1IGXA

Crystal structure of eicosapentanoic acid bound in the cyclooxygenase channel of prostaglandin endoperoxide h synthase-1.
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
553
structure length
553
Chain Sequence
PVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of eicosapentaenoic and linoleic acids in the cyclooxygenase site of prostaglandin endoperoxide H synthase-1.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Prostaglandin Endoperoxide H Synthase-1
total genus 162
structure length 553
sequence length 553
ec nomenclature ec 1.14.99.1: Prostaglandin-endoperoxide synthase.
pdb deposition date 2001-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF03098 An_peroxidase Animal haem peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.640.10 Mainly Alpha Orthogonal Bundle Myeloperoxidase, subunit C Haem peroxidase domain superfamily, animal type 1igxA02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1igxA01
2RHPA 5IKVA 2G00L 3POYA 2PT3A 4X8SL 2I9AA 1IQJL 2D1JB 1IQML 3R5QA 2YGPA 3SXVA 1G2LB 2W2QE 2WPME 2WPLE 3QL6A 1HAFA 3LN1A 3HPTA 3GISX 5JB8E 3BT2A 2FZZL 5GH0A 1EPGA 2WYJB 1JV2B 1URKA 2WFTA 2FD6A 4NJBA 3TK5B 4NA9L 2FLRL 2BOUA 1IQIL 3TBDA 2Q1JB 1SZBA 1PXXA 1DNWC 4LORA 2P3TA 1PGEA 1APQA 2UWOB 2W3KB 3KQEL 1L5GB 1N1IA 1A3PA 2VWOL 4Z0KB 1FJSL 4OEKA 4ZH8B 5CKNA 4RRYA 4IG5A 1EQHA 5F1AA 4BTTA 2P95L 1K36A 4ZHAB 2GD4A 2BQWA 1YUGA 2W3IB 1FE2A 2WFXB 1MYPC 1LPZA 2PR3B 3KQDL 1CCVA 1ATBA 2EI8B 1UZPA 2K2SB 2XBWL 2WYGB 4M11A 2IKCA 2VVUL 3U73A 4XBMA 3ELAL 1DX5I 1W8BL 2RNLA 4X8UL 3NT1A 1D7WC 1NFYB 2J2UB 3DEMA 4Y79B 3FAQA 1IVOC 4CUFA 3N8FA 4Y55A 2VH6B 5HPWA 1F7MA 2XBYL 3OLUA 2MHPA 2H9EL 4D0EA 3V65B 4Y76B 3LN0A 6COXA 3TGFA 2AYLA 2XBVL 2EI6B 3LC3B 1NFXB 2Y5FL 2PUMA 5CKMA 1COUA 3V6QA 3Q3KB 1MHLC 3R4XA 1KIGL 1O5DL 1MQ5L 3HO3A 3OLTA 3N8YB 1Z6CA 1U8CB 2Y5HL 1TLEA 2OYUP 4BTIA 1FSBA 2WG3C 5JVZA 3RKEA 3LC5B 4RRWA 3ZYGA 3N8WB 3QCWA 4CSYA 3GCJA 3GCLA 1NT0A 2EI7B 4YZUB 1NFWB 4BXWA 1W7XL 4JYVL 4XL1A 1LQDA 2Z5ZA 4OTYA 4BTUA 1I0UA 1IJQA 4X8TL 3S4FA 1EZQB 1NQLB 3KQBL 5JBBE 5IKTA 1LPGA 1OB1C 4BXSA 2QRBA 1DIYA 1AUTL 1ADXA 3KL6B 2J4IB 1XKBA 4HHSA 1MQ6L 3GCKA 2F9BL 1HJ7A 2W2ME 3BXIA 5L30L 3TZIA 4O02B 4C16A 2GJMA 3TK6B 5E8DA 3M37L 2KL7A 1G1QA 1Q4GA 3SOQA 2VWMK 3BPSE 2PUQL 2WPKE 1IOXA 2P3FL 2PHBB 1IQGL 2W2NE 2E9EA 4MMYB 3P5BL 3F9PC 4A7IA 3GCWE 3HS5A 5FIWC 2DDUA 3MQEA 1J9CL 3LTFB 2I9BA 3HS7A 2WPIE 2VVVL 3HS6A 1XDTR 1DQBA 2QQTA 3KK6A 4Y7BB 3FNLA 3R55A 3ASIA 1HX2A 1IQKL 1PFXL 4Y6DB 4N7AA 3ENSA 4D90A 2NPRA 3CS7L 4CUEA 2P26A 3GC1A 5CISA 3KRKA 3SOBB 3N8WA 2WG4B 1EQGA 5COXA 2W26B 4KSZA 4MMXB 1JBUL 2XC4L 3LIWB 1IQLL 4YT7L 2IPSA 2J38B 3GCXE 1APOA 5KIRA 1EPIA 3BT1A 3CFWA 4Y71B 4ISHL 5JBCE 3F6UL 2W86A 4ZXYL 1UZJA 3H5CB 1D5LC 1IQHL 1FF7A 4QYQA 2Y5GL 2QPKA 4LMFA 1PRHA 2B7DL 1DNUC 4BDXA 4CUDA 1CX2A 4RRXA 1X7AL 1TPGA 3N8VA 1HREA 1CVWL 1F0SB 4RS0A 1EBVA 1EPHA 2J95B 1ATAA 4X8VL 2O86A 3MDLA 5CKQA 2FLBL 1XKAL 3F1SB 3ERHA 4KVKA 3CENL 1LMJA 2CJIB 3IJEB 4JZDL 4GM7A 3M36L 2XBXL 1IQEL 1ATDA 1FAXL 5K0HB 2TGFA 2BZ6L 2R5LA 4NG9L 2MGPA 1ZAQA 2VH0B 4JZFL 4LJJA 2NQXA 1XFEA 2P3FN 5KN5C 1EPJA 1WHEA 4C1MC 3ZS0C 4KVJA 3R5OA 3N8ZA 1YUFA 1HAEA 4MSFA 2VWLL 4NT3A 2Y38A 1D2VC 3QF1A 1G1TA 1CVUA 1NPEB 2WPJE 3KQCL 4AQTA 4DL1C 3U7UG 2P16L 1TOZA 2JKHL 1NFUB 3ZYJB 1P0SL 1N7DA 1HT8A 3NJPC 2WPHE 1EAIC 4NGAL 4M10A 4RUTA 5GLSA 2VJ3A 1IOEL 1CCFA 3NAKA 1ATEA 4TGFA 1IQFL 5JW1A 3FCSB 4FM5A 2BQ7A 1WU1B 1DDXA 4QJQA 2P28B 3PGHA 2BOKL 2J94B 1RFNB 4ZAEB 4Z6AL 1JL9A 1CEJA 3EGFA 4GN6A 4BDWA 2Y81B 3Q7DA 4YT6L 3KRQA 2BOHA 4JZEL 2UWLB 1G2MB 4OTJA 1L3YA 3TGYA 5FF1A 2M74A 3NYHA 2OYEP 4PH9A 1EGFA 1FFMA 1GK5A 4COXA 2KB9A 2Y7XB 2W2PE 2KV4A 2YGOA 4JYUL 3QH0A 1KSNB 5FDQA 1FAKL 1IGZA 1EMOA 5F19A 3TH3L 5IKQA 3NTGA 3LAQA 3SOVA 1U67A 3NIUA 1EMNA 1HZ8A 3ERIA 3V64C 4PNXA 2EHAA 3C9AC 5I46L 2Y82B 1YUKB 5JB9E 3OGWA 1LPKA 2K2TA 1KLIL 1CQEA 1KLOA 5L2YL 1BF9A 3QMOA 3KCGL 1K37A 1UZQA 1HCGB 3UBAA 2P93L 1V3XB 4RRZA 2XC0L 3CA7A 3LTGD 4XLWA 4ZXXL 1F7EA 4G1MB 3ZYIB 1P9JA 4Y7AB 1F0RB 4ISIL 1IQNL 3N8XA 3R05A 1C5MF 3N8YA 1IGXA 3HO5A 1WHFA 2XC5L 1DVAL 3I6NA 1UZKA 4O1ZA 3FBYA 3PY4A 5IKRA 3FFGL 1G1RA 1YO8A 1G1SA 2BMGA 1YGCL 3NTBA 2BO2A 2Y7ZB 4HHRA 1CXPC 1M1XB 5EGMB 2VWNL 4E1GA 2W2OE 3RR3A 4MMZB 2P3UA 1IP0A 1Z6EL 2BOXA 2VVCK 5JBAE 4Z0LA 1KLJL 2Y80B 1HRFA 1NZIA 1HT5A 2MGRA 4KVLA 3K9XA 4D0FA 2BQ6A 2EFBA 3SW2A 2P94L 3ZS1C 5JVYA 3IITB 1MOXC 1PTHA 2RA0L 2UWPB 2ADXA 2OJVA 2J34B 5B72A 3HO4A 1QFKL 1B9WA 5L2ZL 2FLGA 3Q9KA
chains in the Genus database with same CATH superfamily
2RHPA 5IKVA 2G00L 3POYA 2PT3A 4X8SL 2I9AA 1IQJL 2D1JB 1IQML 3R5QA 2YGPA 3SXVA 1G2LB 2W2QE 2WPME 2WPLE 3QL6A 1HAFA 3LN1A 3HPTA 3GISX 5JB8E 3BT2A 2FZZL 5GH0A 1EPGA 2WYJB 1JV2B 1URKA 2WFTA 2FD6A 4NJBA 3TK5B 4NA9L 2FLRL 2BOUA 1IQIL 3TBDA 2Q1JB 1SZBA 1PXXA 1DNWC 2HOXA 4LORA 2P3TA 1PGEA 1APQA 2UWOB 2W3KB 3KQEL 1L5GB 1N1IA 1A3PA 2VWOL 4Z0KB 1FJSL 4OEKA 4ZH8B 5CKNA 4RRYA 4IG5A 1EQHA 5F1AA 4BTTA 2P95L 1K36A 4ZHAB 2GD4A 2BQWA 1YUGA 2W3IB 1FE2A 2WFXB 1MYPC 1LPZA 2PR3B 3KQDL 1CCVA 1ATBA 2EI8B 1UZPA 2K2SB 2XBWL 2WYGB 4M11A 2IKCA 2VVUL 3U73A 4XBMA 3ELAL 1DX5I 1W8BL 2RNLA 4X8UL 3NT1A 1D7WC 1NFYB 2J2UB 3DEMA 4Y79B 3FAQA 1IVOC 4CUFA 3N8FA 4Y55A 2VRSA 2VH6B 5HPWA 1F7MA 2XBYL 3OLUA 2MHPA 2H9EL 4D0EA 3V65B 4Y76B 3LN0A 6COXA 3TGFA 2AYLA 2XBVL 2EI6B 2WZPP 3LC3B 1NFXB 2Y5FL 2PUMA 5CKMA 1COUA 3V6QA 3Q3KB 1MHLC 3R4XA 1KIGL 1O5DL 1MQ5L 3HO3A 3OLTA 3N8YB 1Z6CA 1U8CB 2Y5HL 1TLEA 2OYUP 4BTIA 1FSBA 2WG3C 5JVZA 3RKEA 3LC5B 4RRWA 3ZYGA 3N8WB 3QCWA 4CSYA 3GCJA 3GCLA 1NT0A 2EI7B 4YZUB 1NFWB 4BXWA 1W7XL 4JYVL 4XL1A 1LQDA 2Z5ZA 4OTYA 4BTUA 1I0UA 1IJQA 4X8TL 3S4FA 1EZQB 1NQLB 3KQBL 5JBBE 5IKTA 4GU4A 1LPGA 1OB1C 4BXSA 2QRBA 1DIYA 1AUTL 1ADXA 2YGQA 3KL6B 2J4IB 1XKBA 4HHSA 2H9EC 1MQ6L 3GCKA 2F9BL 1HJ7A 2W2ME 3BXIA 5L30L 3TZIA 4O02B 4C16A 2GJMA 3TK6B 5E8DA 3M37L 2KL7A 1G1QA 1Q4GA 3SOQA 2VWMK 3BPSE 2PUQL 2WPKE 1IOXA 2P3FL 2PHBB 1IQGL 2W2NE 2E9EA 4MMYB 3P5BL 3F9PC 4A7IA 3GCWE 3HS5A 5FIWC 2DDUA 3MQEA 1J9CL 3LTFB 2I9BA 3HS7A 2WPIE 2VVVL 3HS6A 1XDTR 1DQBA 2QQTA 1LK9A 3KK6A 4Y7BB 3FNLA 3R55A 3ASIA 1HX2A 1IQKL 1PFXL 4Y6DB 4N7AA 3ENSA 4D90A 2NPRA 3CS7L 4CUEA 2P26A 3GC1A 5CISA 3KRKA 3SOBB 3N8WA 2WG4B 1EQGA 5COXA 2W26B 4KSZA 4MMXB 1JBUL 2XC4L 3LIWB 1IQLL 4YT7L 1QIUA 2IPSA 2J38B 3GCXE 1APOA 5KIRA 1EPIA 3BT1A 3CFWA 4Y71B 2BT7A 4ISHL 5JBCE 3F6UL 2W86A 4ZXYL 1UZJA 3H5CB 1D5LC 1IQHL 1FF7A 4QYQA 2Y5GL 2QPKA 4LMFA 1PRHA 2B7DL 1DNUC 4BDXA 4CUDA 1CX2A 4RRXA 1X7AL 1TPGA 1V1HA 3N8VA 1HREA 1CVWL 1F0SB 4RS0A 1EBVA 1EPHA 2J95B 1ATAA 4X8VL 2O86A 3MDLA 2KNIA 5CKQA 2FLBL 1XKAL 3F1SB 3ERHA 4KVKA 3CENL 1LMJA 2CJIB 3IJEB 4JZDL 4GM7A 3M36L 2XBXL 1IQEL 1ATDA 1FAXL 5K0HB 2TGFA 2BZ6L 2R5LA 4NG9L 2MGPA 1ZAQA 2VH0B 4JZFL 4LJJA 2NQXA 1XFEA 2P3FN 5KN5C 1EPJA 1WHEA 4C1MC 3ZS0C 4KVJA 3R5OA 3N8ZA 1YUFA 1HAEA 4MSFA 2VWLL 4NT3A 2Y38A 1D2VC 3QF1A 1G1TA 1CVUA 4A94C 1NPEB 2WPJE 3KQCL 4AQTA 4DL1C 3U7UG 2P16L 1TOZA 2JKHL 1NFUB 3S6XA 3ZYJB 1P0SL 1N7DA 1HT8A 3NJPC 2WPHE 1EAIC 4NGAL 4M10A 4RUTA 5GLSA 2VJ3A 1IOEL 1CCFA 3NAKA 1ATEA 4TGFA 1IQFL 5JW1A 2BSFA 3FCSB 4FM5A 2BQ7A 1WU1B 1DDXA 4QJQA 2P28B 3PGHA 2BOKL 2J94B 1RFNB 4ZAEB 4Z6AL 1JL9A 1CEJA 3EGFA 4GN6A 4BDWA 2Y81B 3Q7DA 4YT6L 3KRQA 2BOHA 4JZEL 2UWLB 1G2MB 4OTJA 1L3YA 3TGYA 5FF1A 2M74A 3NYHA 2OYEP 4PH9A 1EGFA 1FFMA 1GK5A 4COXA 2KB9A 2Y7XB 2W2PE 2KV4A 2YGOA 4JYUL 3QH0A 1KSNB 5FDQA 1FAKL 1IGZA 1EMOA 5F19A 3TH3L 5IKQA 3NTGA 3LAQA 3SOVA 1U67A 3NIUA 1EMNA 1HZ8A 3ERIA 3V64C 2BT8A 4PNXA 2EHAA 3C9AC 5I46L 2Y82B 1YUKB 5JB9E 3OGWA 1LPKA 2K2TA 1KLIL 1CQEA 1KLOA 5L2YL 1BF9A 3QMOA 3KCGL 1K37A 1UZQA 1V1IA 1HCGB 3UBAA 2P93L 1V3XB 4RRZA 2XC0L 3CA7A 3LTGD 4XLWA 4ZXXL 1F7EA 4G1MB 3ZYIB 1P9JA 4Y7AB 1F0RB 4ISIL 1IQNL 3N8XA 3R05A 1C5MF 3N8YA 1IGXA 3HO5A 1WHFA 2XC5L 1DVAL 3I6NA 1UZKA 4O1ZA 3FBYA 3PY4A 5IKRA 3FFGL 1G1RA 1YO8A 1G1SA 2BMGA 1YGCL 3NTBA 2BO2A 2Y7ZB 4HHRA 1CXPC 1M1XB 5EGMB 2VWNL 2JJLA 4E1GA 2HORA 2W2OE 3RR3A 4MMZB 2P3UA 1IP0A 1Z6EL 2BOXA 2VVCK 5JBAE 4Z0LA 1KLJL 2Y80B 1HRFA 1NZIA 1HT5A 2MGRA 4KVLA 3K9XA 1KKEA 4D0FA 4GU3A 2BQ6A 2EFBA 3SW2A 2P94L 3ZS1C 5JVYA 3IITB 1LMMA 1PTHA 1MOXC 2RA0L 2UWPB 2ADXA 2OJVA 2J34B 5B72A 3HO4A 1QFKL 1B9WA 5L2ZL 2FLGA 3Q9KA
chains in the Genus database with same CATH topology
2RHPA 5IKVA 2G00L 3POYA 2PT3A 4X8SL 2I9AA 1IQJL 2D1JB 1IQML 3R5QA 2YGPA 3SXVA 1G2LB 2W2QE 2WPME 2WPLE 3QL6A 1HAFA 3LN1A 3HPTA 3GISX 5JB8E 3BT2A 2FZZL 5GH0A 1EPGA 2WYJB 1JV2B 1URKA 2WFTA 2FD6A 4NJBA 3TK5B 4NA9L 2FLRL 2BOUA 1IQIL 3TBDA 2Q1JB 1SZBA 1PXXA 1DNWC 4LORA 2P3TA 1PGEA 1APQA 2UWOB 2W3KB 3KQEL 1L5GB 1N1IA 1A3PA 2VWOL 4Z0KB 1FJSL 4OEKA 4ZH8B 5CKNA 4RRYA 4IG5A 1EQHA 5F1AA 4BTTA 2P95L 1K36A 4ZHAB 2GD4A 2BQWA 1YUGA 2W3IB 1FE2A 2WFXB 1MYPC 1LPZA 2PR3B 3KQDL 1CCVA 1ATBA 2EI8B 1UZPA 2K2SB 2XBWL 2WYGB 4M11A 2IKCA 2VVUL 3U73A 4XBMA 3ELAL 1DX5I 1W8BL 2RNLA 4X8UL 3NT1A 1D7WC 1NFYB 2J2UB 3DEMA 4Y79B 3FAQA 1IVOC 4CUFA 3N8FA 4Y55A 2VH6B 5HPWA 1F7MA 2XBYL 3OLUA 2MHPA 2H9EL 4D0EA 3V65B 4Y76B 3LN0A 6COXA 3TGFA 2AYLA 2XBVL 2EI6B 2WZPP 3LC3B 1NFXB 2Y5FL 2PUMA 5CKMA 1COUA 3V6QA 3Q3KB 1MHLC 3R4XA 1KIGL 1O5DL 1MQ5L 3HO3A 3OLTA 3N8YB 1Z6CA 1U8CB 2Y5HL 1TLEA 2OYUP 4BTIA 1FSBA 2WG3C 5JVZA 3RKEA 3LC5B 4RRWA 3ZYGA 3N8WB 3QCWA 4CSYA 3GCJA 3GCLA 1NT0A 2EI7B 4YZUB 1NFWB 4BXWA 1W7XL 4JYVL 4XL1A 1LQDA 2Z5ZA 4OTYA 4BTUA 1I0UA 1IJQA 4X8TL 3S4FA 1EZQB 1NQLB 3KQBL 5JBBE 5IKTA 1LPGA 1OB1C 4BXSA 2QRBA 1DIYA 1AUTL 1ADXA 2YGQA 3KL6B 2J4IB 1XKBA 4HHSA 2H9EC 1MQ6L 3GCKA 2F9BL 1HJ7A 2W2ME 3BXIA 5L30L 3TZIA 4O02B 4C16A 2GJMA 3TK6B 5E8DA 3M37L 2KL7A 1G1QA 1Q4GA 3SOQA 2VWMK 3BPSE 2PUQL 2WPKE 1IOXA 2P3FL 2PHBB 1IQGL 2W2NE 2E9EA 4MMYB 3P5BL 3F9PC 4A7IA 3GCWE 3HS5A 5FIWC 2DDUA 3MQEA 1J9CL 3LTFB 2I9BA 3HS7A 2WPIE 2VVVL 3HS6A 1XDTR 1DQBA 2QQTA 3KK6A 4Y7BB 3FNLA 3R55A 3ASIA 1HX2A 1IQKL 1PFXL 4Y6DB 4N7AA 3ENSA 4D90A 2NPRA 3CS7L 4CUEA 2P26A 3GC1A 5CISA 3KRKA 3SOBB 3N8WA 2WG4B 1EQGA 5COXA 2W26B 4KSZA 4MMXB 1JBUL 2XC4L 3LIWB 1IQLL 4YT7L 2IPSA 2J38B 3GCXE 1APOA 5KIRA 1EPIA 3BT1A 3CFWA 4Y71B 4ISHL 5JBCE 3F6UL 2W86A 4ZXYL 1UZJA 3H5CB 1D5LC 1IQHL 1FF7A 4QYQA 2Y5GL 2QPKA 4LMFA 1PRHA 2B7DL 1DNUC 4BDXA 4CUDA 1CX2A 4RRXA 1X7AL 1TPGA 3N8VA 1HREA 1CVWL 1F0SB 4RS0A 1EBVA 1EPHA 2J95B 1ATAA 4X8VL 2O86A 3MDLA 2KNIA 5CKQA 2FLBL 1XKAL 3F1SB 3ERHA 4KVKA 3CENL 1LMJA 2CJIB 3IJEB 4JZDL 4GM7A 3M36L 2XBXL 1IQEL 1ATDA 1FAXL 5K0HB 2TGFA 2BZ6L 2R5LA 4NG9L 2MGPA 1ZAQA 2VH0B 4JZFL 4LJJA 2NQXA 1XFEA 2P3FN 5KN5C 1EPJA 1WHEA 4C1MC 3ZS0C 4KVJA 3R5OA 3N8ZA 1YUFA 1HAEA 4MSFA 2VWLL 4NT3A 2Y38A 1D2VC 3QF1A 1G1TA 1CVUA 4A94C 1NPEB 2WPJE 3KQCL 4AQTA 4DL1C 3U7UG 2P16L 1TOZA 2JKHL 1NFUB 3S6XA 3ZYJB 1P0SL 1N7DA 1HT8A 3NJPC 2WPHE 1EAIC 4NGAL 4M10A 4RUTA 5GLSA 2VJ3A 1IOEL 1CCFA 3NAKA 1ATEA 4TGFA 1IQFL 5JW1A 3FCSB 4FM5A 2BQ7A 1WU1B 1DDXA 4QJQA 2P28B 3PGHA 2BOKL 2J94B 1RFNB 4ZAEB 4Z6AL 1JL9A 1CEJA 3EGFA 4GN6A 4BDWA 2Y81B 3Q7DA 4YT6L 3KRQA 2BOHA 4JZEL 2UWLB 1G2MB 4OTJA 1L3YA 3TGYA 5FF1A 2M74A 3NYHA 2OYEP 4PH9A 1EGFA 1FFMA 1GK5A 4COXA 2KB9A 2Y7XB 2W2PE 2KV4A 2YGOA 4JYUL 3QH0A 1KSNB 5FDQA 1FAKL 1IGZA 1EMOA 5F19A 3TH3L 5IKQA 3NTGA 3LAQA 3SOVA 1U67A 3NIUA 1EMNA 1HZ8A 3ERIA 3V64C 4PNXA 2EHAA 3C9AC 5I46L 2Y82B 1YUKB 5JB9E 3OGWA 1LPKA 2K2TA 1KLIL 1CQEA 1KLOA 5L2YL 1BF9A 3QMOA 3KCGL 1K37A 1UZQA 1HCGB 3UBAA 2P93L 1V3XB 4RRZA 2XC0L 3CA7A 3LTGD 4XLWA 4ZXXL 1F7EA 4G1MB 3ZYIB 1P9JA 4Y7AB 1F0RB 4ISIL 1IQNL 3N8XA 3R05A 1C5MF 3N8YA 1IGXA 3HO5A 1WHFA 2XC5L 1DVAL 3I6NA 1UZKA 4O1ZA 3FBYA 3PY4A 5IKRA 3FFGL 1G1RA 1YO8A 1G1SA 2BMGA 1YGCL 3NTBA 2BO2A 2Y7ZB 4HHRA 1CXPC 1M1XB 5EGMB 2VWNL 4E1GA 2W2OE 3RR3A 4MMZB 2P3UA 1IP0A 1Z6EL 2BOXA 2VVCK 5JBAE 4Z0LA 1KLJL 2Y80B 1HRFA 1NZIA 1HT5A 2MGRA 4KVLA 3K9XA 4D0FA 2BQ6A 2EFBA 3SW2A 2P94L 3ZS1C 5JVYA 3IITB 1LMMA 1PTHA 1MOXC 2RA0L 2UWPB 2ADXA 2OJVA 2J34B 5B72A 3HO4A 1QFKL 1B9WA 5L2ZL 2FLGA 3Q9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHP A;  5IKV A;  2G00 L;  3POY A;  2PT3 A;  4X8S L;  2I9A A;  1IQJ L;  2D1J B;  1IQM L;  3R5Q A;  2YGP A;  3SXV A;  1G2L B;  2W2Q E;  2WPM E;  2WPL E;  3QL6 A;  1HAF A;  3LN1 A;  3HPT A;  3GIS X;  5JB8 E;  3BT2 A;  2FZZ L;  5GH0 A;  1EPG A;  2WYJ B;  1JV2 B;  1URK A;  2WFT A;  2FD6 A;  4NJB A;  3TK5 B;  4NA9 L;  2FLR L;  2BOU A;  1IQI L;  3TBD A;  2Q1J B;  1SZB A;  1PXX A;  1DNW C;  4LOR A;  2P3T A;  1PGE A;  1APQ A;  2UWO B;  2W3K B;  3KQE L;  1L5G B;  1N1I A;  1A3P A;  2VWO L;  4Z0K B;  1FJS L;  4OEK A;  4ZH8 B;  5CKN A;  4RRY A;  4IG5 A;  1EQH A;  5F1A A;  4BTT A;  2P95 L;  1K36 A;  4ZHA B;  2GD4 A;  2BQW A;  1YUG A;  2W3I B;  1FE2 A;  2WFX B;  1MYP C;  1LPZ A;  2PR3 B;  3KQD L;  1CCV A;  1ATB A;  2EI8 B;  1UZP A;  2K2S B;  2XBW L;  2WYG B;  4M11 A;  2IKC A;  2VVU L;  3U73 A;  4XBM A;  3ELA L;  1DX5 I;  1W8B L;  2RNL A;  4X8U L;  3NT1 A;  1D7W C;  1NFY B;  2J2U B;  3DEM A;  4Y79 B;  3FAQ A;  1IVO C;  4CUF A;  3N8F A;  4Y55 A;  2VH6 B;  5HPW A;  1F7M A;  2XBY L;  3OLU A;  2MHP A;  2H9E L;  4D0E A;  3V65 B;  4Y76 B;  3LN0 A;  6COX A;  3TGF A;  2AYL A;  2XBV L;  2EI6 B;  3LC3 B;  1NFX B;  2Y5F L;  2PUM A;  5CKM A;  1COU A;  3V6Q A;  3Q3K B;  1MHL C;  3R4X A;  1KIG L;  1O5D L;  1MQ5 L;  3HO3 A;  3OLT A;  3N8Y B;  1Z6C A;  1U8C B;  2Y5H L;  1TLE A;  2OYU P;  4BTI A;  1FSB A;  2WG3 C;  5JVZ A;  3RKE A;  3LC5 B;  4RRW A;  3ZYG A;  3N8W B;  3QCW A;  4CSY A;  3GCJ A;  3GCL A;  1NT0 A;  2EI7 B;  4YZU B;  1NFW B;  4BXW A;  1W7X L;  4JYV L;  4XL1 A;  1LQD A;  2Z5Z A;  4OTY A;  4BTU A;  1I0U A;  1IJQ A;  4X8T L;  3S4F A;  1EZQ B;  1NQL B;  3KQB L;  5JBB E;  5IKT A;  1LPG A;  1OB1 C;  4BXS A;  2QRB A;  1DIY A;  1AUT L;  1ADX A;  3KL6 B;  2J4I B;  1XKB A;  4HHS A;  1MQ6 L;  3GCK A;  2F9B L;  1HJ7 A;  2W2M E;  3BXI A;  5L30 L;  3TZI A;  4O02 B;  4C16 A;  2GJM A;  3TK6 B;  5E8D A;  3M37 L;  2KL7 A;  1G1Q A;  1Q4G A;  3SOQ A;  2VWM K;  3BPS E;  2PUQ L;  2WPK E;  1IOX A;  2P3F L;  2PHB B;  1IQG L;  2W2N E;  2E9E A;  4MMY B;  3P5B L;  3F9P C;  4A7I A;  3GCW E;  3HS5 A;  5FIW C;  2DDU A;  3MQE A;  1J9C L;  3LTF B;  2I9B A;  3HS7 A;  2WPI E;  2VVV L;  3HS6 A;  1XDT R;  1DQB A;  2QQT A;  3KK6 A;  4Y7B B;  3FNL A;  3R55 A;  3ASI A;  1HX2 A;  1IQK L;  1PFX L;  4Y6D B;  4N7A A;  3ENS A;  4D90 A;  2NPR A;  3CS7 L;  4CUE A;  2P26 A;  3GC1 A;  5CIS A;  3KRK A;  3SOB B;  3N8W A;  2WG4 B;  1EQG A;  5COX A;  2W26 B;  4KSZ A;  4MMX B;  1JBU L;  2XC4 L;  3LIW B;  1IQL L;  4YT7 L;  2IPS A;  2J38 B;  3GCX E;  1APO A;  5KIR A;  1EPI A;  3BT1 A;  3CFW A;  4Y71 B;  4ISH L;  5JBC E;  3F6U L;  2W86 A;  4ZXY L;  1UZJ A;  3H5C B;  1D5L C;  1IQH L;  1FF7 A;  4QYQ A;  2Y5G L;  2QPK A;  4LMF A;  1PRH A;  2B7D L;  1DNU C;  4BDX A;  4CUD A;  1CX2 A;  4RRX A;  1X7A L;  1TPG A;  3N8V A;  1HRE A;  1CVW L;  1F0S B;  4RS0 A;  1EBV A;  1EPH A;  2J95 B;  1ATA A;  4X8V L;  2O86 A;  3MDL A;  5CKQ A;  2FLB L;  1XKA L;  3F1S B;  3ERH A;  4KVK A;  3CEN L;  1LMJ A;  2CJI B;  3IJE B;  4JZD L;  4GM7 A;  3M36 L;  2XBX L;  1IQE L;  1ATD A;  1FAX L;  5K0H B;  2TGF A;  2BZ6 L;  2R5L A;  4NG9 L;  2MGP A;  1ZAQ A;  2VH0 B;  4JZF L;  4LJJ A;  2NQX A;  1XFE A;  2P3F N;  5KN5 C;  1EPJ A;  1WHE A;  4C1M C;  3ZS0 C;  4KVJ A;  3R5O A;  3N8Z A;  1YUF A;  1HAE A;  4MSF A;  2VWL L;  4NT3 A;  2Y38 A;  1D2V C;  3QF1 A;  1G1T A;  1CVU A;  1NPE B;  2WPJ E;  3KQC L;  4AQT A;  4DL1 C;  3U7U G;  2P16 L;  1TOZ A;  2JKH L;  1NFU B;  3ZYJ B;  1P0S L;  1N7D A;  1HT8 A;  3NJP C;  2WPH E;  1EAI C;  4NGA L;  4M10 A;  4RUT A;  5GLS A;  2VJ3 A;  1IOE L;  1CCF A;  3NAK A;  1ATE A;  4TGF A;  1IQF L;  5JW1 A;  3FCS B;  4FM5 A;  2BQ7 A;  1WU1 B;  1DDX A;  4QJQ A;  2P28 B;  3PGH A;  2BOK L;  2J94 B;  1RFN B;  4ZAE B;  4Z6A L;  1JL9 A;  1CEJ A;  3EGF A;  4GN6 A;  4BDW A;  2Y81 B;  3Q7D A;  4YT6 L;  3KRQ A;  2BOH A;  4JZE L;  2UWL B;  1G2M B;  4OTJ A;  1L3Y A;  3TGY A;  5FF1 A;  2M74 A;  3NYH A;  2OYE P;  4PH9 A;  1EGF A;  1FFM A;  1GK5 A;  4COX A;  2KB9 A;  2Y7X B;  2W2P E;  2KV4 A;  2YGO A;  4JYU L;  3QH0 A;  1KSN B;  5FDQ A;  1FAK L;  1IGZ A;  1EMO A;  5F19 A;  3TH3 L;  5IKQ A;  3NTG A;  3LAQ A;  3SOV A;  1U67 A;  3NIU A;  1EMN A;  1HZ8 A;  3ERI A;  3V64 C;  4PNX A;  2EHA A;  3C9A C;  5I46 L;  2Y82 B;  1YUK B;  5JB9 E;  3OGW A;  1LPK A;  2K2T A;  1KLI L;  1CQE A;  1KLO A;  5L2Y L;  1BF9 A;  3QMO A;  3KCG L;  1K37 A;  1UZQ A;  1HCG B;  3UBA A;  2P93 L;  1V3X B;  4RRZ A;  2XC0 L;  3CA7 A;  3LTG D;  4XLW A;  4ZXX L;  1F7E A;  4G1M B;  3ZYI B;  1P9J A;  4Y7A B;  1F0R B;  4ISI L;  1IQN L;  3N8X A;  3R05 A;  1C5M F;  3N8Y A;  1IGX A;  3HO5 A;  1WHF A;  2XC5 L;  1DVA L;  3I6N A;  1UZK A;  4O1Z A;  3FBY A;  3PY4 A;  5IKR A;  3FFG L;  1G1R A;  1YO8 A;  1G1S A;  2BMG A;  1YGC L;  3NTB A;  2BO2 A;  2Y7Z B;  4HHR A;  1CXP C;  1M1X B;  5EGM B;  2VWN L;  4E1G A;  2W2O E;  3RR3 A;  4MMZ B;  2P3U A;  1IP0 A;  1Z6E L;  2BOX A;  2VVC K;  5JBA E;  4Z0L A;  1KLJ L;  2Y80 B;  1HRF A;  1NZI A;  1HT5 A;  2MGR A;  4KVL A;  3K9X A;  4D0F A;  2BQ6 A;  2EFB A;  3SW2 A;  2P94 L;  3ZS1 C;  5JVY A;  3IIT B;  1MOX C;  1PTH A;  2RA0 L;  2UWP B;  2ADX A;  2OJV A;  2J34 B;  5B72 A;  3HO4 A;  1QFK L;  1B9W A;  5L2Z L;  2FLG A;  3Q9K A; 
#chains in the Genus database with same CATH topology
 2RHP A;  5IKV A;  2G00 L;  3POY A;  2PT3 A;  4X8S L;  2I9A A;  1IQJ L;  2D1J B;  1IQM L;  3R5Q A;  2YGP A;  3SXV A;  1G2L B;  2W2Q E;  2WPM E;  2WPL E;  3QL6 A;  1HAF A;  3LN1 A;  3HPT A;  3GIS X;  5JB8 E;  3BT2 A;  2FZZ L;  5GH0 A;  1EPG A;  2WYJ B;  1JV2 B;  1URK A;  2WFT A;  2FD6 A;  4NJB A;  3TK5 B;  4NA9 L;  2FLR L;  2BOU A;  1IQI L;  3TBD A;  2Q1J B;  1SZB A;  1PXX A;  1DNW C;  2HOX A;  4LOR A;  2P3T A;  1PGE A;  1APQ A;  2UWO B;  2W3K B;  3KQE L;  1L5G B;  1N1I A;  1A3P A;  2VWO L;  4Z0K B;  1FJS L;  4OEK A;  4ZH8 B;  5CKN A;  4RRY A;  4IG5 A;  1EQH A;  5F1A A;  4BTT A;  2P95 L;  1K36 A;  4ZHA B;  2GD4 A;  2BQW A;  1YUG A;  2W3I B;  1FE2 A;  2WFX B;  1MYP C;  1LPZ A;  2PR3 B;  3KQD L;  1CCV A;  1ATB A;  2EI8 B;  1UZP A;  2K2S B;  2XBW L;  2WYG B;  4M11 A;  2IKC A;  2VVU L;  3U73 A;  4XBM A;  3ELA L;  1DX5 I;  1W8B L;  2RNL A;  4X8U L;  3NT1 A;  1D7W C;  1NFY B;  2J2U B;  3DEM A;  4Y79 B;  3FAQ A;  1IVO C;  4CUF A;  3N8F A;  4Y55 A;  2VRS A;  2VH6 B;  5HPW A;  1F7M A;  2XBY L;  3OLU A;  2MHP A;  2H9E L;  4D0E A;  3V65 B;  4Y76 B;  3LN0 A;  6COX A;  3TGF A;  2AYL A;  2XBV L;  2EI6 B;  2WZP P;  3LC3 B;  1NFX B;  2Y5F L;  2PUM A;  5CKM A;  1COU A;  3V6Q A;  3Q3K B;  1MHL C;  3R4X A;  1KIG L;  1O5D L;  1MQ5 L;  3HO3 A;  3OLT A;  3N8Y B;  1Z6C A;  1U8C B;  2Y5H L;  1TLE A;  2OYU P;  4BTI A;  1FSB A;  2WG3 C;  5JVZ A;  3RKE A;  3LC5 B;  4RRW A;  3ZYG A;  3N8W B;  3QCW A;  4CSY A;  3GCJ A;  3GCL A;  1NT0 A;  2EI7 B;  4YZU B;  1NFW B;  4BXW A;  1W7X L;  4JYV L;  4XL1 A;  1LQD A;  2Z5Z A;  4OTY A;  4BTU A;  1I0U A;  1IJQ A;  4X8T L;  3S4F A;  1EZQ B;  1NQL B;  3KQB L;  5JBB E;  5IKT A;  4GU4 A;  1LPG A;  1OB1 C;  4BXS A;  2QRB A;  1DIY A;  1AUT L;  1ADX A;  2YGQ A;  3KL6 B;  2J4I B;  1XKB A;  4HHS A;  2H9E C;  1MQ6 L;  3GCK A;  2F9B L;  1HJ7 A;  2W2M E;  3BXI A;  5L30 L;  3TZI A;  4O02 B;  4C16 A;  2GJM A;  3TK6 B;  5E8D A;  3M37 L;  2KL7 A;  1G1Q A;  1Q4G A;  3SOQ A;  2VWM K;  3BPS E;  2PUQ L;  2WPK E;  1IOX A;  2P3F L;  2PHB B;  1IQG L;  2W2N E;  2E9E A;  4MMY B;  3P5B L;  3F9P C;  4A7I A;  3GCW E;  3HS5 A;  5FIW C;  2DDU A;  3MQE A;  1J9C L;  3LTF B;  2I9B A;  3HS7 A;  2WPI E;  2VVV L;  3HS6 A;  1XDT R;  1DQB A;  2QQT A;  1LK9 A;  3KK6 A;  4Y7B B;  3FNL A;  3R55 A;  3ASI A;  1HX2 A;  1IQK L;  1PFX L;  4Y6D B;  4N7A A;  3ENS A;  4D90 A;  2NPR A;  3CS7 L;  4CUE A;  2P26 A;  3GC1 A;  5CIS A;  3KRK A;  3SOB B;  3N8W A;  2WG4 B;  1EQG A;  5COX A;  2W26 B;  4KSZ A;  4MMX B;  1JBU L;  2XC4 L;  3LIW B;  1IQL L;  4YT7 L;  1QIU A;  2IPS A;  2J38 B;  3GCX E;  1APO A;  5KIR A;  1EPI A;  3BT1 A;  3CFW A;  4Y71 B;  2BT7 A;  4ISH L;  5JBC E;  3F6U L;  2W86 A;  4ZXY L;  1UZJ A;  3H5C B;  1D5L C;  1IQH L;  1FF7 A;  4QYQ A;  2Y5G L;  2QPK A;  4LMF A;  1PRH A;  2B7D L;  1DNU C;  4BDX A;  4CUD A;  1CX2 A;  4RRX A;  1X7A L;  1TPG A;  1V1H A;  3N8V A;  1HRE A;  1CVW L;  1F0S B;  4RS0 A;  1EBV A;  1EPH A;  2J95 B;  1ATA A;  4X8V L;  2O86 A;  3MDL A;  2KNI A;  5CKQ A;  2FLB L;  1XKA L;  3F1S B;  3ERH A;  4KVK A;  3CEN L;  1LMJ A;  2CJI B;  3IJE B;  4JZD L;  4GM7 A;  3M36 L;  2XBX L;  1IQE L;  1ATD A;  1FAX L;  5K0H B;  2TGF A;  2BZ6 L;  2R5L A;  4NG9 L;  2MGP A;  1ZAQ A;  2VH0 B;  4JZF L;  4LJJ A;  2NQX A;  1XFE A;  2P3F N;  5KN5 C;  1EPJ A;  1WHE A;  4C1M C;  3ZS0 C;  4KVJ A;  3R5O A;  3N8Z A;  1YUF A;  1HAE A;  4MSF A;  2VWL L;  4NT3 A;  2Y38 A;  1D2V C;  3QF1 A;  1G1T A;  1CVU A;  4A94 C;  1NPE B;  2WPJ E;  3KQC L;  4AQT A;  4DL1 C;  3U7U G;  2P16 L;  1TOZ A;  2JKH L;  1NFU B;  3S6X A;  3ZYJ B;  1P0S L;  1N7D A;  1HT8 A;  3NJP C;  2WPH E;  1EAI C;  4NGA L;  4M10 A;  4RUT A;  5GLS A;  2VJ3 A;  1IOE L;  1CCF A;  3NAK A;  1ATE A;  4TGF A;  1IQF L;  5JW1 A;  2BSF A;  3FCS B;  4FM5 A;  2BQ7 A;  1WU1 B;  1DDX A;  4QJQ A;  2P28 B;  3PGH A;  2BOK L;  2J94 B;  1RFN B;  4ZAE B;  4Z6A L;  1JL9 A;  1CEJ A;  3EGF A;  4GN6 A;  4BDW A;  2Y81 B;  3Q7D A;  4YT6 L;  3KRQ A;  2BOH A;  4JZE L;  2UWL B;  1G2M B;  4OTJ A;  1L3Y A;  3TGY A;  5FF1 A;  2M74 A;  3NYH A;  2OYE P;  4PH9 A;  1EGF A;  1FFM A;  1GK5 A;  4COX A;  2KB9 A;  2Y7X B;  2W2P E;  2KV4 A;  2YGO A;  4JYU L;  3QH0 A;  1KSN B;  5FDQ A;  1FAK L;  1IGZ A;  1EMO A;  5F19 A;  3TH3 L;  5IKQ A;  3NTG A;  3LAQ A;  3SOV A;  1U67 A;  3NIU A;  1EMN A;  1HZ8 A;  3ERI A;  3V64 C;  2BT8 A;  4PNX A;  2EHA A;  3C9A C;  5I46 L;  2Y82 B;  1YUK B;  5JB9 E;  3OGW A;  1LPK A;  2K2T A;  1KLI L;  1CQE A;  1KLO A;  5L2Y L;  1BF9 A;  3QMO A;  3KCG L;  1K37 A;  1UZQ A;  1V1I A;  1HCG B;  3UBA A;  2P93 L;  1V3X B;  4RRZ A;  2XC0 L;  3CA7 A;  3LTG D;  4XLW A;  4ZXX L;  1F7E A;  4G1M B;  3ZYI B;  1P9J A;  4Y7A B;  1F0R B;  4ISI L;  1IQN L;  3N8X A;  3R05 A;  1C5M F;  3N8Y A;  1IGX A;  3HO5 A;  1WHF A;  2XC5 L;  1DVA L;  3I6N A;  1UZK A;  4O1Z A;  3FBY A;  3PY4 A;  5IKR A;  3FFG L;  1G1R A;  1YO8 A;  1G1S A;  2BMG A;  1YGC L;  3NTB A;  2BO2 A;  2Y7Z B;  4HHR A;  1CXP C;  1M1X B;  5EGM B;  2VWN L;  2JJL A;  4E1G A;  2HOR A;  2W2O E;  3RR3 A;  4MMZ B;  2P3U A;  1IP0 A;  1Z6E L;  2BOX A;  2VVC K;  5JBA E;  4Z0L A;  1KLJ L;  2Y80 B;  1HRF A;  1NZI A;  1HT5 A;  2MGR A;  4KVL A;  3K9X A;  1KKE A;  4D0F A;  4GU3 A;  2BQ6 A;  2EFB A;  3SW2 A;  2P94 L;  3ZS1 C;  5JVY A;  3IIT B;  1LMM A;  1PTH A;  1MOX C;  2RA0 L;  2UWP B;  2ADX A;  2OJV A;  2J34 B;  5B72 A;  3HO4 A;  1QFK L;  1B9W A;  5L2Z L;  2FLG A;  3Q9K A; 
#chains in the Genus database with same CATH homology
 2RHP A;  5IKV A;  2G00 L;  3POY A;  2PT3 A;  4X8S L;  2I9A A;  1IQJ L;  2D1J B;  1IQM L;  3R5Q A;  2YGP A;  3SXV A;  1G2L B;  2W2Q E;  2WPM E;  2WPL E;  3QL6 A;  1HAF A;  3LN1 A;  3HPT A;  3GIS X;  5JB8 E;  3BT2 A;  2FZZ L;  5GH0 A;  1EPG A;  2WYJ B;  1JV2 B;  1URK A;  2WFT A;  2FD6 A;  4NJB A;  3TK5 B;  4NA9 L;  2FLR L;  2BOU A;  1IQI L;  3TBD A;  2Q1J B;  1SZB A;  1PXX A;  1DNW C;  4LOR A;  2P3T A;  1PGE A;  1APQ A;  2UWO B;  2W3K B;  3KQE L;  1L5G B;  1N1I A;  1A3P A;  2VWO L;  4Z0K B;  1FJS L;  4OEK A;  4ZH8 B;  5CKN A;  4RRY A;  4IG5 A;  1EQH A;  5F1A A;  4BTT A;  2P95 L;  1K36 A;  4ZHA B;  2GD4 A;  2BQW A;  1YUG A;  2W3I B;  1FE2 A;  2WFX B;  1MYP C;  1LPZ A;  2PR3 B;  3KQD L;  1CCV A;  1ATB A;  2EI8 B;  1UZP A;  2K2S B;  2XBW L;  2WYG B;  4M11 A;  2IKC A;  2VVU L;  3U73 A;  4XBM A;  3ELA L;  1DX5 I;  1W8B L;  2RNL A;  4X8U L;  3NT1 A;  1D7W C;  1NFY B;  2J2U B;  3DEM A;  4Y79 B;  3FAQ A;  1IVO C;  4CUF A;  3N8F A;  4Y55 A;  2VH6 B;  5HPW A;  1F7M A;  2XBY L;  3OLU A;  2MHP A;  2H9E L;  4D0E A;  3V65 B;  4Y76 B;  3LN0 A;  6COX A;  3TGF A;  2AYL A;  2XBV L;  2EI6 B;  2WZP P;  3LC3 B;  1NFX B;  2Y5F L;  2PUM A;  5CKM A;  1COU A;  3V6Q A;  3Q3K B;  1MHL C;  3R4X A;  1KIG L;  1O5D L;  1MQ5 L;  3HO3 A;  3OLT A;  3N8Y B;  1Z6C A;  1U8C B;  2Y5H L;  1TLE A;  2OYU P;  4BTI A;  1FSB A;  2WG3 C;  5JVZ A;  3RKE A;  3LC5 B;  4RRW A;  3ZYG A;  3N8W B;  3QCW A;  4CSY A;  3GCJ A;  3GCL A;  1NT0 A;  2EI7 B;  4YZU B;  1NFW B;  4BXW A;  1W7X L;  4JYV L;  4XL1 A;  1LQD A;  2Z5Z A;  4OTY A;  4BTU A;  1I0U A;  1IJQ A;  4X8T L;  3S4F A;  1EZQ B;  1NQL B;  3KQB L;  5JBB E;  5IKT A;  1LPG A;  1OB1 C;  4BXS A;  2QRB A;  1DIY A;  1AUT L;  1ADX A;  2YGQ A;  3KL6 B;  2J4I B;  1XKB A;  4HHS A;  2H9E C;  1MQ6 L;  3GCK A;  2F9B L;  1HJ7 A;  2W2M E;  3BXI A;  5L30 L;  3TZI A;  4O02 B;  4C16 A;  2GJM A;  3TK6 B;  5E8D A;  3M37 L;  2KL7 A;  1G1Q A;  1Q4G A;  3SOQ A;  2VWM K;  3BPS E;  2PUQ L;  2WPK E;  1IOX A;  2P3F L;  2PHB B;  1IQG L;  2W2N E;  2E9E A;  4MMY B;  3P5B L;  3F9P C;  4A7I A;  3GCW E;  3HS5 A;  5FIW C;  2DDU A;  3MQE A;  1J9C L;  3LTF B;  2I9B A;  3HS7 A;  2WPI E;  2VVV L;  3HS6 A;  1XDT R;  1DQB A;  2QQT A;  3KK6 A;  4Y7B B;  3FNL A;  3R55 A;  3ASI A;  1HX2 A;  1IQK L;  1PFX L;  4Y6D B;  4N7A A;  3ENS A;  4D90 A;  2NPR A;  3CS7 L;  4CUE A;  2P26 A;  3GC1 A;  5CIS A;  3KRK A;  3SOB B;  3N8W A;  2WG4 B;  1EQG A;  5COX A;  2W26 B;  4KSZ A;  4MMX B;  1JBU L;  2XC4 L;  3LIW B;  1IQL L;  4YT7 L;  2IPS A;  2J38 B;  3GCX E;  1APO A;  5KIR A;  1EPI A;  3BT1 A;  3CFW A;  4Y71 B;  4ISH L;  5JBC E;  3F6U L;  2W86 A;  4ZXY L;  1UZJ A;  3H5C B;  1D5L C;  1IQH L;  1FF7 A;  4QYQ A;  2Y5G L;  2QPK A;  4LMF A;  1PRH A;  2B7D L;  1DNU C;  4BDX A;  4CUD A;  1CX2 A;  4RRX A;  1X7A L;  1TPG A;  3N8V A;  1HRE A;  1CVW L;  1F0S B;  4RS0 A;  1EBV A;  1EPH A;  2J95 B;  1ATA A;  4X8V L;  2O86 A;  3MDL A;  2KNI A;  5CKQ A;  2FLB L;  1XKA L;  3F1S B;  3ERH A;  4KVK A;  3CEN L;  1LMJ A;  2CJI B;  3IJE B;  4JZD L;  4GM7 A;  3M36 L;  2XBX L;  1IQE L;  1ATD A;  1FAX L;  5K0H B;  2TGF A;  2BZ6 L;  2R5L A;  4NG9 L;  2MGP A;  1ZAQ A;  2VH0 B;  4JZF L;  4LJJ A;  2NQX A;  1XFE A;  2P3F N;  5KN5 C;  1EPJ A;  1WHE A;  4C1M C;  3ZS0 C;  4KVJ A;  3R5O A;  3N8Z A;  1YUF A;  1HAE A;  4MSF A;  2VWL L;  4NT3 A;  2Y38 A;  1D2V C;  3QF1 A;  1G1T A;  1CVU A;  4A94 C;  1NPE B;  2WPJ E;  3KQC L;  4AQT A;  4DL1 C;  3U7U G;  2P16 L;  1TOZ A;  2JKH L;  1NFU B;  3S6X A;  3ZYJ B;  1P0S L;  1N7D A;  1HT8 A;  3NJP C;  2WPH E;  1EAI C;  4NGA L;  4M10 A;  4RUT A;  5GLS A;  2VJ3 A;  1IOE L;  1CCF A;  3NAK A;  1ATE A;  4TGF A;  1IQF L;  5JW1 A;  3FCS B;  4FM5 A;  2BQ7 A;  1WU1 B;  1DDX A;  4QJQ A;  2P28 B;  3PGH A;  2BOK L;  2J94 B;  1RFN B;  4ZAE B;  4Z6A L;  1JL9 A;  1CEJ A;  3EGF A;  4GN6 A;  4BDW A;  2Y81 B;  3Q7D A;  4YT6 L;  3KRQ A;  2BOH A;  4JZE L;  2UWL B;  1G2M B;  4OTJ A;  1L3Y A;  3TGY A;  5FF1 A;  2M74 A;  3NYH A;  2OYE P;  4PH9 A;  1EGF A;  1FFM A;  1GK5 A;  4COX A;  2KB9 A;  2Y7X B;  2W2P E;  2KV4 A;  2YGO A;  4JYU L;  3QH0 A;  1KSN B;  5FDQ A;  1FAK L;  1IGZ A;  1EMO A;  5F19 A;  3TH3 L;  5IKQ A;  3NTG A;  3LAQ A;  3SOV A;  1U67 A;  3NIU A;  1EMN A;  1HZ8 A;  3ERI A;  3V64 C;  4PNX A;  2EHA A;  3C9A C;  5I46 L;  2Y82 B;  1YUK B;  5JB9 E;  3OGW A;  1LPK A;  2K2T A;  1KLI L;  1CQE A;  1KLO A;  5L2Y L;  1BF9 A;  3QMO A;  3KCG L;  1K37 A;  1UZQ A;  1HCG B;  3UBA A;  2P93 L;  1V3X B;  4RRZ A;  2XC0 L;  3CA7 A;  3LTG D;  4XLW A;  4ZXX L;  1F7E A;  4G1M B;  3ZYI B;  1P9J A;  4Y7A B;  1F0R B;  4ISI L;  1IQN L;  3N8X A;  3R05 A;  1C5M F;  3N8Y A;  1IGX A;  3HO5 A;  1WHF A;  2XC5 L;  1DVA L;  3I6N A;  1UZK A;  4O1Z A;  3FBY A;  3PY4 A;  5IKR A;  3FFG L;  1G1R A;  1YO8 A;  1G1S A;  2BMG A;  1YGC L;  3NTB A;  2BO2 A;  2Y7Z B;  4HHR A;  1CXP C;  1M1X B;  5EGM B;  2VWN L;  4E1G A;  2W2O E;  3RR3 A;  4MMZ B;  2P3U A;  1IP0 A;  1Z6E L;  2BOX A;  2VVC K;  5JBA E;  4Z0L A;  1KLJ L;  2Y80 B;  1HRF A;  1NZI A;  1HT5 A;  2MGR A;  4KVL A;  3K9X A;  4D0F A;  2BQ6 A;  2EFB A;  3SW2 A;  2P94 L;  3ZS1 C;  5JVY A;  3IIT B;  1LMM A;  1PTH A;  1MOX C;  2RA0 L;  2UWP B;  2ADX A;  2OJV A;  2J34 B;  5B72 A;  3HO4 A;  1QFK L;  1B9W A;  5L2Z L;  2FLG A;  3Q9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...