1IGTA

Structure of immunoglobulin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
214
structure length
214
Chain Sequence
DIVLTQSPSSLSASLGDTITITCHASQNINVWLSWYQQKPGNIPKLLIYKASNLHTGVPSRFSGSGSGTGFTLTISSLQPEDIATYYCQQGQSYPLTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG2A INTACT ANTIBODY - MAB231
publication title Refined structure of an intact IgG2a monoclonal antibody.
pubmed doi rcsb
total genus 41
structure length 214
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 1996-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igtA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igtA01
2W07A 3LQZB 4JHAH 2KQNA 2IAMB 5DI8B 3W0WB 4MNGA 4ZO8A 3QG6B 1S5HA 4G8GD 4P4KB 1FL3B 1RQ5A 3LKOA 1QEWB 5CEYA 3I2CH 4JFDA 1MFCL 4NGHH 4J23A 4WIQA 1UVQA 2F58H 1AY1L 3EO0B 4PYHA 2BMKA 1AP2B 1L7IL 3FONA 2NY2D 2PYFB 4UQ2B 3P77B 3PHOA 2F54E 3IU4L 4IHOA 3TT3H 5DGQA 1AGEA 4Z7NF 1E4KA 1IGIL 4G6AC 3SDDC 3M1BB 2XKNB 2GK0B 2K7QA 4PG2C 1P53A 1VENA 4RAUB 3IFLL 2VQTA 1QYGH 1RJLB 2E5EA 4MDJB 4Z7VF 1RZJH 4Z5RB 5KZCB 4G6JH 1MI5A 3WJLC 5B38B 1P6AB 1RUAL 3R06B 1I1AC 4I0PC 1QHOA 4JM4L 3VXNB 1AQDB 3ILQC 4HKBA 2ZCHL 4CU7A 3QEGH 3LCYA 1H3PL 1CE1H 4YBHA 1T80A 5AWNH 3RVXD 4XPFH 2IPKB 5A43C 1R3IL 1NSNL 3LKSA 4M3KB 3QG7L 4YHIA 2V6HA 4Y4KC 4KTDL 2M8XA 1NFDE 1VFMA 5T5FL 2ZUXA 5HGDA 5GS1B 2F54A 4S1SH 4NQED 4LSSL 2P5EE 2IAMC 1MRDL 4PJAE 3VXTA 3DV4B 2EEDA 3G5ZA 1DQTA 3QSKB 4P4KC 5DWUH 4Z6AT 4UNVA 2HLAA 4G42B 2W60B 3ZMRA 1X5LA 3HAEB 5HGBB 5LG1A 2PYEB 1OAKL 4JY5L 3SE9L 3CDYA 3ZDYE 3BRGC 1HHJA 4XNZB 5E8PA 2VXSL 5JIHA 3H42H 2P5WD 3MRDA 4HGKC 3U30B 4ZMAT 1EDQA 4OZIF 1Z3GH 2Y4SA 2D3VA 3CH1B 3JTTA 5F1NA 1OAQL 4IBLT 4O2CA 4N0FA 2BSTA 3MNWB 4YAQB 4HUNB 5C0IB 3ZDZE 4XZUB 1N8ZA 1LO3L 3NH7L 4HJGA 1CGXA 4RNRA 4KKLC 2HJKB 4U1KB 3HZKB 5CP3A 5DSCB 2GQHA 2NXZB 1NFDA 3M8OL 4HBQA 2P5EA 5IW6B 2FD6L 1QFUH 5GJSH 3BVNB 5D7JD 3KLAB 3GM8A 5A2JH 5DFTA 2X40A 3VWJA 5T1MB 5SWQB 4M7LH 3NA4A 4XVUD 5IT2H 3TVMD 2HT4D 3OKKA 4CU6A 3TESA 3G6DL 3T8XA 2X4RB 1KXVC 1MLCA 1H3XA 3KXFE 3W0WE 2X4QB 3SKUD 4GMTL 4GQPH 2FCBA 4DN3H 5I18L 3C60B 3EOAA 2YMXL 3B9DA 4ENED 2VABA 5GS1C 5BQ7A 2R2CA 3MROA 2E7CA 1KEGL 3WIIL 1E4WH 4F7MB 1Q1JL 1PGRB 3RTQB 5C0CD 1N4XL 1C12B 2GIYA 5I16B 1QPXA 5LAXA 1XGYL 3K80A 4XNZC 4IS6A 2X1XR 4ALAH 3DX8B 2OJEB 3U30C 4X7TB 3VW3L 4P0DA 5DUBB 5T33H 4KH2A 1XH3B 4LSPL 3BZDA 4N1CA 4Y5VA 4V2CB 1BX2B 2DQEL 4JFPB 1MEXH 4FABH 3KPMA 3RVUD 3KXFA 4H8WL 1PLGL 4BQBA 3W0WA 5DI8A 4R4ND 1UQSB 2VH5H 4AMKL 4LHJB 3UBXB 3ARGB 3IKKA 4R26L 1FL3A 2XG4A 3OSKA 1QEWA 2DLHA 2ZG2A 3LN4B 2RJMA 1OAXL 2BJML 2W0PA 1MCLA 3PWPB 4FQLH 2JE8A 3EYSH 3U6RB 4NWTH 2PYFA 4X7EC 4UQ2A 1MIEL 2P8PB 3MREA 1Y0LB 4IJ3C 3QCVL 3QT2A 1XGTB 3E8UL 4TVSa 2AQ2A 3VDBA 2IADB 5TQ0L 2FATL 4H0IA 3G6JF 5CEZL 2CMRL 4YFLF 3B8SA 5LQBL 4LLWB 2PYEE 4KRPD 3HFML 1YEFL 1XR8B 5D1ZB 3BIAX 3QEHA 2CIKA 4RAUA 3ROLB 5I1GH 3QIBD 4MDJA 3RTQC 3V0VB 4U49A 3QI9D 4N68A 4HLZG 1A1MA 5DRZB 4IOFC 2X4TB 1CF8H 3R06A 4BSWB 4XWOC 3SDXB 1EGJA 1AQDA 4H20L 1KB9K 1MPAH 4KPHH 3LEXB 3U0WH 1M71B 2IPKA 4MD5B 3D18B 4HWBH 4NBZB 3O6LH 1S9VB 1U92B 5IEKA 4M6OL 3MRJB 5KVGL 3BW9B 4PJGA 3WIHA 4LSQH 3MACH 1CXEA 3FQNB 5JXAL 1ZSDB 4LLVA 4R4FH 1NUDA 4EKXA 1AGFB 1CGSL 4G42A 3HAEA 5IHZB 1AD9A 2PYEA 3TF7C 2B2XL 1BZ9B 3P30L 4XGZA 1NGQH 4KV5E 3WYRA 4U1MB 3ZT5A 5C2BH 5CINH 1UC6A 1MWAH 1YEHH 2FYYB 2NY1C 2R0WL 2OR9L 3SCMD 1X5YA 5D7KD 4G8IB 4APQC 2Q7YB 2MCG1 2V2XB 4ZNCD 4Z77A 3QHFH 4KXZI 5C8JB 3MNWA 4HAGA 1ZLWK 4YAQA 4UTAL 4ZS7L 5FYLL 1JTTA 2BC4B 3OR6B 3P9MB 4X0KA 5CCKH 5L8JB 2V17L 3PWLA 5D1ZC 1VFAA 1CTNA 1HE7A 5I8EB 3HZKA 5DSCA 4TQEH 3TWCL 4PTTB 3UTOA 1LD9B 3BHBA 4OGXL 4OM0L 5IW6A 1OW0C 2F8XC 1L0YA 2UYLA 1YY9C 3Q6GL 1TCMA 4JRYB 1S9XA 1I85C 5SWQA 1SY6A 3QQ3B 2EXWD 2VDQL 4PJCF 2BVYA 4GJTB 1G7QA 2X4RA 4U1NB 3PQYD 2X4QA 5K59E 2IMNA 4R90L 3C60A 3WLWC 4WHDA 1CDIA 4WHYG 2JJTA 2VXQH 4NN5B 3W81A 1H3TA 3R0NA 1HHGB 1AKJB 4Q6YA 4ZTOL 4YFDB 2ARJQ 5DURB 2IANB 1C12A 5FHAH 5F89B 1NGPH 4FTVD 2NW2B 5IWLC 5I16A 3D25B 1HHKB 4BQ8A 4Y89A 4LASH 3DX8A 3LQAC 4CKVX 3RGVD 3RWFB 3REWA 3B2VL 5DUBA 4P23D 4F9PA 1XH3A 4HXBH 4XPAL 4OLVH 4EIGB 2ZCKL 3G04B 4UDTB 1KIUA 1OOAA 1FAKT 1R0AH 1FV1A 5EU7E 1JNNH 1H8NA 1OTSD 1FYTD 4F15B 4MNQB 2NX5B 3NN8A 3HZMB 4LF3B 3SDXE 1UQSA 2VL5B 1XFPA 5L6YL 3UBXA 3ARGA 1INQB 3K8KA 2IF7A 4UINH 3LN4A 4GAGL 3TBSA 3ZT7A 4GFTB 3GBLA 4HIHB 1UKQA 1JWMB 3LY6A 1IM9B 2J7LA 3KDMB 2WQ8A 3UPAA 2R2EB 1VHPA 1A64A 2MCPL 2D4FA 3ARYA 4IRJD 3BWAB 4OD2B 4ZFGL 1U36A 5DQ9A 5CP7B 1XGTA 2BRQA 2XWBB 1UB5B 4F8QA 2IADA 5DVKA 3EGSB 4K8RL 1HCVA 4LLWA 1KPVA 3ROLA 2PR4L 1B4JL 3TBTB 3WFDH 3PXJA 3GI8L 4OF0A 4RA0C 3H8NA 2PUQT 2X4TA 3IB4A 3BOVA 4X7CC 3SDYH 5KSBA 4LPVA 2APTA 5GRUH 2ICEB 3LEXA 1I85A 1FFOB 1YEKH 2VOTA 4OZ4A 1M71A 1FNHA 5TDPB 4HPYL 4LCCB 1MVUB 1EFXD 1XF5B 4MD5A 3D18A 3WXVL 1S9VA 1U92A 2WINA 2NR6C 5HHXL 3QIUD 1EVUA 4U6HB 1DQML 4F15C 1ZANL 4PGJA 3CU1A 1DEDA 4HT1L 1GL4B 1H3GA 4JZJA 3CLEL 5LGHL 3FQNA 1ZSDA 4JRYE 3OV6A 3DYOA 1AGFA 5B8CB 1FQ9C 1NBZA 5IHZA 3EJZD 5JW5A 1FZJB 3IAQA 4NRZB 1WEJL 5TE4L 4LHQB 3STZB 3B83A 4JN1L 4MZ3A 3KYKL 4PD4J 4G8IA 1MAML 1T21B 4GBXD 1CGYA 4NQDD 1QTYT 3NABH 4PY7B 5LBSH 5C8JA 3U7AA 3CZFB 3OR6A 3P9MA 2XKSA 2B1AL 2IANE 2KUTA 3LPGA 4CMMA 4NZUL 3LMJL 4FFWC 2LVEA 4PTTA 4Y5XA 3OKDA 2E6PA 4ZFOA 4JPVH 3NIFF 4Q6IC 1A7RL 5IBLD 1YPZB 1QSEB 1J1OH 2BXYA 1GRWA 5FUCE 4LMQE 1MJ8L 4I3RH 4NBXB 4O5LL 3GSNH 3WJJA 1F3JB 4K9EH 1MCHA 1YYLH 1AQKL 3QQ3A 1WUNT 5DUPH 5KVEH 1TJHL 4LCCC 5T1DH 1WFOA 4U1NA 2APBA 2OX5A 1E27B 2NX5E 5IFHH 3BP5B 2X4NB 3K0WA 5EH1A 4M7KL 3NBNA 1W72B 1UWEL 3UYRL 1HHGA 4JO1L 1AKJA 4HMEA 4HKZA 2DQGH 2R23B 5DJ8B 3QHZL 2SEBA 1ZHNA 3D39E 2IANA 5F89A 2DLFL 4O02H 1X7QB 2NW2A 5CILL 2P42B 4PJ5B 5HHOD 3D25A 1HHKA 4X6DB 3RWFA 4K55A 1TMCB 1KJMA 1RZIB 4Y4FD 3TA3B 3G04A 4UDTA 1FO0H 1QZ1A 4KQ4L 4R3SB 1PYWB 1NANH 3HPLA 3WSQL 3BIKA 1HYSC 4UIKH 5D72H 4WW1A 2Z93A 3LZFH 2NX5A 5I76B 4LF3A 3HZMA 1ONQB 4X7DC 1T2QL 3V4UH 1YEJL 1PQZB 2OK0H 3V8OA 2WLYA 4ZOCA 2O5XH 3MRBB 1SBSH 2QQKL 4OLEA 3WLBB 2OSLA 2WQRA 4ELMF 1IQWH 3FN9A 2YR3A 3D39A 1B0GB 2Z92B 2HJFB 3MLTB 5EUOA 4MB3A 1ZT1B 3CD4A 4RFOH 4OD2A 3BWAA 3OAUH 1GZQB 3ZKSD 1HNFA 2H3NB 3TPKA 3KS0J 4QOKD 5F7DA 4X6CB 3EGSA 1U8HB 2ILLA 2HT2C 2H2SD 4DFIA 1A6UL 4LGPB 4GAFB 4WFGE 3GO1H 5CS7A 2YRPA 3CDGB 5IVNA 4I5BB 3CFCL 3L5XH 3LIZH 4PLKC 4K2UH 2ICEA 3QCTH 1NCDL 4LLAA 1FFOA 2JJVA 1TZIA 5E03A 3HE6B 4S0TD 1XF5A 3GSQB 2YWZA 3TA3C 1FP5A 4DEPC 2JCCF 1WCQA 5E2JA 3O4LD 4TN9A 4U6HA 3D48R 5HHPB 1S7TB 4S2SA 1WSST 2Q8BH 1YPZE 1QSEE 3NPSC 3ZDXF 4P2QB 5GGTL 4OF6A 1S7UB 3MV01 3DVIA 4ODTL 4YC2C 3ZSTA 3JSSA 5B8CA 5C08D 3HCVA 4DAGH 1G7LB 1FZJA 4IRSA 1ZHBA 4NRZA 3CSPA 2X4SB 3N1FC 1KCSH 4P2CG 5HJ3B 3GSXB 4KK5C 2X1OA 5HD8D 1T21A 3O8XD 9CGTA 1JBJA 2R4RL 2IQ9L 1D7FA 1TIUA 4PY7A 2YK1L 3VXMB 4F7TB 5EU4A 4NQSB 3CZFA 4GW5B 4KI5F 4OLUL 3KJ6L 1HDMB 5JO5A 4OI7A 4ZUVB 3SDCD 3QIWB 4PJ5E 4X6DE 2B1HL 1RFDL 2IFFH 1RK1B 2ID5A 3FL7A 2XA8L 3P40A 1AXTH 2BOBB 4XI5C 1I7ZB 4EXPX 2GJZB 1EERB 2CK0H 1YPZA 1QSEA 1HSBB 4YZFE 4XP1H 2JF1A 4C55A 1IGCL 5F71A 2K9UA 1JRHH 1F3JA 4GXVH 5T1LA 3IDXL 3BZEB 1PX3A 4P46B 3QULB 1AXSB 3C8DA 5I73C 2E7HA 3HMXL 3B5HA 1E27A 5TPWL 1ED3B 1D9KA 1NL0L 4KKCC 5C3TA 3BP5A 4MS8D 3UO1L 4YIQB 1N5AB 4YBQD 2NYYD 4OIIH 2VJXA 3U46A 4MXQC 1T22B 5DJDA 3BE1H 4AJ0A 2R23A 2ZOKB 5IHUL 5IMMA 5DJ8A 5KN5B 5HVHB 2OR8A 12E8H 3T08A 3FT2A 2BVEA 1X7QA 4PJ5A 2CD0A 1P2CB 4X6DA 4TRPL 1INEH 1R5IB 2NXYB 1KBGH 3TBYB 4X5WB 5EWIL 1OY3B 1HCFX 4C57C 5FYJH 1F90H 3RKDC 5IQ7H 4X6CE 2V7HB 1W2KT 1RZIA 5HDBE 2YPKA 4MJ6B 5JNYA 5GGUA 4R3SA 1PYWA 3QUYD 3H6JA 1NC2D 3ORJA 3U0PB 4IIQC 4XP4L 5ITFA 1EO8L 5JDSB 2NQCA 4HPOL 1NFDF 3WKNA 1CL7L 5D1QB 4P3DB 1J10A 4JGUA 3MRBA 2FGWH 3FTGB 4MAUL 4M43L 3WLBA 4WY7H 3SGEI 2YBRB 3RNKB 1YNKL 3RAJL 1B0GA 1EX0A 2Z92A 2IFGA 1DQQB 2CGRL 3EZ8A 1HXYA 2HJFA 1N2RB 4P46C 1IC7L 2ZZUT 4DVRL 2QSCH 3ESVF 4Z8FL 3ZDYF 1J1PH 3DMMD 1GZQA 2AKRB 4HFWB 1YEEH 4WI6A 1HWGB 3EUUA 4D0CB 3MYJB 4BKLB 1GYAA 3ZDZF 4XCFH 3RP1A 4ZSOE 5HYFA 5ESQB 1ZLUH 4ZPVB 3W11C 3VWKC 4G7VL 1T0NA 3QFJA 1CVSC 4I5BA 1F3RB 2NXYC 2VSCA 5HYJD 1KENH 1NGZB 4GH7B 4ZFOL 3MJ9A 3HE6A 3B3IA 1DLFH 4MLSA 4JFYA 2APVA 4JFFB 4YDKH 3RX7A 3SKNB 5IGXL 4MHHG 3VXUD 4D3CH 1BIHA 1JNLL 4BM7A 5HHPA 2A6KA 1S7TA 15C8H 3OGCA 5BOZG 4CW1B 4UV4H 4WEBH 1S7UA 4DOHE 1KIPA 3ARDD 4DGYH 4LCWD 2E27H 3KHQA 3O45B 2NY0C 1CLZL 3DGGA 5IW1A 1G7LA 5AYQA 3GMRB 1CN4A 5F7HA 2X4SA 5J1AB 2ARJB 1JHLH 1LK3H 4ZSOA 5I1JL 1PKOA 3TIEB 3GSXA 5I1CH 5SX4H 2CKBB 4WO4B 4OLYH 1NCBL 4R96B 4XAWH 4HS6B 1FFQA 4PJ9C 2B8OT 4NQSA 1DUYA 3ARED 4GW5A 2B4CL 1X5IA 5I6XB 1A7OL 2G5RA 2BXZA 2PXYB 4ZUVA 3QIWA 4CDHA 2BNQE 1N64H 1RK1A 1JPTH 3S35H 5IFAL 2BOBA 5F88A 5BZWB 1I7ZA 2J6EL 2GJZA 5MP6L 3MLYL 4GKOA 4YXLL 4NYLB 5F7LB 3MA9H 1UJ3A 1HSBA 4P5KB 3VMPA 3HI6L 4Q2ZB 3W9DB 2W38A 1CQKA 3EYVA 3PABA 3CSGA 5E1AB 3LDBB 3CVIH 2J3SA 3BZEA 4I18C 1P4LB 1OM3L 3AU1B 3WHE1 1J0KA 1KN2H 1N5AA 4B7IA 1IEAB 5IB3A 2W9DL 4UT9H 5J0BA 4PJGF 4X5XB 2JJUA 4WFFD 4NUJA 1T22A 5C0EB 1H0DB 4M4RA 2BFVL 2X89D 4GG8A 4MCYB 2ZOKA 2ZUUA 4HH8A 4NKMB 5KSUA 4F7PA 5KN5A 4I3SL 5CGYD 4UZGA 4EJ1C 2WWMC 4UV7H 5SV3A 3IAPA 1G7JB 1P2CA 2BNQA 4GRWF 1R5IA 3GRWH 1J0ZA 1GXEA 4X5WA 4OCYL 1SYVB 2Y7QB 4OCXL 2V7HA 1VFUA 1J8HB 4X9BA 5D2LB 2VXVH 4MJ6A 1PZUB 2E9JA 3T77B 2VLJD 1GGBH 1WTLA 3DTXB 2NTFB 5I6XC 4R2GB 2JIXA 5EU6E 2X6MA 4C58B 1IM3B 1QLFB 2FZ3A 5JDSA 4LHUD 3V5DB 1Y18A 1HKLH 5CJ5A 5D1QA 1U3ZA 3TZVB 4P3DA 5EOCJ 4PS4L 3PDOB 3MXVH 4JE4B 1N5YH 4KUZL 2L7JA 2BK8A 4JFFE 2AK4D 5KG9B 1QRNB 3LDBC 5D2NB 2YBRA 3LEVH 5H8DA 3OJ2C 4HK3J 1DQQA 4WI3A 1N2RA 1L6XA 2VXUH 4KV5F 2EYSB 4GAYA 4KVNL 1QFWH 2HFEB 4PR5B 3BAEL 2AKRA 3VD3A 2IBBA 3G5VB 2VDRL 2OM5A 1S3KL 4JLRA 3O6KH 4DTGL 4BKLA 1IEHA 1V3MA 5IV2A 2EO9A 4LIQE 3RL1B 1XIWC 2GAZA 1M6OB 3CSYA 2QQQA 5ESQA 4IOSD 4MB5A 5EU6A 1JTPA 2AERT 3CNKA 3KJ4C 1EHAA 3WO4B 2RCSL 5MEOB 3NZ8B 5J6GB 1NGZA 4HUUB 5GS0L 5GJTH 3MUGB 1UM5L 2ZCLH 3OAYH 2NY5H 1JJUA 4F80A 5IR1B 4R6UA 5LWYL 1LEIB 1Q72H 4JFFA 3HG1B 3MOAL 3SKNA 1H15B 2HG5B 4S10A 3OR7B 4RSVA 1A6PA 4JR9L 3PL6C 3QNXA 1YNTB 4FS0A 2OXHA 4LQFH 4XPTH 2I60L 4CW1A 3MUY1 2ZSVB 1BJ8A 4X8JB 3BRDA 1DBMH 2HVJB 1FJ1B 3O45A 5GGVY 3SE4A 3GMRA 5CZXC 3KPRB 3LVEA 1T2JA 2ARJA 4NZTL 5D2NC 3ARBC 4GW4B 2P7TA 3BKYH 1RUQH 4RDQG 5F7WC 3ZZ1A 3O3EA 2DQHL 4G5ZL 2B7DT 3TIEA 1NKOA 3OG4B 2CKBA 4WO4A 1JPGB 3HE7D 3VDAA 4R96A 4HS6A 4JM2B 4NKIH 4OV5B 3L3GB 2HMIC 4FQ2L 4HF5H 5DC0A 4K8RC 2PXYA 3C09B 1BWMA 4L9LB 2EDXA 4P9HL 1DQDH 4PJFB 1OLLA 5JW4M 5BZWA 2Q86B 1TTUA 4OAWB 4P5KA 5CIPA 4Q2ZA 1F97A 3MLXH 4FN0A 3W9DA 2FECI 5KSBF 1J8HE 5D2LE 5C0AB 3V0WL 3FFCD 3S34L 2AXGA 1BZQK 4TNWF 5E1AA 3REVA 3WBDA 3I9GL 5KJRL 2CRZA 1TJGL 3ALPA 2R0LH 5CJOL 1ODAA 4XVTL 3U7YH 2YRZA 4LKCB 4MZ2A 2CDFB 3BP6A 5D5MF 1QLEL 1TQCC 2Y5EA 2PN5A 1BBDH 2VN4A 3N06B 4DQOH 3GHEH 1H0DA 5E7FA 1QRNE 4NKMA 1G7PB 2X1QA 5D8JH 5CLTA 1QSFE 2DLEA 1WT5A 3M07A 4OJFL 2ZKHL 3SJVD 4P2OD 1GPOH 4QXTB 4EDWL 5I75B 3FMGL 4KJPC 3BIBX 3S6CA 3VFTB 1G7JA 3IGAA 4Y2DB 5AZEL 1RUPH 4C56D 4OCLC 1WISA 1MJ7L 2PO6D 4JVPA 4HIJB 4I4WB 1OTUD 5JORB 4NCC2 5FDYA 1Q9KA 2V9QA 2Y7QA 4L9DA 4CNIA 5F7YC 4XX1G 2LTQB 2CDGB 1HYRC 1I8LA 2PTUA 5D2LA 4XNUL 1ZGLP 2J88H 3T77A 1WC7A 1U8KB 4OGAD 5FUOH 4LKXB 3DTXA 1FH5H 2NTFA 4ZUSB 4X9IA 3C09C 4DZBB 1AO7B 3UTSB 1IM3A 4PB0L 3C5ZA 4DGVL 3S3PA 3O6MH 4M7ZB 1KCUL 4F3FB 5HDLA 3F58L 4M8QB 1IAIM 3TZVA 1RZKL 1MF2H 2IGFL 3PDOA 5GHWH 1T66C 3HNVL 3SOBL 4NJ9L 3TN0D 4F7CB 1QRNA 3HG1E 1UYWH 1DBJL 1QSFA 1MHEA 4MXWL 4P57A 3MXWH 1IMHC 3CFJA 2N7AA 2HFEA 1KYOK 3TNNA 4PR5A 3SKOB 2IG2H 2I07B 2J5LC 4JQIL 4LEXL 3TCLA 2ATKB 4JDTL 4UT6L 5A2IH 2MOVA 2XY1A 3JWOL 3KPRE 4LSUH 1CICC 4LEOA 4ZOAA 3RL1A 1M6OA 1L0QA 2HKFL 4ZUWA 1I9JL 5CWSB 2C4XA 4U6VL 4RGOH 5JR1H 1XF1A 4HZLA 3RPIA 4DJMA 3B6SB 3NZ8A 5MEOA 1WIUA 4HUUA 3MUGA 3VXSB 3DI3B 4MXVE 1KJ2A 1O7VA 2FX7L 1LEIA 1N6QL 5CJQL 1H15A 1ZHKB 3FO2A 4BUGA 5TF1H 1MCOH 4EUPB 3JZ7A 1YNTA 4G8EB 4L4TD 2CDEB 1CU4H 3BSZH 5DFVC 4AIOA 1CDJA 1A6VH 4M7ZC 2R8SH 5C0AE 2ZSVA 2AJZB 2BSSB 4X8JA 1FAIH 3LV3B 4I9WD 2HVJA 1FJ1A 4Z78B 4KVCL 4XPHL 2WUCL 5C7XL 1UACL 2I5YH 3LH2H 3KPRA 2B0SH 4TPRL 4BQCA 4GW4A 2I25N 1UM6L 5EUOF 1SQ2N 1PAMA 1H5BC 3FHAA 2X70B 4GS7B 1NLBH 3VXPB 4W4NA 5DD1H 3QAZB 4ISVB 2HTLD 2NZIA 1XZ0A 4JM2A 1GGUA 5DF0A 1LEKA 2LU7A 4OV5A 2UUDH 4R7NB 4H5SA 4ODUA 4ZXBD 4EI5D 1Q94B 4L9LA 2D7NA 2ESVD 3MV11 1RHFA 3BO8B 4V1DA 2Q86A 4XH2B 4LL9A 3V5HB 2LV4A 4FMKA 4OAWA 3L3OA 1X4ZA 4KMQA 5I30L 2AJSL 3DNKA 4K23H 5C0AA 1WIOA 4X6EB 2YOCA 1KJ3H 3OAZH 4WCYH 1NH6A 4JO2L 3MQIA 1EV2E 2YPLB 5DD5H 4NFCA 1YN6B 4ODWA 1RSFA 1AO7E 3W82A 4J6RL 4LKCA 2CDFA 1DANU 3C6SB 3BPNB 3P0YH 4L3CB 5IUSA 3IJSB 3MLSH 4Y16B 5EPMA 3L3IA 3FO9A 4EN3B 3O3UN 5F44A 3TIDB 1VA9A 4WU5B 3NCBB 4I8DA 4YUEL 1A5FH 4NM4H 4RMSA 3MLWH 3VFSB 1VGKB 4QXTA 3VG0L 5T5NG 3VFTA 2BERA 5C70A 4Y2DA 4JFXB 3B2UD 4FP8H 5EIQA 5LGJA 1RD6A 2XZCH 4I4WA 3FO0H 5BO1L 5JORA 4FA8A 4GS7C 3BKJL 4YK4B 2CDGA 5ID1B 3QCUL 3MFGB 3A67H 1DDHB 4OZFA 1CR9H 5J57B 4ZUSA 3PP4L 1GGIH 2RR3A 4EEEA 1WBXA 4DZBA 4LP5A 1NUGA 5FFLA 2YS4A 4F3FA 4JAMB 1BBJA 3GNML 4J8RB 3VXSE 1YPZF 4OFYA 5MEND 2NNAA 3CFEB 4JHWH 3U7WL 1ACYL 4F7CA 1N3NB 3WHE0 1HILA 2P46B 4DKEH 5FHBH 3N50A 3HI1B 1RU9H 5EULV 1I3GL 5C0BD 2Z9TA 2Y07L 4V2BA 3ARFA 3SKOA 2FWOB 2I07A 3OB8A 3QUXB 3DIFB 4DKAA 1QG3A 4QWWD 3SO3B 5KANI 4BZ2H 4K7PY 4Y16C 1YDPB 2ATKA 2APFA 2DL2A 3PNWA 2WLZA 3H3PH 1NGXB 5HDOA 4BZ1L 4XMKL 4JFDD 3MCKA 4FXKB 1TZGL 1ZV5A 3PWUB 5D70L 5CGMA 5CWSA 3EDEA 2AQ1A 2MKWA 1RUMH 4QRPB 2VB5A 4LPXA 3OKNB 1AGCA 3B6SA 3C9NB 2Q87A 3ULUE 4UUJA 2IBZX 1MCQA 1ZA3A 2H2PD 3VXSA 3LQAH 4YZFF 5T3ZH 1A6AB 4YK4C 1AGDA 5FYKD 1OD7A 3C8KB 3BKCH 5CJXC 5DO2C 3RWCA 3UTQA 3E2HB 2LFGA 4KI5D 1ZVSB 2A38A 1FC2D 4EUPA 3MBEA 5L9DH 4G8EA 3DVFA 1DQLH 2CDEA 4HX1B 3T0EB 1JF1B 2W0FB 4EBQL 1MI5D 2BSSA 4QCIB 1KPRB 1S7WA 4XPBH 1KEMH 5EC1B 4PJXB 2YPLE 1KCRH 1FZKA 4MAYB 1JHTA 3D3VB 1A0QL 4MA7H 3SEPA 2UVFA 4ZD3H 3N9GH 4YHML 1HKFA 1P7HL 1A4JB 2AABH 3F5WB 4HEME 4ISVA 1AFVH 5F21B 3X14B 3SO3C 2F54D 4M5YL 3WXWH 4S11A 4CRPA 3FAXA 3NACL 4POZD 3RWJB 3IAGC 2OMBA 5HDBF 4R7NA 4M61B 5F7EL 4ZODA 3GIVB 5KVDH 3IU3B 3WDHA 2VTFA 4AIZB 5FM4A 1EVTC 4JQVC 3MLZL 4M1CD 1FDLH 4LPTA 2GTWB 5ICYB 2HT3D 4YXKL 4MGXA 4K3EH 3FZUC 4HC1H 4WENB 1CVRA 2YPLA 5CD5C 2BRRH 4LPCA 3GKWL 1LO5B 3EJJX 3VFPB 1YN6A 1DJSA 3C6SA 1YECH 1YY8B 4X7SL 3OPZH 3V9FA 4FXGA 4DGIH 1LO2H 2VC2L 4EN3A 3H3KA 5E2WH 3T0BA 4JPKL 2MPAH 3TIDA 3T0EC 6FABL 4WU5A 5JW3L 4P9ML 4CVWA 5ITBL 5EZOL 4KY1L 2P5ED 5C9JA 3QXAB 2ZJSH 3ES6B 3VFSA 1D3CA 2B5IB 1L0XA 3D87B 3E6FB 1K2DB 2Z0BA 3VWJD 3B9KA 1WWWX 5F9WC 3FQWB 4NZDA 2LAGB 5A2FA 4JFXA 2ZUQC 1KOAA 1LEGB 4YHKL 1W8NA 1U6AL 3QH3B 1ZLSL 3CSBA 1ETZB 1JN6B 4OCRL 2FSEA 3BZFA 4Z7QE 5ID1A 2G2RA 4YDLC 1BEYH 3S97C 4PGBB 4XRCB 2H32B 3CH8A 1YNLH 4TTDD 3MLUL 1T4KB 2B4CC 1BFSA 3CXDL 4LLUB 4F2MA 3WFHB 1KJ2L 2X7LB 3U82B 2CIIA 4J8RA 4JPWL 1T7WA 5F96L 1KTRL 2IALA 1PG7H 3K1DA 4WI4A 4HW6A 3CFEA 1Q0YL 4Z76A 5E8OA 4PRBA 4N5ED 3MGOB 5C0NC 4LCIH 1I1YB 5CZVH 1NC4B 4YHYC 1T0PB 3HI1A 4N9GB 5BVPH 1R5VB 3FB5B 3NZHH 4LLDA 3OXSA 1QFWM 4YGAB 3EIFA 2DN7A 3H9HB 3QUXA 3DIFA 2I9LA 2HTKD 1MCPL 3KXFD 3W0WD 1YDPA 5JUEL 4PJXE 4OTXH 1DEEA 1NGXA 4P4RA 3WKMH 3D3VE 5T3XH 3UAJD 4FXKA 3VFNB 5KS9A 4Q9QL 4RWYL 1EBPA 2NY3C 1RMFL 4RFEA 4ZYKB 3MO1A 2VYRE 1IT9L 4GKSB 5HHVL 2EIDA 3CLFH 4YFLI 3U4BH 5C09B 1U93B 4YDVB 2WUBH 3ZO0A 1SMOA 3C9NA 1CGVA 4XC1L 5EN2B 3OF6A 5EOQL 1CYGA 3F8UB 1JMZA 2DQDH 1A6AA 1J1XH 1U58B 5FK9B 3C8KA 1QFHA 3LKQB 3MJ8B 4R97C 3AUVA 4UTBL 1ZVSA 2VUYA 5CJ8A 3N85L 4M48H 4GAJL 4AL8L 5EZJB 3KR3H 4HX1A 3VCLB 1JF1A 1KTDB 2W0FA 5KZCD 3IF1B 4HUXB 5CMAB 3VA6A 4QCIA 2E7MA 4LAQH 1XGQB 1ZEAH 5EC1A 4PJXA 1A4KB 4TSAL 4N0UB 4F58L 1CXKA 1NCCH 4KZEL 4PG9B 4MAYA 4OM1H 3MV9A 2EE3A 3QPXL 3D0LB 2AJVH 1V5JA 1A6ZB 1MCNA 4XC3L 2WIMA 2ZP0T 2DM7A 4FXLA 3UZEA 3M17A 1FCCA 3PGCB 2KZ1B 4J3TA 1FNGB 3F5WA 4HJJL 3LKPB 5I1HL 5J7CC 5KW9L 2EH7H 3S3JA 1JL8A 3X14A 2NPLX 4OFKA 2AJYL 1OARH 3GM0A 3Q6FA 2OBGA 2AJXH 1GGCH 3GIVA 3IU3A 1W72H 4AIZA 1I75A 2QLVB 2V9RA 5EOCL 5BV7L 2PYED 1P9MA 4OCNC 1GH7A 3FOLB 1RPQA 4K3JL 2GTWA 4MCZB 4EOWL 1QR4A 4OD1H 2GKIA 3Q5OA 2D03H 3WE6A 2DI7A 4PJIB 1A02N 1F45A 4JFHE 4PV8A 3QNZB 3WDIA 2P48B 4G3YH 1LO5A 3C2SA 4XBPB 3VFPA 1RIHH 1I9IH 1YMMB 5ICXB 1CLOH 5DJYB 3GSUA 3NA9H 4HFUH 3O2DH 2EH8L 2GSIB 2NXZD 2NY6C 4UT7H 3BQUA 1VPOH 3MRMB 1B9ZA 3IYLW 1B2WL 5F6HI 4XVJH 3P9WB 1I9EA 3NTCH 4E5XA 3E6FA 3TYFA 4N0CC 3RIFK 1MFCH 3FQWA 5JZ7C 3HS0B 2AW2A 3KNBA 2AEQL 1SJEA 3QH3A 3ULVL 2JB5L 1AY1H 4L8BB 4YWGL 4X8XA 1L7IH 4KHXL 4FQQB 5DMYA 2JELL 4XNXL 3C60D 1NEUA 5EO9B 5CGTA 4PGBA 2IJ0C 4XRCA 2H32A 4PRAB 1H3VA 1NMCC 3VGAB 1IGIH 1ZWIA 4LLUA 3WFHA 3JV4B 2V2TB 4JB9L 5C09E 1T1WB 3L3KB 3UYOD 1I7TA 4E41E 2D7TL 2J1KA 3IFLH 3T2QA 1JGDA 4PRHB 2YD6A 3AS1A 3MGOA 5IJKA 1RUAH 1NC4A 4Q9CA 4JM4H 5GS2D 4N9GA 4XPGL 1R5VA 1O5DT 2ZCHH 3FB5A 4Y19B 1H3PH 3BP4B 4J4PC 1U8LB 3BUYB 2P49B 3IFNL 4KROD 4M1DL 2DDQL 4MQSB 4EDXB 5DK3A 3H9HA 3HZYB 4TVPE 1R3IH 1NSNH 4TOYH 4YBLB 2RQ8A 3INUL 3N1PC 3QG7H 1J05B 4WRLA 4KJYB 4UBDC 4N0UE 3ARGD 2OTWB 4N0YL 2EDDA 4CU8A 5D93B 3TT1H 5T5FH 4JQXC 2X05A 4LSSH 4MJIB 3KVQA 4FNLL 5L8KB 4ORZC 4ZYKA 4GKSA 1BM3H 4YDVA 1F58L 4F57L 3IJYB 4E41A 4JY5H 5F7FA 2VXSH 1U58A 4YPGB 5D2LF 3AY4C 3PIQA 5SX5H 3LKQA 4P5TB 3V4PL 3UX9B 1KELL 3ILPB 5ERWB 5BW7C 4X9FA 1OAQH 4UI2A 3VGAC 2OZ4A 1I4FB 2VDOH 1IGMH 3IS0X 1KFAL 4NC1E 3WNMA 3VCLA 1KTDA 5GRYA 4HUXA 5CMAA 3RVVC 4PJIE 1JGLL 3I3EA 3QUZB 1A4KA 1IQDB 1RZKC 4N0UA 4JKKA 3ZE1E 5GISH 1TVHB 1ZMYA 1BQSA 1YMHB 4DVBB 1YMME 3D0LA 2VLRE 2FD6H 3T4AB 5HDQL 1Q0XL 1BQHB 2DI8A 3IKCA 2CXKA 4LBEB 2R9HC 1AR1C 1FNGA 5CKAA 3EYUL 1X4YA 2ICWB 3G6DH 3BH8A 5B3JE 3MCLL 4YBLC 3UYPA 4GMTH 5I18H 1MCDA 2YMXH 5D93C 2CSPA 2NY4B 5BOPA 1FIEA 1KEGH 3WIIH 5I8OL 4ZAKB 4LARH 4MCZA 3MZTA 4ZO9A 3P0VL 3X11B 1U8OA 1N4XH 4U6YB 4P48A 4PJIA 4Z95L 1JNHA 4J1UB 3RWIB 3OAYK 5CAYB 4XBPA 5I9QB 4JGJA 5GZOD 1YMMA 2VLRA 1TNNA 5ICXA 4NP4L 4LSPH 5DJYA 3B8YA 1JF5A 4WGWB 2DLIA 1F11B 2GSIA 1NPUA 2DQEH 3R8BB 3EAKA 1G7IB 3RDTB 3MRMA 2WBJB 1BFOB 4GUPB 4H8WH 1PLGH 2R29L 1KIQB 4YHOL 3S3SA 3QUML 3QUZC 2ENSA 4J3SA 5E70A 5GRVL 1DP0A 1FE8H 4Y19E 5HHMB 5KAQG 3ZTJG 1FNSH 1EEUA 1TQBB 1WWCA 3HS0A 3QZWB 1OAXH 2HFFB 3NIDE 2XQBL 1UCBL 4YHNB 4OGYL 2EE6A 1X5XA 5C6PB 3PDGA 1MIEH 5JW4N 5FO9B 4JM2F 1KCVH 3CFIC 5C0RH 4XB8A 4RZCB 3QCVH 4DW2L 4MJIE 3OKLB 4A6YL 4MXVF 4PRAA 3E8UH 2YUXA 1AKJD 3NFPB 3ULSA 5TQ0H 3JV4A 4BSJA 2V2TA 5CEZH 5DURD 2CMRH 5LQBH 2IAND 1E6JL 1T1WA 2Z31C 3L3KA 4LRNH 3HFMH 1YEFH 2YD5A 1G9NL 1TFHA 1JYNA 2XN9B 2IBGA 3H0TA 3V4VL 3F12B 4H20H 5K9JL 4FG6C 4Y19A 2DQTL 1UWGL 3BP4A 5I9QC 2DMCA 3BUYA 1AJ7H 4M6NL 2WK2A 4S1QH 1DFBL 3GHBL 3HZYA 1BF8A 4PB9L 1IC4L 1VEOA 5DUML 1AHWB 2NX5D 2VDLL 4O00A 1J05A 4M6OH 2YPVH 1TETL 2OTWA 4N1EA 4K94L 3RDTC 2WBJC 3DHJA 4LLYB 5B3NA 4PLJD 3MRKA 4JJHA 3H3BC 3S5LB 4JHZA 4DKFL 3LKRA 1BPVA 1EHLL 1CGSH 1F8TL 3D39D 1TQBC 3AC0A 3P30H 4LSVL 5KOVC 4LAJH 1E28A 1KLGB 3IDGB 1AD0B 3BT2L 2BHYA 5KSAB 2VERN 4QHLB 2A83B 4LU5L 4YPGA 1HQRA 5ECJE 4P5TA 2AXFB 1H3UA 5IVXB 3ILPA 4MWFA 5ERWA 1S7RB 5EORH 1I4FA 4FFWD 5JQHC 4ZS7H 5FYLH 4CADB 5IMOA 1D5MB 5HY9B 4AY0A 4KQ3L 3WNOA 3TWCH 3AMKA 1IQDA 1KC5L 1RV6X 3FN0H 4OGXH 1LO0L 1HHHB 1IGJA 2IMMA 4OM0H 4OI9A 1TVHA 4DVBA 1YMHA 3T4AA 2DQJL 3E0GA 1BQHA 4JY4B 3Q6GH 3OXRB 4LSTL 2CQVA 4CVUA 1SM3L 1LDPH 1ORQA 1K3IA 2ICWA 3HB3D 3HMWL 5I15H 3LEYL 3SBWC 2QSVA 1F13A 3KLHD 1P5UA 4HCRL 4R90H 5C92A 5HHME 3TO4B 2FX9L 4PGDB 2FH6A 5J9PB 5MHSE 4J2XA 1JP5A 1ZT7B 3DVGA 5FM5O 5DJZB 4IRSD 3HR6A 3S88L 2Z91B 4ZAKA 4ONHB 2A6JB 3X11A 4HLZH 4WFGD 4H0GA 1RUKL 5MEPA 4HS8L 1ZE3C 2OS7A 4MVBD 4J1UA 2J8UB 1EBAA 4EXKA 4K71B 3O9WC 3B2VH 3VFGH 5DT1L 5EOTB 5IEHA 1QLRB 3U79A 2VZTA 4AEIL 1T03H 1A1OB 3CXHJ 3EDKA 3MR9B 2IC2A 2ZCKH 2XT1B 4GRLB 1F11A 3Q1SL 4GKNB 2XN9E 5GS0D 5DJCA 1BFOA 4GUPA 1QSED 1KIQA 5L6YH 3ZKNC 4ZTPH 2QKIB 1KNOB 5BRZE 4GAGH 4W4OA 5T1KA 5T1LD 3QZWA 1NDGB 1MHCB 5F3HB 5F6HJ 2HFFA 3GMOB 4F7EA 1D9KD 3CUPA 7CGTA 4YHNA 3D2UB 3PHQB 5JOPE 3ULUF 3GB7B 4Y4HC 5FO9A 1ZLVH 3O6FB 3L3JB 4X99B 4RZCA 4ZFGH 1MQKL 4HWBA 3WCYA 3UROR 4D9QE 1Z2KA 3NFPA 3DETD 3LB6D 3LRGA 4EI6B 3FQXB 1QNZL 4K8RH 1FLRL 1U8NB 2E6JA 3CFKB 3WEXB 2P8LB 3V6OC 1U42A 2PR4H 4PJ5D 1CBVL 1B4JH 2KH2B 3WFBL 4EVNA 4MJ5A 3OAZK 4JRXA 1OPGL 5DJXB 5ENWB 3F12A 1S7XB 4K71C 2FL5A 2ERJC 3PF2A 5CP3H 2DYPB 1MJJB 1KCKA 1YJDL 5BRZA 1MWAA 1K8IB 3MSPA 2MHAB 4GMSL 4HPYH 5IOPB 4QHUB 4HZAA 2A6IB 3EHBC 1AHWA 2Q6WB 3WXVH 3SBWA 5HHXH 4R8WL 1F3DJ 1DQMH 4WHYH 4U3HA 1MCRA 1ZANH 1CLYL 4Z7UB 1WBZB 3E3QE 1L9MA 1G6RL 4WWKB 2R2HB 3CLEH 3S5LA 5FUZL 2EE9A 4NO0A 4MSWB 1R3HA 4HIIB 1QO3B 3S98A 1V7ML 3U83A 2Q8AH 2DRUA 3GBML 4NRYB 1WEJH 5TE4H 4BFIB 4JHAL 1SEBA 4PYGA 1KLGA 2FECL 1TVDA 3HC0B 3GSNB 1R24B 4NFBA 5KSAA 4QHLA 2A83A 1UM4L 2PW1B 4N8PA 4JN1H 5CHNB 3KYKH 2FO1A 2Y23A 2VQUA 1FFNB 2AXFA 4PRIE 3O6FC 3WUWB 2F5BL 1MAMH 2YWYA 1PEZA 1BWWA 4KGJA 4MX7B 4L29B 3SDAB 1A7PL 1A47A 2BVUA 2HFTA 1V05A 4CADA 5D1XA 3JVGA 5MI0C 2BHZA 5ANMA 4ZO7A 4HWEL 4RA3A 1F2XK 1D5MA 4NZUH 5HY9A 3QFJD 2J8UE 1SVZA 5I74C 2G9HB 4NJAL 5B39A 5H2BB 4XHJD 3OJDB 4OQTL 4OLZL 2DMKA 1HHHA 1ZA6B 4DN4L 1B3JA 1MY7A 1A7RH 3TLRA 3D9AL 5AG9A 1CFQB 3HE6D 1MJ8H 5E9DB 4JY4A 5DJAA 4O5LH 1AQKH 2GUOB 4MQ7B 3RY4A 5JPMA 3BPOC 1M7XA 3K1KC 3QEGL 4MXQD 1I8IB 4Z7QF 1OQOA 1CE1L 4MQXC 5DVOA 3TO4A 4G43A 5J9PA 4M7KH 4PRIA 2NW3B 5KS9F 3I02B 3UYRH 2WP3T 1B0RB 1QFOA 5IG7B 3QHZH 3BEWB 3KYNB 2C1OB 2C3GA 1KTKE 2DLFH 4KMLB 2MMXA 4PP1C 5CILH 1EPFA 1T1ZB 5HYSB 2UWEB 4GG6B 4OBRA 1KXTB 3CMGA 1W0VB 2D31B 5DWUL 5E4EB 4X6BA 1K5NB 4OIAA 5IMLB 1QLRA 1NMAH 5CZKA 1TPXB 4FQXB 1WITA 3MR9A 3GSOA 5C0FA 3QIWD 4OZHB 1JVKA 1PDKA 4GRLA 4KQ4H 4GKNA 2CH8A 2JJSC 3WSQH 4C59B 1WK0A 2BVTA 5A3IC 1Z3GL 1RJCA 1IAOB 4NQTA 4D9LL 3LAFA 1FFPB 1OAZL 2Y25A 3AM8A 2QKIA 1KNOA 1A6TA 1UWXH 3HTLX 5HBBA 4PTUB 1NDGA 5GRXG 5F3HA 2QQKH 1YEIH 3QUKB 5HHQB 4JVUA 5DD6A 1FZMA 1J86A 3B9VA 3EKCA 3QEQB 1L7TL 5C6WH 3VXQA 5FV2A 3L3JA 4X99A 4Z7UE 1T5XA 4JFQB 4R0LB 5DGRA 5E94B 1KPUB 3UJTH 1U91B 4FQPA 4U0RB 5GRWA 1JHKL 1UADC 4G8GB 4ZQKA 5JLZB 4M7LL 4U4BA 5IT2L 2ZSWB 5B4MD 3SGDI 2AJUH 4QRQB 1U8NA 3CFKA 3EYQC 4PRNA 3N1GC 3PV6B 2EEAA 2X4PB 3KPPB 2P8LA 5BV7C 3QO1B 2BNQD 1NQBA 2NY2B 1A6UH 3RVTC 1X5GA 4LCUB 2X9WA 4IDJH 2YD9A 1HH6B 5DJXA 5ENWA 3H9SA 3CFCH 3TPUB 1E4WL 1DN0A 3GMQB 1NCDH 2BVPB 1M1SA 1K8IA 4FQXC 5IOPA 3WDJA 2JIXD 4QHUA 4OF5A 5HYEA 2A6IA 2WSKA 1JWUB 4JZOA 2EKJA 5J11B 3S8WA 5DJ2B 3K2UL 5KANG 1IGYB 5D1QD 4OI8A 4HIXL 4Z7UA 1WBZA 4Z0BL 4FFYH 4WWKA 2R2HA 5GGTH 2EC9U 1KF9B 4BELD 5E9DE 5F9DC 2EZ0C 3CVHB 1PW3A 4JPIA 4ZNEA 4F9LC 2QHRL 1MEXL 3VGFA 1P1ZB 3U2SB 5M95B 3C5JA 4NRYA 3GK8L 3SE3A 5FO7A 4YDIL 5E2TL 4Y5YC 3ULVC 3HC0A 5CUSL 3GSNA 1R24A 1E4XH 3TCXA 5CHNA 2CO7B 3S4SG 4FFZL 4OFVA 4KHTL 4NQEB 3WUWA 1KB5L 3L7FB 4M03A 4MB4A 2YK1H 4MX7A 4CMHB 2JJSA 3D1MC 3PV7A 4L29A 2OP4H 3SDAA 4WW2B 3HPJA 4OLUH 3KJ6H 1T83A 4JY6B 5EU6D 1LGVA 2VDKH 2VE6B 4LSRL 3ARWA 4MA1B 4XMPH 2NY2C 2UWEE 2G9HA 4GG6E 2XA8H 3I84A 3LS5L 5H2BA 3OJDA 1HSAB 4XWGL 2P5WB 2GSGB 1J18A 4KK9D 2C7UB 2PKDA 1B90A 2EDLA 1U3HB 4UIMB 5E9DA 3UBXI 3L5IA 1TLKA 4JFFD 1RVFL 1HK6A 2GUOA 2FEDD 1C1EL 1J9CT 4XP6H 3IDXH 1YQVL 5ADPH 4Y2OA 3MNZB 3HMXH 1CF8L 5TPWH 3RWHB 1FO0A 3UO1H 5J11C 43C9B 1I8IA 2VAAB 3U0WL 3EOBB 2CRIA 4FHBD 5DXWA 4OV6F 1GZPA 2MJWA 4ORGB 5D7JB 5E6IB 3SGJC 4ZG1A 3O6LL 1XR9A 5JOFB 3GIZH 3X12B 5IHUH 4NC0B 3RVXC 3BEWA 2XTJB 3TVMB 1CFSB 3DPBA 3KYNA 2C1OA 5J06A 3WIFB 3X13A 2Q3ZA 3QNYB 3QEQE 4WO4D 1UGNA 3MACL 1DUZB 5HYSA 4TRPH 2GCYB 4GG6A 5FA4B 4PV9A 1W0VA 2D31A 3FRPG 5EWIH 1K5NA 1MFEH 4YR6B 2E7BA 1B88A 1CDYA 2OJZL 3BXNB 2APXA 3S36L 1NGQL 2PXYD 5C2BL 1KT2A 4M62H 2N7BA 1J0JA 1MWAL 2GJ6B 1A9EB 4L8DB 1RY7B 4MMZC 4XTRD 4NC2B 1EO8H 4HHAB 1IAOA 4LVOB 4HPOH 1FFPA 3T0WA 1CL7H 4FQJL 2PETA 3TBVB 3KLSA 1MFDH 2A0LD 1GHFH 2DF3A 4MAUH 4M43H 5I8CB 1B0WA 1UZ8B 4WI5A 5HHQA 1YNKH 3RAJH 5F7UA 3QXTA 4G9FB 3ZE2E 5I1IH 1G0DA 3UP1A 1IC7H 4DVRH 1JK8A 3QEQA 4BSVB 3EYFB 3FB7A 4Z8FH 4R0LA 2EDRA 1KPUA 1U91A 3RKPA 4A6YB 5JLZA 2YZ8A 4M6MH 3VFRA 3R4DA 1VEMA 2ZSWA 4QRQA 3MUHL 4C83B 3PV6A 2X4PA 3KPPA 5D7JC 1LHZA 3QO1A 4X4XA 4P5MB 1CIUA 2OTUB 1XCQA 4NQXB 4WDIB 3TVMC 3A6BL 1AC0A 2HT4C 3MNVB 3ZKMD 1OSZA 1BOGB 5I1EL 1HH6A 4G7VH 4PJIF 2VXQL 1LVEA 3SHSA 4DZ8B 3KYOB 3FAWA 3KYMB 1IFHH 2BY3A 4H1LG 4HWZA 3TPUA 3K3QA 3GMQA 4ENEC 2XRAL 4KZDL 3HI5L 3TO2B 4HLJA 4DUWA 4R2GD 4AEFA 1G9ML 3MRCA 5E2VL 1WFUA 5IB2A 3CX5K 4LASL 5JXEA 2OL3L 5DJ2A 3MPCA 2P5WE 1Z9SA 1IGYA 1JNLH 5B3JF 3TZVD 1Q9WB 1BJ1J 1I7RA 4HXBL 5E99L 2EECA 3KPOB 4LVOC 1BLNB 1S7SB 3RZCB 4POYA 4MA8L 4PJDA 1QRND 1QSFD 1N26A 4FQ1H 1P1ZA 1CLZH 1MJUL 5FYJE 3U2SA 3F7PC 3UXFA 4L3AA 1MELA 4D9RE 2EEBA 3DX7A 3RUGE 2OMNA 4PJ7B 2FBJL 5I1JH 2ZWLT 3RVUC 1OB1A 3P9LB 4XBEL 4KTYA 1I8KB 5IW3A 4LHUG 4R4NC 1T7ZA 2PW2B 1N7ML 3UTTA 3BGFB 1DLHB 4BH8B 5AZ2L 3HN3A 1ULVA 2XTJE 2C5DC 1UB6A 4LMQI 4I48A 4WW2A 2B4CH 5EFIB 1A7OH 2BOCB 2VE6A 4W6YB 3T2NL 5KSVB 2DWDB 1G9NC 5IFAH 2GSGA 2J6EH 5MP6H 3MLYH 3ARVA 4LVHB 4YXLH 5DJ6B 1WAAF 3SCMB 3T0AA 5CFHA 1U3HA 3UJIH 1GC1L 5JMOC 3WFDL 1FZOB 4OSUL 5GS3A 1AE6L 4NHCH 3HC3H 4P3WA 3MNZA 4KRPC 2GJ6E 3NIDF 4MJ2A 3RUGA 3QIBC 3UTZA 2XNAA 3QI9C 3QPQD 2VAAA 2YUZA 2DTML 3EOBA 4G7YH 1DBKL 4K94C 2W9DH 2VITA 4X4ZA 4PP2B 1BFVL 4M8VA 4ORGA 5E6IA 1G6VK 5A1AA 3KPRD 2EO1A 3X12A 5DS8B 1CFSA 4G8FB 4I3SH 2F19L 1NUFA 3H7BA 2QR0A 4G9FE 2ATPA 4PGCB 1DUZA 2GCYA 5FA4A 3G5XA 4ODXB 5SX5K 4JM2D 4I0CC 2I26N 4YR6A 4HUVA 4OCXH 1PSKL 3BXNA 3P3YA 2EICA 4KJQD 5EB9A 3BGFC 4HKJB 2ZUTA 1OAYL 4L4VB 4FQCL 5HGAA 3GSVB 4V1DD 2GJ6A 3KPQB 3WS6A 5IJVB 3CDCA 5C0AD 1P7KB 3RGVB 3NABL 2VWEC 5LBSL 3JUYA 3KPTA 4LVHC 3SCMC 5D96B 4PS4H 4BK5A 2LAAA 2JKXA 3C08H 5FKPB 1DCLA 2XYCA 5I8CA 4ELKB 3MRPB 4KUZH 2UY6A 1FYTB 2E7LC 3HUJB 3BPLC 1AI1H 4M3JA 3S96B 3P11L 4BSVA 1N0XL 4KU1A 2DM4A 4KVNH 3VG9C 1K4DB 3BAEH 4I3RL 4K9EL 2DBJA 2OCFD 5I1KH 3ECBA 2VDRH 1EMTL 2AV7A 5DUPL 1S3KH 1FSKC 4C83A 25C8L 4DTGH 3GMNA 3UTPE 4P5MA 4S1DD 4Y2DD 1U0QA 3DHMA 4NQXA 4WDIA 3BGMA 4PJ7E 3CAFA 3VRIB 4OF8A 3WUZA 2EXWC 3MNVA 5INDB 1MFBL 4DZ8A 3KYMA 2VZVA 2AGJL 2D0GA 3MRGB 1FGVL 3WNPA 3D69B 1JPST 1UCTA 4ODSL 1UM5H 5IF0B 4P2RB 1RJZA 4HIEB 1G0XA 4OKVB 3MOAH 3MRLB 4L1DA 2F9BT 3PP3H 4JFEE 1TTGA 4UQ3A 1F6AA 1UH3A 1RZ7H 3SY0B 4JR9H 4PUBH 4NN6B 3RRQA 1T20B 1Q9WA 4OFYD 2EYTB 3QDMB 4HEPG 2FHCA 3KPOA 4TVPH 2I60H 4J7RA 2DS4A 1BLNA 3RZCA 1SJHA 2UZXB 1G6RB 1DSFL 3RGVC 1FO0L 1U8MB 4EZMA 2ADJB 3RBGA 4UAOC 4P23C 1NAMB 4UIKL 2W65B 4AT6B 2YZ1A 4QEGA 2A9ML 5D6DC 3ARFD 4NZTH 1I1AB 4N1HB 3IDYC 5IHBA 1OTSC 5MEQB 1YC8A 4GXUN 4Q97A 1I8KA 1IAIL 1Z0MA 1SBSL 2PW2A 3FQTB 3C6LA 4BH8A 1IQWL 5ID0B 4X7FC 1NBYA 3O2VL 4Y4KB 5TE6L 4F8TA 2BOCA 4U33A 2YD1A 5KSVA 2DWDA 4ODBD 4JFEA 5IK3B 1TZHB 4KK8D 1AGBA 1FN4B 3VXSD 5DA0B 4IRJC 4GW1A 3E6HB 4GBXB 4NQDB 3V0WH 3GRWA 4QRRB 1RJYA 3S34H 1FZOA 3LQMA 3FB8A 4L4VE 4WTZA 3I9GH 1Y6MR 5I71B 1YJDC 1MREH 1QOKA 5KJRH 1TJGH 5L2KB 3MBED 3ZYIA 2FO4A 3MJGX 4XVTH 1T7VA 1X5KA 3FJTA 1Q9OB 1MRFL 2YUVA 3DV6A 1QR1B 4NN6C 3A6CH 1QLEH 2ORBH 1OQXA 5J1TC 4PP2A 3UMTA 5F8QC 3ISWA 1F4YL 5EBWB 5DS8A 3ZYJA 4JN2B 4G8FA 4OJFH 1HOCA 2ZKHH 4EDWH 2DIAA 3FMGH 4X6FA 4PGCA 1KLUB 1NFIB 3NAAL 1HXMB 5AZEH 3VI3E 3QIUC 4ODXA 3KPLB 4PPTA 3ULUD 1MJ7H 1SJXA 5JHLL 5DRXB 1V3JA 3BN9D 2ITDA 3LPFA 2AEWA 3MLVH 1DVFA 3T4YB 1G0YR 5J3HD 4HKJA 4Q58C 4XNUH 2RBLA 4X5LA 5AUMB 4L4VA 4RRPA 1UA6H 3BH9B 4JDZA 4ONGL 5KVMC 1OGAB 4F33B 3KPQA 5J6HB 4QTIH 5IJVA 1J87A 2VZUA 1BD2B 1JZ2A 4PB0H 4DGVH 4LFHG 1P7KA 3SQBA 1FVDB 3F58H 1TVBB 1OL0A 2E9IA 1FFRA 1RZKH 1SYSB 5C07B 2AJ3A 2YPLD 2O61B 5IESH 1PG7X 4Y4FB 5FKPA 3HNVH 4GBXC 1I1FB 2G60L 4P2RE 4NJ9H 3SOBH 3VD4A 2LE9A 1DBJH 1T0MB 3GBNH 5I71C 1AXTL 5DQJA 4F37K 5DA4A 1Q38A 1WIPA 2D9QB 4Q9RL 2CK0L 3S96A 1YN7B 4EN3D 3QDME 4NIKB 5DMKA 1UKSA 3HNSH 5E5MA 1A7QL 4JQIH 5D9SA 4LEXH 3Q5TA 3U1SL 4L8SC 3LOWA 4UT6H 3LS4L 5FGCB 3FCTB 1C08B 1MCJA 5BVJA 3B9KD 5JMRA 3U4EA 1A3QA 2V5TA 5F70A 2HKFH 3VRIA 5INDA 3WO3B 3OKOB 1I9JH 4LVNB 4PJEB 3NMEA 4XAKD 2WWKO 5D7LB 3BD3A 4PJAA 5ETUA 4LOUD 3MRGA 3D69A 4XXCC 3DBXB 1RAMA 4XCYA 12E8L 4GQ9L 3MJ7B 3HA0A 4P2RA 4HIEA 4I2XB 1N6QH 3P0GB 4IJ3B 4FZ8L 1FLTX 5DRWB 3IS1X 1S78D 1F90L 1T20A 3T2OA 2EYTA 3QDMA 1K8DB 3SDDA 4LGRB 4PG2A 4HG4J 3IVKB 4NQDE 1T89C 4QRRE 5E5UB 1IJ9A 1BZ7B 1URLA 2W65A 4AT6A 3MLRH 4KVCH 4XPHH 2WUCH 1ZHLA 5C7XH 4Y4FC 5L2KE 3WJLA 5HVWA 4I0PA 1I1AA 4TPRH 4J3WA 2FJHB 3QUXD 1UM6H 4XCCH 5MEQA 3CMOL 1IARB 1ZLVK 3H7LA 5J4MA 3ETBF 3THML 1F4AA 5L2JA 4WEMB 3FQTA 1IC5L 3VI4E 4WY7L 4WUKL 5ID0A 5C08B 4XCEB 4Y4KA 43CAA 5EO1B 3MRFA 2QSCL 4HV8B 5E2UL 3LQZA 3MBXH 2WIIB 2IAMA 3O81A 4WVRA 5IK3A 3PGDB 3OF6D 3QG6A 4P4KA 4LVNC 4YE4H 3TJEH 4QRSB 1LNUB 3U48A 1CG9B 5I30H 4KRNA 3E6HA 3O8XB 2FGZA 1YEDB 4QRRA 2PTVA 3EO0A 1LMKA 4YDJB 1AP2A 4DWHA 1FBIH 5EBMB 4RAVB 1A3LL 1OGAE 1XF2B 1F4WL 5DHYB 2N56A 5L2KA 2H2SC 3P77A 2R69H 2NY1B 2HRPH 1EXUB 2X10A 3KS0H 1BD2E 4J6RH 2FH8A 4N8VB 1ADQH 4DFHA 1Q9OA 4APQB 1I9RH 1NKRA 4G80B 3L3DB 4Z7UF 5C07E 2C26A 1ZS8B 4OF7A 3M1BA 2XKNA 2GK0A 3IRPX 1HH9B 1DLFL 5HXMA 4MAYD 3T0DA 3MV9D 4YDKL 3S7GA 4YUEH 5ALCL 5EBWA 4PGZA 3RY6C 1RJLA 4JN2A 4Z5RA 1GSMA 5H35B 2EXYD 5HYQB 3VG0H 1KLUA 1NFIA 5B38A 4JO3L 4BQ6A 15C8L 2DI9A 3AGVA 1HXMA 2CUMA 3ARUA 3VXNA 4WEBL 1KTLB 3KPSB 5DRXA 3OZ9H 5BO1H 2GITB 2E27L 1D6VL 3SPVB 2J4WL 2RGSA 4H26B 5FGCE 5GZNC 4ODHL 1KGCE 3QCUH 1JHLL 1XMWA 3BH9A 4JG1H 1OGAA 4F33A 4YHLL 4P2YA 3FKUS 5J6HA 1YEGL 4PJEE 4OLYL 5GS1A 1BD2A 5DK2B 3V6ZB 5D7LE 5JIPA 2ED9A 3DV4A 4UB0L 4XAWL 5GGVL 1FVDA 3MV8B 1TVBA 3GNMH 5C07A 2W60A 3DRQB 1IL1B 5HGBA 3QBTB 3O8XC 1ACYH 4HD9A 3U7WH 4NDMB 1J12A 4I2XE 1T0MA 1JPTL 1I3GH 1XGPB 1YN7A 2VZOA 3SDCC 4RMRA 2XPGB 4Z7VB 3BQUD 4LRIC 2D2OA 3ZKQD 3CH1A 1WCBB 4FFVD 4U1JB 3K8MA 4W6XB 2ADFL 1RZGB 5CKGA 5C0IA 4G6FB 3VH8B 4KXZH 3FCTA 4XZUA 4BZ1H 1C08A 5D7SH 4XMKH 2HJKA 4U1KA 4MD4B 3J8F7 4KKNA 1TZGH 1PVHA 1OT2A 4TNVK 5D70H 3GJFH 3NFSL 4AH2B 4PJEA 4UT9L 5D7LA 1LK2B 4GG6F 4MS8C 5HHNB 4RIRB 3BVNA 1O7SA 3KLAA 4YBQC 3DBXA 1FL6B 2NYYC 5D7IB 4JFHD 3AS2A 5T1MA 2DWEB 4PJHB 2FB4H 3MGAA 4R7DB 2JB6B 3IDNB 3MJ7A 4WHTB 4M93B 3SGKC 4I2XA 2VO5A 5L88H 1GVIA 5DRWA 5BCAA 1EZVY 3BDXA 3T0VA 1K8DA 1GIGL 5FCUH 1CXLA 4EBQH 3PWPE 4TSCL 1UWXK 1NC4D 3NFNB 1MCWM 5FYKL 4F7MA 4HULB 3RTQA 2WMPA 1M4KA 4XBGB 3OKEB 1A0QH 4JFOB 4YHMH 2C3XA 2OJEA 2ARWA 4X7TA 1AH1A 2G5BB 4AENB 5C86A 4Q0XL 3W9EB 2ZNXA 2QSQA 3RNQB 1OTTD 4JRWA 2O93L 4M5YH 4LCWB 5DEZA 5HI4D 1BX2A 3ARSA 3NACH 4XCEA 5EO1A 5FGBC 4JFPA 5F7EH 2VXUL 2BCKB 2DICA 1QFWL 2VR5A 4QF1B 2WIIA 1TCRB 1I7UB 3PJSB 3PGDA 4I13B 3KPSE 4E41D 3MLZH 2X41A 4CJ0A 1CG9A 3DMMC 4YXKH 1RIUL 1Z0NA 1YEDA 3PWPA 5B21A 5FEBA 3VD7A 4RAVA 3O3AB 4LCYB 3AREB 1XF2A 3LKNB 1P84K 3U6RA 1HHIB 1Y6KR 2DTSA 5DHYA 1VFBB 1ROWA 3GKWH 2P8PA 4M93C 1Y0LA 1JGVL 4N8VA 5DD0L 1H9VA 4KC3B 4APQA 3ZE2F 3KPNB 3MV8E 4G80A 5GJTL 3WS3B 3L3DA 2BNUB 2VC2H 1UEMA 1ZS8A 2ZCLL 2XKUA 4JPKH 6FABH 1HH9A 2NY5L 5JW3H 4P9MH 1XR8A 1LDSA 3EFDL 4PJDF 4U1LB 1BOYA 5D1ZA 4KY1H 5EZOH 5ITBH 5H35A 3V0VA 3BFOA 3RVWD 5T3ZE 5DRZA 4Q6IB 3O3BB 3QWQB 4BSWA 1D5IL 1OW0A 3HNTL 3SDXA 3BDBA 4CVXB 5ELIA 1R3KB 1KTLA 3KPSA 4ONFH 4YHKH 1U6AH 4H25B 1ZLSH 3HC4L 5CSBA 3SPVA 3IT8D 2HLFC 4HS3B 4NSKB 3GMPB 1RUQL 4WW2F 2HKHL 3MRJA 5IP4A 4WFHE 3MLUH 3FOMB 4ZFZB 3CXDH 3BW9A 2MSPA 2I9TB 1SEQL 4YXHL 3V6ZA 2DL9A 1S5IH 4PJ8B 3MV8A 5D7IE 1XEDA 1ZOXA 5F96H 4PJHE 3QQ4B 1IL1A 1A6WL 1Q0YH 4IMKC 4HF5L 4NDMA 1BZ9A 4JO4L 4HXAH 3O0RL 1YMMD 2VLRD 4U1MA 5IWLA 5DVLA 1GC1C 2K3TA 3AREC 1Y6NR 5E5RB 1NCNA 3QJHB 4P59L 1XGPA 2FYYA 3HAEG 3PDDA 3RUGF 2N1KA 2Q7YA 2R56L 1MCPH 1WCBA 2V2XA 4MD0B 4U1JA 2C3HA 5JUEH 3VH8A 2BC4A 5TH2B 2A73B 1XF3B 3CC5B 4D8PB 2UZIL 5I8EA 4Q9QH 4RWYH 1G9EA 3G9VA 1LD9A 4AH2A 1RMFH 2Y9RT 4O2FB 1IT9H 1T3FB 1K4CB 4K3HA 5HHVH 4MDIB 1LK2A 1CD1B 2ZPKL 1WV7T 4DQOL 1M7IB 3PUCA 3GHEL 1NEZB 2V5YA 4XC1H 2YC1B 1P4IL 2ADGB 4FZEL 5D7IA 5EOQH 1VACB 4LCWE 4JRYA 3RZWA 3GSWB 4PJHA 1CD9B 5IM7B 5ISZB 3JWNC 2ZUSA 4WHTA 3IXAB 4B53A 1RUPL 4MNQE 3DYPA 1T04B 5ILTL 5CGYC 3I3DA 4GAJH 4U1IB 1WZLA 2WV3A 1SJVA 5HGGS 3BEVB 4PJ8C 1PD6A 3NFNA 1RULL 3AS3A 2K7PA 2W9LA 1U8QB 1LE5B 4QGYA 2XOTA 4Y19D 4KZEH 2KKQA 3MTRA 3QPXH 5A16B 2XWJB 5J12C 4HC1A 1OCWH 4XC3H 2ZG1A 4JFOA 1A9BB 4QHMB 2QBWA 4Q9BA 4JDVB 4AENA 5I1HH 1WQVT 4HJJH 3W9EA 2WBWB 3T65B 5KW9H 3IDJB 1EGJL 1RI8A 2GHWB 5J56B 4DEPB 2AJYH 5E00B 3GI9L 2R4SL 2BCKA 2ED8A 3DJ9A 4MNQA 5EOCH 5BV7H 2IG2L 1J0HA 3NPSB 2VL5A 3GGWB 3PJSA 1INQA 5TFSL 3W2DL 4YC2B 4K3JH 1HIML 1I8MB 4EOWH 3FQUB 3RIFF 1MRCL 2VDPL 3WIHL 4HIHA 4LSUL 4P5TD 1D5BB 1JWMA 3O3AA 2V7NB 3UBXG 1EHXA 1IM9A 1U2HA 1VFBA 3KDMA 4RGOL 4RCAA 5F6IC 5JR1L 2R2EA 3RA7L 2BDNH 5HI3C 4HDIB 3RWEB 4YH6A 4K7PL 5CP7A 5T3XE 3KPNA 2XWBA 1UB5A 1QBLL 3WS3A 4KAQL 2CK2A 2BNUA 4UILL 3QUZD 4Z0XB 3BDYL 1JZ4A 3JV6B 1B2WH 3ZE0F 3TBTA 1MCOL 2CRMA 4Q6IA 3O3BA 4RMQA 3R0MA 4CVXA 1A6VL 2Q7NA 1FAIL 4H25A 3G08B 2JB5H 4JG0L 3ULVH 5F93C 4YWGH 1DBBH 4KHXH 2DQIL 2JELH 2I5YL 5TDPA 1AIFB 1J0YA 4XNXH 3LH2L 4LCCA 2DBLL 5I73B 1MVUA 4NSKA 3WFCL 2NY4D 3GMPA 2D9CA 5TF0A 1U9KA 3SJVB 4P2OB 2R15A 3QRGL 1SY6L 4AK1A 4ZFZA 1NLBL 4ZAKD 2I9TA 1CGWA 3P2TA 3IFOB 4C56B 4JB9H 3N1QC 5DC9B 2AVGA 4PJ8A 3OHXB 1WWAX 3L7EB 1VEPA 5DMIH 1CK0L 2RB8A 3QQ4A 4KUCF 3OG6B 5ISZE 3HE7C 5F7NC 3DUUB 4X4YB 4OZGB 4LK4A 3STZA 3VA2C 3QJHA 1OAUH 4HUMB 4BA8A 4LNRB 4M1DH 2DDQH 3SQOL 2Z8RA 5GGRB 4JVWA 3SKMB 3INUH 4MNHB 3I50L 5DD5L 4N0YH 1EUUA 5MHSD 2A73A 4K3DL 1IGFH 4D8PA 2P45B 4IIQB 1W0WB 4N9OB 5T1KD 4E42B 5I2IB 4FNLH 4U1HB 3P0YL 3CVHH 5HSFA 3MLSL 4S0SD 5BJTB 4O2FA 3CDFA 1K4CA 5FYJU 3UC0L 4QLRA 5GSRB 1CD1A 2F15A 1LQSR 4F57H 1NEZA 2YC1A 2ADGA 4YQXH 1A5FL 1JMXA 2HH0H 4NM4L 5GGQL 2DM2A 3AAZB 4NHUB 1QQDB 5ISZA 1GOFA 1MSPA 3IXAA 3BZ4B 4KKAD 1KELH 1T04A 1FVEB 2XZQL 4FP8L 4QYOB 5ADOH 5AYUL 2X4NA 4P2OC 2GI7A 2AI0L 1N0LA 2W9EH 1XT5A 1KFAH 2VUOA 1OF2B 1W72A 4E9LA 3ESUF 4NO3B 4Y0GA 2PO6C 2PTTB 3BEVA 1OTUC 4A2MA 4JRXD 1U8QA 1LE5A 3DVNB 4PY8I 1GGIL 1PEWA 1RZ8B 3VWKB 5BRZD 5A16A 5JHDB 4N90E 2XWJA 4X80L 5HDQH 1Q0XH 3FT3B 1V3KA 3V7AG 1JI1A 4L4TB 3T1FB 4JDVA 3VI3F 3NCJH 4ZFFB 3EYUH 2KQMA 5JOPD 1MCIA 3IDJA 3TA3A 4XCNB 4DKEL 2VSDA 4NQVB 3MCLH 5E00A 4XNMB 3O2DA 5DDHB 4D9QD 1D6EB 3QP3A 5EUKB 3X3FL 4L4JA 4QXGL 4NO0D 3TN0C 5EDXA 1BGXL 3BI9X 3DI2B 5I76A 1ONQA 3GGWA 3BP7B 2QSTA 1X4XA 4JJ5B 4BZ2L 2CJUH 4KJWD 3P4OB 5I8OH 1PQZA 1I8MA 5KSAD 3P0VH 2NY0B 4PJAF 3FQUA 2BX5A 1D5BA 4GLRI 4OLWL 4Z95H 2V7NA 3SKJL 3SGEH 4R4BB 3MLTA 3STBA 4EI5B 2KZWA 1ZT1A 4MLIA 1PZ5B 3PP3K 2ESVB 4HDIA 3RWEA 3AVEA 4P2QE 5D1XD 3S9DB 4AM0B 3DXAB 2H3NA 4PJ9B 1S9WB 3LQAL 3ALWA 2GW5A 4X6CA 1U8HA 3O2WL 2H6PB 4NO2B 3JV6A 2R29H 4OZGE 4ZS6D 4YHOH 3WN5B 3QUMH 5L9DL 1QSZA 1JF6A 2D4DA 1DANT 4O51B 3BJ91 3CDGA 2OTPA 4Z7OE 3DSFL 4HBCH 2JK5B 5CD3B 2P1YA 5JIIA 3QQ9D 2XQBH 1UCBH 4NNYB 3MRRB 3VXME 4OGYH 1AIFA 4I18B 1KCRL 3TO4D 1KLFA 3GSQA 1CFVL 4PRID 5AAMA 4DW2H 3AB0C 4A6YH 4ZD3L 4Z7WB 5I1DB 3BYTA 4ELMB 1UXWB 2ZUVA 4HUKB 1GJIA 3IFOA 1WVZA 4P2QA 3WL9B 4H8WC 1OP3H 1AFVL 1G9NH 3L7EA 3ZL4L 3ET9F 3AXLB 5IFJB 1EO5A 1MCSA 1WJ3A 4JKWA 3MOBH 2HTLC 4U0QB 3CFBB 1W8OA 3DUUA 3JWDL 4OZGA 3V4VH 4IM8A 2WP3O 5C0GB 5FO8B 1KIRB 1QKZL 2DQTH 1UWGH 5HJ3A 4ZXBC 4GRLD 4EI5C 5M7QA 4LNRA 5JPNB 2WAHA 5DUMH 5B22A 2VDLH 3SKMA 3VXMA 4MNHA 2EC8A 2EDKA 4F7TA 2BRRL 2IWGA 4C54A 1TETH 1HDMA 3BN3B 4K94H 3OKYA 3VI4F 1MFNA 1LO4L 3EJYD 5JHDE 4WV1C 3CK0H 1W0WA 4IIQA 3WN5C 4DK6A 4E42A 5I2IA 5CSGA 4CJ1A 3OPZL 1KB9J 5C0BB 1U95B 2FIKB 4L4TE 3P4MB 1F8TH 4NKOB 4LSVH 1FC1A 1LWRA 3AAZA 4O58L 1QQDA 5K93A 4LU5H 5FYKU 4P46A 1S5HB 1AXSA 3QULA 4OF3A 1OP5H 3BZ4A 3BX7C 1ED3A 5F3BB 2QQNH 1FVEA 5DEGB 4QYOA 3UDWC 4YIQA 1UVQB 2XXMB 4TSBL 1V3LA 4XVSL 3L5JA 3T3PE 1OF2A 1IAKB 2ICES 4NO3A 3E1F1 3B2UC 1ITCA 3QDAA 2YHGA 1BEYL 3CCHB 3H9SD 4IHOB 3DVNA 4KQ3H 1XIWB 2HWZH 1KC5H 4LDEB 1YNLL 3ZTJH 1LO0H 4PD4K 1RZ8A 2A74B 3KJ4B 3VWKA 5JHDA 3OQ3B 2ESVE 2DQJH 3B4NA 3DXAE 2YD8A 3TBYA 2FX8H 3AMLA 3T1FA 4LSTH 4ZFFA 1IRAY 1SM3H 5KTEL 3PE9A 3V5KB 3HMWH 5CEZE 1J7VR 4XB7A 1J5OL 3EO1B 4HAFA 4OCWL 5CZVL 3LEYH 4WWKD 2YN5A 5EU5B 4ZOBA 4HCRH 5DDHA 2F53B 4N8CL 1D6EA 1ES0B 5EUKA 3PL6B 2FX9H 5E8DH 3U0PA 5J89A 1FNAA 2Q3AA 1VGEH 4JJ5A 3S88H 1RK0B 3P4OA 3RX8A 4YHIB 3BGAA 3LHPL 5D71L 2VZ3A 2VN7A 4HS8H 3S37L 3FTGA 3X3GL 4QWWC 1UG9A 5HGDB 1JYWA 2HAZA 3ARBB 3MC0A 1MFAH 3RNKA 3VXTB 4R4BA 4Z7WE 3WD5H 4CDGC 2XG5A 1ZXQA 3QDJB 3SDAD 5DT1H 2GY5A 2WUBL 4AEIH 1BIIB 4AM0A 3DXAA 1NBQA 1UFUA 4HFWA 4PJ9A 3Q1SH 5E8PB 1J1XL 2H9GB 4D0CA 4NO2A 3K74B 2EDJA 3MYJA 7FABL 3L5HA 3RHWK 2H2PC 3VMNA 3BKMH 5E9DD 5F1NB 2VR9A 1H8OA 4ZPVA 1E4KC 4WNQB 2LQRA 5EA0H 1C5BL 4KI5C 1MCEA 1N8ZB 4HJGB 4KRMB 1MAKA 4XP5H 4NNYA 1GAFH 1NFDB 4I18A 4LPUA 5FYLE 3ZSSA 1MQKH 3TJHD 1PY9A 4Z7WA 4HK0B 4KFZC 3VWJB 1UXWA 1TQCB 2IPUG 1QNZH 2X5PA 5K59F 3OKKB 1FLRH 3KWWB 1FPTL 3VXOB 1MLCB 1FNLA 1CBVH 1OARL 3ZDXE 3U9PL 4YX2H 2Q20A 3EOAB 1W72L 3CFBA 4KDTC 4OUUB 3VGGA 4POZC 5J1AA 1UH2A 1OPGH 5BQ7B 4KMTL 5FO8A 1KIRA 4QRTB 4W6WB 1YJDH 3OJMB 1ZTXL 3C2AL 3K46A 4GMSH 5BS0B 1VB9A 2W91A 1H3WM 4M1CC 2P44B 2HT3C 2EZ0D 2O26U 5IVOA 3CZJA 1CLYH 1CLOL 1G6RH 3MX0A 4J3VA 4Y5VB 1NAMH 2DIBA 5FUZH 1U95A 2FIKA 4NYLA 3SDXF 1V7MH 1VPOL 2A77L 4NKOA 3QEQD 4AG4L 4XVJL 1UM4H 3NTCL 2F53E 3LRHA 1P4LA 1GOGA 1FIGL 5F3BA 4QKXB 5DEGA 2F5BH 5SWSB 2J5LB 3AU1A 2HVKB 1IEAA 3VWJC 5DHXB 1IAKA 1A7PH 4X5XA 1MIMH 1FL5B 4PREB 3MREB 1JFQH 4HWEH 5C0EA 2EDEA 4MCYA 1CICB 3CCHA 4WWID 5D2NE 3T1WA 1XIWA 4NJAH 5I1AB 1MCWW 1NBVH 4OQTH 3ZYZA 4OLZH 1MUJB 3VXRB 1BJMA 2A74A 4DN4H 3QDJE 2QV2A 3D9AH 3L5WB 3GJEB 3IDIB 2X4UB 2XQYG 3QEHB 2CIKB 4TTDC 3VGDA 1SYVA 1YYML 4PY8J 3QQNA 5JXED 3U36B 1G7HB 1A1MB 3V5KA 1J8HA 3EO1A 2DLTA 4M4PA 2O5YL 2FDBP 1P4BL 4WI9A 5EU5A 2BY2A 2F53A 1ES0A 3P73B 3MJ9L 3PL6A 4N5EC 2M1KA 1QLFA 4HJ0D 4POUB 4Y5VC 1Q9LB 3GJFK 3V5DA 3CJJA 8FABB 1EA9C 1RK0A 4TOYL 3MCG1 5IEKB 5E24E 1EIBA 3TT1L 4XHQA 2HTKC 4KDTA 1CTOA 5D7IF 3AFLA 4XMLH 4PJHF 4PJGB 1F4XL 5D2NA 5KG9A 3ARBA 3UTTD 3IFPB 1WFTA 4LLVB 1BM3L 1H5BB 4YEFA 3QDJA 2EYSA 3UAJC 1AD9B 1BIIA 4XGZB 4YJZL 4L1HA 4KK6D 3G5VA 4GRWB 2H9GA 5EBGA 2OYPA 5JW4R 5FV1L 2R2BB 2GEEA 1U3HD 3T09A 4D9LH 1OAZH 5I0DA 4M5ZL 2VDOL 3QHTC 4Z77B 1IGML 2NMSA 4WNQA 2YA2A 1L4IA 5FYJD 4X0KB 5BS0E 3QDHA 3PWLB 3S37X 5J6GA 1VFAB 4D9RD 3RIAK 3BHBB 5GISL 1EFQA 3UPCA 3H9ZA 5IR1A 3B9EA 3GEWB 1L7TH 3HG1A 2UYLB 5E6ID 2HG5A 4HK0A 2Y6SD 4PJFE 3OR7A 1JHKH 1S9XB 2EDNA 1OSPL 2XTJD 5E7BA 3KWWA 5GRJL 1G7QB 3VXOA 1S9KC 3JUZA 4ZUUB 3FB6B 3NCEB 4W70A 2HFGL 4OUUA 2HJLB 5H37G 5HI5D 4QRTA 5SWSE 5IROC 1GGTA 4LARL 5LXGL 1JPGA 3TV3L 4NZRL 3I6LE 5BS0A 2GJ6D 4KKBC 4BH7B 2ICWI 3L3GA 3K2UH 2PF6A 3FT4B 3VXRE 3REWB 3TFKD 1CI5A 4HIXH 4Z0BH 4RGNB 2D7OA 4WU7B 1B6UA 1CXFA 4PJFA 4KROB 1FV1B 2QHRH 4G9FD 3JV0A 3PGFL 4P49A 3GK8H 3NN8B 4YDIH 5E2TH 1VSCA 5CUSH 2NXZC 1FE8L 4YLQT 1OWRM 3D5OF 3D6GA 1FNSL 4FFZH 4KHTH 1KB5H 3TBSB 3UTSE 2K1MA 5SWSA 2EIZB 5AG8A 2HVKA 3V8CA 2EDFA 2MQCA 1JNJA 1FL5A 4PREA 1RIVL 1KCVL 2DJ4A 3NCCB 5C0RL 4LSRH 1CICA 4HH9B 1G7PA 4PJGE 5DQ9B 2DKUA 3LS5H 5I1AA 3C60C 4XWGH 3VXRA 1MUJA 5BMFL 5JIKA 1NLDL 4XNQB 2JJTC 1JE6A 3L5WA 5ACMA 3C8HA 5I17B 3GJEA 4LRNL 1KPVB 3IDIA 2X4UA 4HIJA 5GGSB 1RVFH 1DE4B 1C1EH 4GRWE 3U36A 1G7HA 1YQVH 3VJ6B 5I1LB 1N6UA 2QADB 4AIXA 1PY4A 4LQ1A 1U8KA 2BVQB 5KSBB 3RZCD 4LKXA 3P73A 4D0DB 1AJ7L 4S1QL 5DLML 4WEUD 4OZ4B 4F9PC 1AO7A 3UTSA 4RGNC 8FABA 1Q9LA 2Y06L 4NWUL 3UTPD 5LCVL 2WINB 1DQJB 4M8QA 4NRXB 3U9UB 2O5ZL 4KROC 2YPVL 1MQ8A 4FQIL 3EDJA 5D5MB 4CN6A 2XZAL 4JZJB 5IROA 1MNUH 3ARGC 3IFPA 3C6LD 1HI6B 4GSDL 1H5BA 1FVCB 3K4DA 4IEFB 1NBZB 2OJZH 2DD8L 5JW5B 3S36H 4LIQL 3OMZA 4RISL 5DQDL 4WFEE 3DO7B 4JFED 3MGTB 2VDMH 3DWTA 4I77L 4BUHA 2MWCA 2CKBL 2R2BA 4ETYA 5JQ6L 3ARPA 4KUCD 5EORL 2F5AL 4XNYL 1A3RL 5LKNA 1AXIB 4FQJH 2QQLH 1A7NL 2A9NL 4X6DF 4OCSL 3ALXA 4CMMB 1V7NL 3N0PB 4NOBA 5EU7C 4Y5XB 2R0KH 3OKDB 3FN0L 4YHZL 4ZFOB 4BJLA 1IILE 2CXGA 2P43B 2QADC 4ESKA 4RGNE 1FRGH 1ZHKA 4TULL 1U3JA 4NQCB 1IZKA 4OFDA 5E08L 1LDPL 1A14L 1QSVA 4M1GL 5GGTA 2AJZA 5I15L 3LV3A 4Z78A 3A6BH 4ZUUA 3FB6A 5I1EH 2HJLA 5F9WB 4OLXH 1DVFD 2CUIA 2ZUQB 4JZJC 4HKZB 4L4VD 2X70A 2XRAH 4KZDH 3VXPA 2SEBB 3O41B 1ZHNB 3HI5H 3D85B 4K3GA 4Y1AB 1JWSB 4BH7A 4UNUA 1G9MH 5LJYH 3CPLB 5E2VH 4OCMC 4YDLB 4H88L 1BQLL 5I8KL 4X6CF 3FHQA 4IRZL 4JFZL 5L7XL 2OL3H 3G6AB 3FT4A 1MHPL 3VFGL 3I6KB 2EDHA 1KJMB 5E99H 1Q94A 4OB5L 4D2NA 1T03L 3IETB 1BVLB 3BO8A 4WU7A 1CD8A 4XH2A 1T6WA 4MA8H 3V5HA 5GZOC 3HPLB 3BIKB 5GXBB 4WW1B 1MJUH 1IBGH 1FORL 2AQ3A 2Z93B 4JKPL 4X6EA 4YHYB 2FBJH 4Y5XC 5KSBE 3UEZA 2AEPL 1II4E 1UZ6E 4ZTPL 3GMLB 1T1YB 1EEZB 3HMXA 4XBEH 5TQ2L 2EIZA 1N7MH 3FO1B 4G6KL 3WHXB 4L3CA 2OSLB 3WJJC 5AZ2H 3IJSA 4Y16A 3D39B 2W0KA 5EUOB 2WWKT 5D5ME 2FLRT 4NNPL 3T2NH 1NGWB 5F97E 1KCLA 4HH9A 2NY7L 5SWZB 1VGKA 2NY3B 4CUCA 4XNQA 4OZGF 4NN5C 5F7DB 1CIDA 4P3CL 1WTGT 5I17A 3B43A 3JWDC 4P2RD 4ODVL 5DR5L 1GC1H 1A8JH 3GMMB 5GGSA 3UJJH 4WTWA 4OSUH 1DE4A 1AE6H 5C9KA 3VJ6A 4QXWA 3ZTNL 4Z7OF 3MUJA 5I1LA 3Q0HA 5CJXA 3SE8H 3QDMD 4G6AD 3SDDD 1DDHA 4R97B 4I3GA 2BVQA 4D0DA 5TJWK 2DTMH 1DBKH 1TZIB 4QRPE 4G6ML 1BFVH 1TJIL 5FUCC 2MQ0A 4JAMA 1DQJA 4OZFG 4I0PD 1I1AD 4NRXA