 3RZCD 1BBJB 4GKNB 3ALXA 4HUWB 4OF3A 1X5HA 4K9EC 5TDOB 1FN4B 1RAMA 1A1MA 1DUZB 5TQ2H 5KVEL 3KYNB 2XA3A 3GHBL 5HBBA 4NFDA 3X13B 2RHEA 3MV8B 4HKZA 3I6GB 3BGMA 4YBQC 1EUTA 4R97B 4OKVB 3WJJA 2HVKB 5KTEH 3CGTA 3CLEH 5JOFB 4NNXB 1IAIM 1YUHA 3O6FD 1KGCD 4XPTH 2ENYA 2X40A 1BHGA 4JRXA 3HG1D 2R56L 1JHTB 3WIHA 5KSVB 4P49A 3SE9H 2IAMA 4WI8A 2DLIA 4GRWB 1UACL 3K80A 3WHE0 1JCKA 4OZ4B 3IGAA 4LNRA 4BKLA 4U4BA 1PZ5A 1FHGA 2YPVH 3TIDA 4XCYA 2KBGA 1INDH 2Q1EA 3EYSL 3SPVA 1A3QA 4WUKH 3V5KA 5GS1C 1DE4B 3O2DA 1RIVL 4GRWF 5DGQA 4OBSA 1KJVA 1T1ZB 4I0KA 1AH1A 4D3CL 3CFJB 1FAIH 4V1DE 1QSED 2XFXB 4JFEA 5E08L 4XMKL 3JXAA 3TH4T 4PP1C 5IVXE 2WBJB 1NMBH 2OSLA 3F5WA 3HCVB 1RULL 3I84A 5M95B 1BGXL 5IB3B 3MRHB 3UDWC 3RX8A 3QZWB 3UYPA 3L3OA 2XG5A 3V52H 1KIPA 2O5XL 4LSTH 4MNQB 2ESVB 3AU1A 4OD2A 5E6YA 4RFNC 4Z7QE 2JCCA 3BKMH 1GAFL 3O3EA 5C0EB 2BVTA 2W9EH 1ZGLB 3OR7A 4XCCH 2YUZA 4QHNA 3D69B 3O3DB 1OW0A 1Q94B 4FFVD 4XX1G 4ZFZA 1L7TH 3C87A 5E6IC 1OGAE 4PY7A 1FL3B 1JGUL 4P5MA 1H3TA 4NCDA 5BMFH 3L3HA 4OLVH 3WN5A 1ZVYA 1U8KB 1GGCL 1RZ8B 3MC0A 1ZHNA 3Q1SH 4CJ1A 3IAGC 3EOTH 1CE1H 1CICB 4JAMA 1Z6JT 1ETZB 2ZG3A 4CN6A 2YPKB 3NPSB 1OCWH 4I48A 4HHAB 4MNGA 1QFUL 1YY9C 1SHMA 1SM3H 5LGHL 4RNRB 2J5LB 4GLRH 4J3UA 4Q9QL 1MOEA 4M6OH 1R3JA 2JB6A 5MI0C 3STZA 4X98A 4L5FL 4G5ZL 4IIQA 4LPYA 4HV8A 1MI5D 3W0WA 5IGXL 2YEZA 4XC1H 3VD7A 4M6MH 3FTGB 5DK0A 4GW5A 3ZMRA 3O2WH 1PEZA 4PJDB 4PYHA 5BXFB 3DUHA 5CBAB 4I13B 3MCLL 5IFAL 3T0EA 5F7YC 4EDWL 2GTWB 5I1IL 4ALAH 4PJDF 2HH0H 5FKPA 4L1DA 2VQ1A 4U3HA 4OCXH 2DJUA 1OAKL 3PQYA 1T0NB 1P1ZA 2NW2A 2DQIL 2IGFL 2VZUA 3ZKMC 5IW6A 5JHDB 5MEPB 4KKBC 1NFDF 3MRJB 2X4RB 2ZUUA 4JM4L 1I9RL 5ESAA 3ARFA 2YBRB 1N6UA 35C8H 4JM2F 2F74A 1WC7A 1G1YA 3FQXA 3RL2B 3N9GL 3GI9H 4TQEL 4CRPA 3BMVA 1BZ7A 1Q9OB 1H15A 5I8OL 1HNGA 1EEQA 3ALPA 5DUMH 3MJ9A 4PB9L 5I71B 3EJZD 3K2MC 4DUVA 5EBLA 4MZ2A 4U6VH 4F37F 4M7ZC 1IQDB 4WEBH 3WS3A 2IPKB 4JRXE 1XIWD 3ARBC 4KJQC 4X4YB 1HHKB 3NFPB 3ULSB 4PGDB 4MHHI 2X4TA 4U1HA 1AQDA 3HAEB 2X44D 3K4DA 3U1SL 3GKWH 3G5ZB 4PJ9A 5AAWA 2WV3A 5JUEL 3S36H 4Y4KA 1INEH 1YQVH 2ZKHL 3KPMA 3RUGA 4RWHA 4UDTB 1J5OH 1CDIA 1KCRH 5EBMA 4FP8L 1CN4A 1FNSL 4DW2L 3ARDB 5KAQF 1YEJL 4JFEE 4Z7NF 2B8OT 2E27H 3AY4A 3DX8A 3O9WC 4D8PB 3NVQA 2XNAB 1T66C 4Y4HB 4GG6A 3U0WH 4MX7B 2WBWB 4R3SA 4WHYG 4NO3A 5AYUL 3WSQL 2UY7A 3M07A 1TVBA 4PV8A 2XOTA 1M7DA 1X5LA 2Y06H 2JCCE 5EO9B 5E5MA 3L3IA 1ZLWK 1MHHA 4IJ3B 2V9RA 5ADOL 1KTLB 4DK6A 5ICYB 3OXSB 2A6KA 2B0SL 4RISL 4OFDA 2Q8AL 3HUJB 4WU7B 2AXGB 4MDIB 3JTTA 1D3CA 3MUHL 4X5XA 5EC2A 5B21A 4JFXB 5DQJA 1AGDA 3VI3F 4M1CD 3LPFA 2IAND 5HHOE 5GGRY 1YECH 3GK8H 1C7TA 4LHQB 4YDJA 2P46B 4BZ1H 2J8UA 4ZSOA 2WP3O 4L4TB 1CLOH 1R5WA 2Z35A 1J8KA 3LKSB 1PG7L 1U8HA 1HXMB 1J18A 1BQHB 5I75C 4MAYB 3ULUE 3W0WE 1WBYA 3E0GA 4MS8D 4XP4H 5DLML 1HH6B 3BXNA 4P2QA 4R2GB 1JBJA 1W0VA 1IT9L 3RPKA 3QA3B 3IDIB 3Q2CA 4Z7OE 3C6LA 4XPFL 4NWUH 4PJFE 1DEEB 3T0EE 3TZVB 5IESL 3VXRD 2BVPB 3KXFA 4G8FA 1WJ3A 2BNRA 3SKMB 2X4NB 3HZKB 5SX5K 5TDNA 1HH9B 3K4AA 3VFOB 4MCYA 2ITCA 3MYZA 1DQDH 4XPBH 5DD5L 1U8PB 2QSCH 1AO7D 4UILL 3GMRA 5B4MC 3HE6C 1AP2B 4J1UA 4Z7WB 4NP4H 3PL6B 3H7LA 1Z3GL 3TO4D 1YJDC 1NLBH 2DQEH 2ATKB 1QFWI 1IAIL 3D3VE 2WWKO 3QHZH 4OCLC 4TTGA 3BIKA 4UNTA 5A16B 4HJJH 4JO3H 3OKMA 1A02N 3U7WH 1UB6B 4KDTC 1OAXH 2XXMB 5TH2A 4PJ7B 5C6WH 5CSZA 4BFIB 5D96C 3H3KA 1QVOB 1CGUA 5CBEA 5FYKU 4KK5C 3T1FA 3BKJL 2GK0A 5HGHB 2W9LA 2BCKB 1R24B 3MTRA 2MOVA 1U3ZA 2NX5B 4P9HC 4LDLB 1JGLH 4TSCH 1I7RB 4PJXE 1KUMA 5HVWA 4RMRA 3REWB 5DC0A 5FV1L 4F80A 1IC5H 3GO1H 1MCLA 2LQRA 3H7BB 3GIVB 3AB0C 5D7SL 2W38A 5I8KL 1RPQA 1FGVH 3FQTA 4P5KB 5F6IC 1U8MA 3ROLA 3RUGE 3ZDYE 1U8LB 1CDHA 5KW9L 2QSQA 1HNFA 5EBWA 4YPGB 1IM3A 3EDKA 4HIXH 1HZHH 4LVNC 1EGJL 1AD9B 4GG6E 1CBVL 4F3FA 4OT1L 2EE2A 2VIRB 3C60A 4JGUA 1PBYA 3JWOH 2ICEA 4K7PY 3HR5A 5EZIL 5T1LD 4KJPC 4WVRA 4PJCB 5D93C 5B3JF 1FE8L 4TTDC 1MCQA 3GIZL 3VGAB 3HPJB 1AGBB 1S7UA 4PJGF 1K3IA 3FOLA 5JOPD 5T3ZH 5DMIH 4PJCF 4U1JA 4PJAA 2EKJA 1KNOB 5ESVB 1K8DA 1A1NB 4R8WL 5L2KB 4X4MA 3VFVA 4UDUB 1NJ9A 1F3RB 2AKRB 2EDNA 3MLYL 4OZIA 3FZUD 3ECBB 4N0FB 5FDYA 3AXLA 3D0VA 3PHQB 2J8UE 4ZSOE 1P4BL 3MCKA 1IGFL 4ZTPL 4I9WD 4ISVB 4O02H 4HFWB 4M1DL 1G7PB 1TJHL 1KFAL 4R97C 3WEXA 3RY4A 2BNQB 3QUZC 3OKOA 4IRZH 4P2QE 5E2WL 4BQ8A 2BVQB 3TN0D 3HMXH 3DO7B 3SDXA 1ZHLA 2QQLH 4L4VE 1X6NA 2VDLH 5F7UA 1TTFA 3KPNA 3L5WB 1QRNB 2O5YL 1IGYA 2FZ3A 3FFCA 5AUMB 3MXVL 4TRPL 4I3RL 4L8SB 5GJSL 2GJZB 1WWBX 2ITDA 1EMTL 3VG0L 5DRZA 4ZUTA 4HCRH 3SDAA 3KXFE 1KLFA 4Y16D 3QIUB 2NY3C 3DJ9A 3FRUA 2ICWA 3S8WA 1EO5A 1FIGH 4J3WA 3B43A 5D7LB 3D9AH 1MJUL 1LD9A 1KJMB 1KIQA 1QPXA 3QNYA 5CP3H 3JUZA 3P11H 1XCQA 1P4LA 3AM8A 3T09A 3ZT6A 4OCRH 4TSBH 5A1AA 4AENA 4MLSA 5C92A 3O4LD 5FUZL 3KS0H 1LP9B 1BVKA 1EEZA 4LEOB 2WBJC 4FQXB 3RP1A 1L6XA 2BJMH 3QXVA 4K8RC 5CJ5A 4PRBA 3ILQD 1P7KA 3W81A 3NCYP 3LIZH 3RRQA 1JIBA 2RR3A 2YRLA 2BVOA 3FB6A 1U3HC 5HI4D 5C2BL 3I85A 1CVRA 2J4WH 4PP2A 3REVA 3HI6L 2IPTH 2XXCB 4K7PL 3S34H 2IWGA 1LEGB 4Y19D 4QWWD 1U36A 4Z8FL 5F44A 2CKBB 1PKQB 2OK0L 4F58L 2B1AL 4PJIA 3S5LA 1FH5L 3LRHA 1MIML 3T4YA 4HJGB 2VXSL 4LQ1A 1UGNA 3DVGB 3O8XA 1CICC 5I1LA 1V7NL 5E8DH 3VFMB 3H9ZA 1QG3A 1B0GB 3QB7C 3NPSC 4N0RA 3N1QC 5EU3A 1D5MA 3OXRB 2V7NB 5FM8A 2FX8H 4PB0H 5CAYB 4NQCB 1RUAL 4O58L 5DJ8B 2X4QB 4P2RA 2B2XL 5LBSH 3VXMB 3GI8L 4H88L 2ZCLH 4C56B 1FJ1A 3CFDA 3MLUL 4CDHA 3SJVB 4DVRH 4PRNA 4XPAH 4JRYD 1LEKB 3CDYA 4JN1H 1HYSC 5SWZB 1T4KA 3TC9A 3I3DA 2EEDA 1AY1H 2ADGB 3JV4B 1MJJB 1UYWH 5I19H 2V2WA 3QIWA 5F1OB 2N7AA 2PO6C 2EE3A 4PR5B 5FO9A 1NEUA 5E8PA 4QHKI 3FQUB 2F54B 4AM0B 4DZBA 5ICXB 4JM2C 1TJIH 1S9WB 3VW3L 4JFDE 2W65A 4PUBH 4PJAE 2OMBA 1JF6A 5I1KL 1G9ML 3P4NB 5CD3A 4RGND 4OKDA 4X4ME 4Y1AD 1QHOA 1VFUA 2GFBB 2VUYA 1KCKA 4NKMB 3VMNA 1CF8L 4OZIE 1Q9KA 4ZXBA 3KAAA 1TZIB 3MRBA 4OLWH 4HCRA 2VLRA 5SV3A 1ZLVH 4LRNH 2I07B 4NJAH 5B38A 5LGJB 2IH3A 5J3HC 4HZLB 4P3CH 3OKKA 4UB0H 3DXAD 1Q0XL 4DN4H 4JJ5B 4NYLA 3SDXE 5MEOB 3BQUB 5C08B 5DA0B 2XWTA 3VDCA 1JPGA 5DK2B 4OCWL 1UB5B 4O9HL 1MY5A 3DSNA 3FFCE 4CW1B 3GJFH 2Q3ZA 3P4OA 4P2CG 5C0RH 2ZUXA 3WIFA 3ZKSD 4AY0A 4OM1H 4GBXD 3LS4L 2A73A 1QA9A 3U4BL 3S37X 1P6AB 3LKRA 2CR3A 1T0MB 1QLEL 4FXGB 2NR6D 3SY0A 4NZUL 3SCMA 3DSFH 3ARDC 5D70L 3D1MC 1IJ9A 3PABA 4YHMH 2XYCA 4L8BA 4PY8I 4Y4HC 2EYRB 5DRXA 5IEKA 1ACZA 3CVHH 3RWJA 1BJ8A 3LD8B 3MRQA 2FJFB 3FB7B 3GB7B 3CMGA 2V2XB 4RX4D 2J8OA 4KI5E 4IJ3C 3OJ2C 5ENWB 4KY1H 1I1YA 1S9XB 5HVHC 4NQVB 3VXPB 1CZ8H 5HHNA 1O7SA 5T5FL 1PYWB 1XR8B 1TNNA 1OAUL 4P46D 1GGIL 2CLVA 4LRIA 1BQUA 4UV7H 1FFPA 2HTKD 3QUML 5B39G 4Z6AT 4LP4A 1NCTA 3RX7A 2EICA 3HE7B 1KB9J 4Y2DB 3MBEA 1NFIB 1MCNA 2EXWD 4APQA 2P1YA 3DLQR 2OL3B 4XP9H 2IH1A 1IAKB 2R2BA 2HWZL 3KPSB 4P2RE 1T5XA 4XBPA 3R1GH 2UVEA 1T21A 5FGCE 4MAYC 1OQXA 3UPRA 4I18A 3PV7A 3U4EA 2ZPKL 2AJYH 2XQBH 1ZGLP 4R2GC 5T3ZE 1UZ6E 2NY6B 1EHLL 3UTPE 5FO8B 4NCC2 4X4XB 3UCRA 3IJSA 3WNKA 1T0PB 4DOHB 1RJLB 4F9PA 3B8SA 3MA9H 3TZVC 1SMOA 1XGYL 2Q20A 4KHXH 2AJXL 1SBSL 1J12A 4NWTH 4XXCC 2CRMA 3E8UL 1BQSA 1MFAL 2ZG2A 1CU4L 4WHYH 2OQJA 1KTKE 1GZQB 2RJMA 3F12B 3OJVC 5C0JA 5D9SA 4WCYH 1KBGL 1UXWA 1BP3B 2DQHL 1NDGA 3G5VB 4KK9C 4D0BA 5EZJB 5IP4A 4YHOL 3RQ3A 2AJ3A 3FN3A 1QFOA 3QEGL 2G2RB 2W07A 1NGYB 2YN3A 4LHJB 4ODUA 3TA3C 3INUH 3VMOA 4TVPH 1KSRA 1A14L 1G6RL 2E9BA 4J3VA 5DJDA 1C5CL 1G7MB 1D6EB 5CSBA 3GJFA 2CGRL 3L5XL 2NY5L 4Y4FD 2YMXL 2E9IA 3OKDA 1ZLVK 1Q9LB 4KKLD 5C0IB 4BYHA 4UUJB 2QADB 2X89D 4U3CA 3U9UA 1L0YA 3RI5F 1AGFA 5ITFB 4XNXL 5FEBA 2HLAB 3SOBH 4DUWA 3IJHA 3DTXA 3NCBB 5DMKB 3LSOB 3UYRH 1CK0L 1A6TA 3SE4C 3B8YA 3LEVL 4XPGH 3M45A 1A7NH 2UZYB 4Z76A 3AAZA 3CX5J 3P0YH 2ZOKB 5DGRA 2ZNWA 4X5LA 5C7XL 5AD0B 4K2UH 4L29B 1G9NH 1SVZA 3KHOA 1DN0B 3B9KD 3C6SA 1PY9A 5HHXH 5IVZA 5A3ID 3BH8B 1L9NA 5HI3D 1UEYA 1A6PA 4JG1L 1ES0A 4NQSB 2PCPA 3V5HA 4E41D 4F7EB 4P2OB 5J1AB 2PN5A 4CKVX 5E1HB 3DVNA 2C26A 3C5ZC 1SJXA 5E9DA 1IEBB 3L7EB 3IXAB 5I0ZA 4HJ0D 2YKLH 4LLUB 4PRHE 2R4SL 5CJXC 1ORSB 1RZGA 1HILA 3TESA 2D4FA 4XPHL 4GXVH 1VGEH 3IU4L 3MREB 4KTEH 3SKOB 3FOMB 4JPIB 3ZSTA 3V4PH 4XVJH 3BP7B 3DRQB 2ZSWA 3QR2A 5TPWH 2P5WD 2I27N 4OM0L 4ERSL 4AEFA 1S9YB 1D6VL 4XB8A 3EJJX 2R23B 2FR4A 4LSPL 4YWGH 1N0LA 5C9KA 5KBNC 3CZFB 4OGXH 3BN9D 4MD5B 5DJXA 5E8EB 4UIKH 1Z9MA 4CMMB 4XI5C 5IVOA 9CGTA 5H2BA 4HIHA 1YEDA 1HKLH 4KHTH 4QOKE 1I8LC 3SN6N 4Q9RH 2ZJSH 1NMCC 3VD3A 4LVEA 4WFEE 1KJ2B 5KSBA 1A6UH 4AJ0A 1MPAH 4MXWH 2GJ6A 4LASH 1RZJL 3FB8A 1AHWB 2EH8H 1I7ZA 5I76B 4PLJC 4WTXA 2R0KH 3KYOB 4HWBA 1CFTB 3TBVB 3ZE0E 4HS6B 5T1KD 1BX2A 2CIKB 5IFHH 4M43H 5EC1A 5IQ7H 4XX1E 1JZ6A 2EIDA 1FZMA 1XGTA 2PTVA 2FHFA 3WFCH 4S1SH 3QIUC 1QLFA 3L7FB 4G6KH 2NY1D 3CK0L 5FM5M 1N2RB 3ZKQD 1X6LA 2AXJA 3UTSD 1TDQA 3D87B 1A9BB 4ZOBA 5F1IB 2ZZUT 1TQBC 3ARZA 4NM8H 4PJ5B 4C58B 3PDOA 3RA7H 3ZTNH 1X4ZA 4PRPA 4WGVB 5DC4B 1FNEA 4ONFH 4U6HB 1UZ8A 4DKFH 2CRYA 5EORL 3MLRH 4FQXC 4X6CE 3ARQA 4NQEA 3AMLA 5HI5D 4NJ9H 3GSNL 3VFUB 4JQXC 3BDYH 5D1ZA 1QBLH 5GS0H 5DEFB 1H5BA 2P47B 4TUJB 5C0CD 4HGWB 4MDJB 4HPYL 3C8HA 1B0RB 3PWPD 1S7XA 1PGRB 1U3YA 2DMCA 1RK1A 3R06B 5HD8D 3OR6A 3I50H 1HI6B 2VXVH 4K3EH 5DSCA 2COQA 4LCUB 3EFDH 2CRZA 3TJEH 2EDHA 2X10A 2I9TA 1UFUA 4LKCB 5F3HA 2FYYB 1IBGH 1CFQB 4JDVA 3CMOL 3RBSA 4KPHH 2VL4A 3K46A 1YDPA 5I2IA 3RDTB 3GMMA 4YXLL 3DMMA 4WO4D 5HGAB 4EQ3A 2CH8A 5E0QA 4O2EB 3CH1A 3NACL 4PRID 4F33A 2I9LB 1NDMA 2ZUVA 5B8CA 1TVHB 3W9DA 1DBAL 4GUPB 4ZFGL 3GHEH 4R4BA 5E9DE 4C55A 1VFAB 1OM3L 3N06B 1C16A 5C0GB 3IDMA 1T83A 4OCYH 4YHNA 4H26B 3SDDC 1ZOXA 3VGFA 4YHZH 1IGIH 4HUUB 2HT3D 3O6FB 4AQ1B 2DQUL 1TVDA 2VWEC 4PRAA 3HG1B 3EKCA 4F57H 1L0XA 4WI4A 2Z8VC 4A6YL 4FXKA 3L3KA 3I75B 4AEHL 3K2UL 4OIIH 4XWOD 3VFRB 4Y5XC 2Q3AA 1OF2A 1MIEH 4XCFH 2JB5L 1IEHA 1ZT1A 1HCFX 2IPUG 2IBGA 3BIAX 4YGVB 2QQKL 5I1GH 5IW3A 1QSEB 1NSNL 5KSBE 4JO1H 4D0DB 4NFCA 2VE6B 4R26L 1KB5B 3MLZH 3UZQA 2YD9A 5HPMB 2XTJE 1SJVA 3BQUC 4UTBL 1HIML 4HPOH 4FQHB 4OTXL 5CWSB 4U1NA 1JPSH 1QOKA 4OZFG 1MLBB 1CVSC 3TNNB 3HZMB 5J13C 2VDRL 5J11B 4MQXD 4TVPE 2VNCA 3HKFA 1MJ7L 1QEWA 3O45B 3UBXI 1UVQA 4TPRH 5CKAA 4ZDHA 2MSPA 3OKNA 1XAUA 4M5ZH 2O5ZH 4JE4B 1MH5B 2VB5A 4PRPE 4XH2A 2VL5A 5J6GB 3S98A 4MAUH 1NCCL 1CIUA 1NBVL 3JVGA 1G6RB 6FABH 1XF2A 1JPTL 5HHVH 5E99L 2X4UA 3X11B 2R0ZH 1YN6B 2IALB 5F7DA 1T04B 5I30H 3BD3A 1MI5B 4NZTH 5DXWA 5KJRL 4L8CB 4HK3N 4AH2A 4CN4A 2WBKA 5DUPH 5J4MA 3MUGB 2FL5B 4WFHD 1ZTXH 3ZKND 3JWNC 5JW5B 1ZKAA 1RFDH 3HC3H 5I9QB 5LG1A 3MLXL 4HLJA 5C70A 1BAFL 2E7CA