1IHVA

Solution structure of the dna binding domain of hiv-1 integrase, nmr, minimized average structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
52
structure length
52
Chain Sequence
MIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the DNA binding domain of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna binding protein
total genus 5
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1ihvA00
1EX4A 1IHVA 1QMCA 4FW2A 1C6VX 5D7UA 1IHWA 1C0MA 1C1AA 4FW1A
chains in the Genus database with same CATH superfamily
1YJWA 4PJJA 4M77E 4RTUA 4VUBA 4C92G 2L8DA 2KXDA 5KYNA 4J9HA 4UC4A 5CO7A 5GANe 2EW3A 2VWFA 1VQKT 2GTOA 5LJ5f 3X20B 3M56A 1NM7A 1YITA 2YUOA 1NYGA 2CP3A 3OBYA 3A8OB 4BI3A 1EZZB 3CC4A 2QQ9A 2D8JA 5IXFA 5J39A 2I0NA 1MNEA 1N9RA 4L6V5 3M0PA 4FW2A 2EYWA 2E5QA 2DL7A 4N4GA 5EG2A 2D0QB 4C0ZA 1WHKA 3JSCA 1D0XA 1JXMA 3JAME 2LRQA 5LJ3g 3L2WA 1UE9A 2DD4A 4BE2A 2J06A 1K8AU 3DB3A 5GMKm 2ZGWA 2X3XD 3QG1A 4PLLA 4Z88A 3M53A 1AEYA 5I2SA 2I2LA 1UG1A 4B6MA 5GANj 2VC8A 4M7DE 2LNVA 2PQWA 4NS5A 2MI6A 3GLXA 4CRIA 1CKBA 2A3LA 2CP0A 3M0TA 4MDWA 3OBWA 1KIKA 4HCKA 1E7OA 4J9FA 3LYIA 3CCMQ 3QIIA 1F1BB 2MIOA 1ZHIA 4C5EA 3V7RA 1T0HA 2RH2A 3E9FA 5CIUA 2QASA 3OS5A 1FMVA 1RLQC 1B34B 1KC8C 2FYKA 4XTYA 5A0GA 4JLIA 3BDUA 1NPPA 3OYHA 1UJYA 2LVMA 1WJQA 4KRTA 1TWBA 2M51A 3JCMJ 2V1RA 4EMKC 3GIBA 2CKKA 3CCRQ 4FIBA 5ECAA 2FRWA 4MMLA 3OYGA 4KH0B 4LNPA 3OYIA 2ZPBB 3QYHB 3CCVA 3E2UA 1D09B 2LQWA 1AHJB 3L2VA 1I5LA 4CC4B 1YN8A 1QQJA 2KAFA 3EG2A 4ESRA 1OYXA 3CMAT 5LJ3e 5GAN2 3CCJT 1WYXA 3CCSQ 4PFOA 1YIJA 2HCKA 2CH4W 4M75B 2MPXC 1IB8A 4E7JA 3CBMA 3TQ7P 3CCLT 2E4HA 1M8VA 2QQSA 2M0OA 4NL2A 2KRSA 2X4WA 3CMAA 1YJNQ 3JB9J 4BACA 3QZ9B 2EAYA 3E9GA 1S72T 3L2ZA 2LT1A 5CQXA 2K4YA 4AFQC 5GAMh 4V2SA 1PD1A 4J9BA 3JB9D 3S3OA 2EQKA 2L2PA 3T9NA 3R6OA 3OS1A 3J7AF 4M7AD 2E12A 1S72A 2O31A 3V8KA 2VVKA 2RA2A 2FPDA 1ZSGA 1WHJA 4OMNA 3PIOA 5LJ3j 4M77A 1VQOT 4M7AC 4OB0B 1VYTA 1PHTA 1X6BA 1U3OA 1KQSA 2KROA 1B07A 4HVWA 7AT1B 3L2RA 1VQ8Q 1PM3A 2YWWA 2RJCA 2LX9A 1PWTA 3BE3A 3CCET 3AT1B 2VYTA 1VQOA 2RJFA 1ACMB 1PNJA 4D8DA 5AYFA 1YP5A 1MV0B 1K73C 1VA7A 1PG5B 4C92B 4C8QD 4BI8B 5DY9A 4OF1A 3EHRA 3UDCA 4B9WA 1IREB 3OYYA 1RAIB 2BZXA 2YUQA 5D6WA 2LJ1A 4CC3A 3VS0A 1MNDA 2BKDN 2MAMA 3FRNA 4Z8AA 3MPUB 3C95A 3N5BB 4XU3A 4EPCA 3M58A 4PNOA 4FW1A 1B7TA 2FEIA 1OU9A 4FSXA 1QVFA 1OPKA 2V8IA 3EFOB 3EGXA 5CKEA 1N9SA 3PTAA 4KUDK 4M78A 2F2XA 2E6NA 2GBQA 2C0IA 2PZ1A 4M7DA 4RTWA 1TXQA 1ZX6A 2QQBA 1M2VA 4C0DC 2E41A 1VQNA 2DXTA 2AKKA 3OYNA 2K7AA 3X24B 2K5LA 2EGAA 1EIFA 3EGDA 1UGRB 1OI1A 3ZEHA 4XTWA 4A4EA 4J83A 3RBBB 2HL5C 1KSWA 5IT9E 4ZGEB 2NUZA 3A8HB 3CBPA 2BIVA 3EG9B 2EQMA 2O9VA 4XTUA 3RNJA 4RCCA 5FU7C 2RQTA 5FRMA 2RQUA 1IHVA 1AVZC 1D1AA 4P5NA 3LWIA 1Y57A 2CP6A 2NUTA 4BI4A 4BE0A 5I22A 1SF9A 3EFSA 5HCKA 2XD0A 1NEGA 5GAOl 3OW2A 2JVVA 3G71A 3ME9A 4PKCC 4KH1B 4J6WA 2PUOB 3CPWA 3E19A 1BI3A 3DKMA 3I56T 3QWXX 4C8QE 3CPWS 1M3BA 2EBPA 1VQ6A 4RG8A 4KUIA 2QA4A 1N5ZA 2LCCA 2LNHB 1K9MR 4FM4B 4LDXA 2X35A 3EH2A 1QKWA 1WQWA 2BE7D 1QCFA 2ZPIB 3BW1A 3I35A 1M3AA 2RB6A 3G4ST 3GP8A 3RKWA 4RTYA 3V7SA 1AWJA 2YRVA 2DXCA 5CKDA 4XTZA 1TUGB 3GBQA 5I2MA 2DVEA 2RPNA 1HJDA 2A37A 1JQQA 4A4HA 1BKBA 2ZPFB 2OAWA 2VGMA 3G6EQ 2DPPB 3H8ZA 3SB2A 1MV3A 2AK5A 1VQ7Q 3DB4A 1PKSA 1QVGS 1VQMT 1Q86C 4BE1A 1H3HA 2XHCA 2FHDA 4F14A 1SG5A 2BTTA 1G83A 5I11A 3G7ZA 3QWYA 1VQMA 2F2VA 1T3SA 4RTZA 1JBMA 2EJFA 2OJ2A 1IRXA 1M3CA 2HSEB 1KD1U 1M90U 1R77A 4WF2A 2LC4A 2K9GA 1IO6A 3P8BB 3D7SB 4F7UE 2DMOA 4AG2C 1YNZA 3ZBDA 4QQ6A 2RMOA 4N4HA 4HCBA 2C0OA 1NYFA 4E7KA 2JM8A 1RADB 3HRSA 2ENMA 2QTVA 1VQPT 5GANd 4Z89A 1RAFB 4OMMA 1MMAA 4JRPA 1JO8A 4PJOC 3J81E 2WSFE 3PE0A 1HSQA 3CC2T 2ZPGB 1ARKA 3UATA 3QJ6A 1ABQA 3V8LA 3NGPA 1K0SA 2F69A 1VQLA 3UT1A 3MKDA 3RR6A 5J3BA 3X25B 4J9GA 2KGTA 4BDZA 3CC2A 4HVUA 2QG9B 2YLCA 1JJ2A 1GBQA 1YCSB 2DRMA 1OPLA 3TSWA 1ZSZA 2JMAA 5GMKj 4JS4A 3TEEA 4M77C 4RKUE 4M7AA 2KRMA 1M1GA 1TSFA 2X4YA 3CD6T 4M75D 5DM7R 3OSSC 2EQUA 3OYAA 4OB2B 3I55Q 1EX4A 2CP5A 5KCOA 2VXEA 1UHCA 1WJRA 3INZA 4CC7A 2RI2A 3H9NA 3JCMh 4M77G 2DXBA 4DBQA 5GMKi 3ASKA 3O8VA 3CD6A 3MHXA 1PRLC 4ZN1A 4XU1A 1UB4A 2P0QA 2R5AA 3Q1JA 3M55A 4BD3A 5FLXE 1M30A 1YJ9T 2DVJA 1MMGA 1Q7YC 1IHWA 1IGQA 2WSCE 1IGUA 3QXEB 3PVQA 4LXCA 1C0MA 2OI3A 3U23A 1O75A 1NG2A 1G2BA 2DD5A 3JCMX 5FRNA 1D3BB 3TCJA 3S3NA 2OTLT 2MF2A 2W10A 4FU6A 4OMLA 1IZ6A 4M7DC 2ECZA 2JTEA 2XMFA 4D6WA 3MEVA 2QDLA 3M4YA 1X2KA 3OQ5A 2PVOB 2HQEA 3CCQQ 2OTLA 4EIKA 1WA7A 3M0UA 2A08A 2CZ7B 4C92D 3GF5A 1WDXA 3VS5A 2DETA 3LW5E 4J7IA 3VS3A 3OYDA 1XTDA 4M78G 4M7DG 1Q82R 4B9XA 1YITT 3HRTA 1XOVA 2EKOA 1M1KC 2KR3A 2KI7A 5GAMe 2MWPA 5FROA 3NMZC 5CKHA 4Z02A 2QDYB 5KCHA 2K3YA 1ABOA 2HZYA 3CC4T 2DBKA 1YI2Q 4RG2A 4L5GA 3CC7Q 2ZZDA 1SRMA 4AFSC 1CSKA 1NLPC 4TVRA 4M75E 4PJNA 5IHIA 4E47A 3KBGA 5KYYB 2ZPEB 1JEGA 3SHWA 2FZCB 5GAN7 1K9AA 3H41A 4FYYB 3SDZA 2RQWA 3DLLA 3A8LB 4F7UA 1RABB 3LGFA 3CCMA 2FO0A 4RCBA 3OMGA 2H3EB 4XQ3A 3ZFJA 3TVTA 1VQ9Q 2ZAEA 4X9DA 1I5OB 1R0CB 5GAMj 1E6HA 1K8AC 3OY9A 5EC7A 3CQTA 4FYWB 3M57A 2EJ9A 2AHJB 1YJWQ 1H92A 3L42A 3GPLA 2DX1A 2DBMA 2EKHA 2RI5A 2RK1A 2X4XA 1UEBA 1NEBA 1WHMA 4PK4A 2M02A 2PUKB 3GNFB 2XDBA 4C92E 3CCSA 4C0FA 1VQKQ 2OTJQ 4LD9K 4O5VA 4GBQA 2ROLA 5IH2A 2DTIA 2DEQA 3RKXA 1YCYA 3LLRA 5LJ5h 2YRCA 5GANf 3CCVT 3PMTA 1YJNA 4JRQA 3VRYA 5FWBA 2EJGA 2QQRA 2QXFA 1T3LA 2AT1B 3VS4A 5C0MA 2XK0A 1MUZA 2XI9A 4ELZC 2DZCA 5KYUB 1NJIU 3UPUA 1TOVA 2JOYA 1YIJT 4PLIA 4AFZC 2M16A 1R8OB 1ZUYA 1UDLA 2HNIA 3OS2A 1I07A 1HK9A 1M5Q1 5KYXA 3S6WA 2ROTA 3VS7A 1VYVA 3L2UA 2D6FA 4X1VA 2DILA 4A63B 1W2BA 1D0ZA 4N0AC 4FL6A 4PJOA 1J3TA 4KGZB 5IXBA 2HDAA 4JJBA 3EG1A 1TUDA 2JN0A 1AZGB 1M9SA 2ZCFB 1B34A 3ZL7C 2JW4A 2X4JA 1TU0B 1I1JA 2EYQA 3RERA 2V8JA 4R0KA 5DLOA 1HD3A 3JV3A 1KHCA 4QT7A 1KG1A 4C0GA 1Q95G 1D0YA 2KYBA 2DYIA 1M27C 2HQXA 4KGXB 4XU2A 3WVDB 2J6KA 3PIPA 3CXCA 1IXDA 1KQ2A 3CPWP 3M54A 3CXCS 2NWMA 1ZSZC 2BE9B 4ANJA 4BY6C 1U8RA 2NYSA 4M7AF 2CT4A 2IG0A 1MGQA 1K9MU 3VU3C 3SWNC 1KQSS 1QKXA 2XG8D 1W70A 4A53A 3EGXB 3JB9G 2DXUA 2FVUA 2GCXA 3VKIA 4M78B 4M7AG 4HCZA 1AZEA 1PCXA 2BZ8A 3H0IA 3CMAQ 4M4ZA 3CCJQ 4DQ2A 1LOJA 4LDWA 1BI2A 2IPOB 3PVLA 2M1HA 4JUVA 5DLQE 1Y0MA 4C8QC 1BCOA 5LJ3f 2LJ0A 3PMIA 3CCLQ 1I8FA 3H6ZA 1KHIA 1QVGP 1VQ5Q 2LCLA 1XJWB 1RAAB 1V29B 1K0XA 1VQNT 2JNGA 4IKFA 2DJQA 3F70A 1S72Q 1AWWA 1LJOA 2LQKA 3HPWA 1OX8A 1RAHB 1KC8R 2VKNA 3I5SA 2DK3A 1QVFS 3FDRA 3VRZA 1NJIR 4J6YA 2NUTB 5KYWA 1AD5A 1RAEB 2R57A 1B3QA 3KXTA 4DBRA 1YHQQ 1M1FA 4R55A 2CZ0B 3I9QA 4XAXB 1Q81C 1YWPA 1VQOQ 1D1BA 2QAZA 3WVEB 4KGVB 2EPDA 1NPRA 1VUBA 1G3SA 2YRDA 3EAEA 4OMOA 4C92A 1JU5C 4C5HA 4HA8A 3CCEQ 3JCMP 4Y28E 4E7HA 3UF4A 3M0RA 4DEXA 4AG1C 2KT1A 3M4GA 3LX7A 3ULRB 2MK5A 3GNGA 1VQ4T 3G71T 4FT4A 3META 3VUBA 2EQIA 5FU6C 1JRIA 2RQVA 3C4SA 3JCMc 4RMOA 2KE9A 1QWEA 2RHZA 2D8HA 2LP5A 2K5IA 4QQGA 2AIRB 1VQ6T 2GQVA 2WSEE 1VQ4A 4EMGA 4QKUA 3EFOA 2QA4T 2F1LA 1ZA1B 2YSQA 3OYLA 2O4XB 4J9DA 3OW2S 1ZLMA 2MCNA 1RI9A 5IHKA 5LJ3h 2V8KA 4DOWA 4PFZA 1RLPC 1BIAA 1CKAA 1GFCA 1P92A 3MP6A 4XTXA 3NFCA 4L59A 4A54A 2O2OA 3JCMe 2DEUA 3AHUA 4IUTA 2RN8A 1UECA 1VQ7A 2QQAA 3QYGB 3DLMA 2CSIA 3CCUQ 3H0HA 1WXUA 3BY7A 4IIMA 1RACB 4F7UG 3MJXA 2L3QA 3EG9A 3FC3A 4FYXB 3H0FA 4GY5A 3OSVA 1TH7A 5CR2A 1V76A 1UUEA 2NUPA 2JS0A 4EMKB 2F5KA 2K3BA 5HK0A 1RI0A 1MMDA 3BFMA 4LDUA 1G8XA 1PKTA 2NLUA 2D9TA 4PJLA 2DLPA 4II1A 4D8KA 1K73R 2BZYA 5HKCA 2DAQA 3THKA 1XQHA 2JZ2A 4ME7A 2QYZA 2FL7A 4J6XA 4GLMA 2KK4A 2YDLA 1N8RC 1VIFA 2B8AA 2KY9A 2PU9B 4OMFB 4QW2A 3OYCA 2W0ZA 1W1FA 1MMNA 2JTFA 3QJYA 3FB9A 4FCYA 4OMQA 1ZBJA 2JTMA 2E64A 1WQ7A 2E1HA 2PVDB 2VV5A 1BU1A 3I56Q 1KD1C 1M90C 5L8RE 3VS2A 3M9QA 3KUFA 3JCMW 1G3WA 2KT8A 1BK2A 2J05A 3SD4A 3FLGA 2YT6A 3G1JA 3BDLA 3I55T 1UFFA 4DBHA 2FPFA 1WLPB 4LDYA 5GAMd 1Q82U 3JB9H 5GAOm 4M7AB 2GFUA 1AT1B 1OULA 1WXBA 3HTRA 3S3MA 1RL2A 4N0AA 3OS0A 3G4SQ 3CMET 1TS9A 1VQLT 1FXXA 1WX6A 3PNWC 1DJ7B 1FYNA 3I55A 4PJOF 2FRYA 5D6YA 3RKYA 1Y96B 2BUDA 4JLGA 5CVIA 3CMEA 2LQNA 2SRCA 2K57A 1WNLA 2XKOC 4LE9A 2RHUA 4PJOG 2CUDA 1FMWA 4AMCA 1WFWA 1VQMQ 1D1CA 1QWFA 2VB6A 2K79A 2VXFA 3C12A 1JJ2S 2A28A 2GNCA 2EVRA 2EGCA 5GAMg 4ZTJA 4ZTFA 1PSEA 1W4SA 4M77F 3JB9I 4HT9A 2YXYA 3SWNA 1U06A 3RIRA 2A0FB 1Z9ZA 3EG0A 4M75C 2C0TA 4C0DB 2H8HA 5GAN6 2QEXQ 3RMQA 2H3JA 4K11A 2QTXA 1Y7XA 3NPFA 4MDXA 1TG0A 5LJ5e 2DJZA 1W6XA 4ZNXA 2GTJA 1VIEA 1KJWA 1U1SA 4DA4A 4C8QA 1HXDA 2ATCB 4RTTA 2KQWA 1VQPQ 1OOTA 4MZTA 3TREA 4E7LA 2FZGB 5GMKl 3L2QA 2HSPA 5FU7B 3QHSA 3TSZA 1KFZA 3CC2Q 2HKNA 3MEAA 2VASA 2E3IA 2EQJA 1RAGB 4F04B 1Q86R 1N27A 3VV0A 1MHNA 1TTHB 1WPYA 1R0BG 3OYKA 2O01E 5L23A 4M78F 3V7CA 4M7DF 3HP9A 3SFMA 8ATCB 3HFOA 4AFUC 1AWXA 1FWZA 5KH6A 4GLKA 3M0QA 4ZGJB 4QVZA 2GFAA 1KK7A 4NOYA 5LJ5j 1EFNA 3A1PA 1JXOA 2CZ6B 3KFVA 5HK3A 3NHNA 4OP0A 4IURA 5A0LA 2RJEA 2AZVA 2XDPA 4C92C 1VQ9A 1SHFA 2HEQA 3X28B 5KE3A 2KRNA 3I5RA 1X75C 2HD0A 2DIGA 3C0CA 3L1AA 1I81A 1UGQB 2L89A 4LUDA 1Y71A 4IIOA 3MP1A 2DF6A 3NTKA 1OV3A 2O88A 3CCMT 1KQ1A 2COYA 2P84A 1A0NB 1BI0A 1K76A 3QBYA 1WI7A 1YJ9Q 2E6ZA 2MYSA 1D3BA 2CS7A 2OTJT 2YLBA 1BIBA 1T0JA 1X2QA 5CK9A 5GMKh 4PFPA 3CXCP 2G6FX 2E5KA 3VUZA 1HYOA 2COZA 2HAXA 1Z9QA 5A2QE 4MZMA 2CT3A 2RHXA 1VQKA 3VYHB 2OTJA 2OTLQ 2LJ3A 3CCRT 1KQSP 4ELYC 4J9IA 2KMTA 2CP7A 1XNIA 1PRMC 2ED0A 2PVGB 1WHLA 2CUBA 2JM9A 2RJDA 1QCNA 2QI2A 2X3WD 2X51A 4E7IA 2FPEA 3CCRA 2EYXA 4JRIA 3CCST 3REAB 2M9UA 2F2WA 2HBPA 4WTOB 1YITQ 3VS6A 3FJPA 3EH1A 1RUWA 1QW1A 2VGNA 2JMCA 2DRKA 3FEOA 4M78E 3EGUA 1YJNT 3CC4Q 5KYXB 5KYYA 2Y4YA 2YHTA 3MEWA 1X27A 2DERA 1ZUKA 5GAMf 3P8HA 4JZ3A 4A4FA 1Q7YR 1TUCA 2R58A 2YUNA 2XICA 2DE0X 1JB0E 2JJ9A 1QVFP 1G5VA 1QLYA 1QMCA 2FZKB 4PJOB 1KC8U 2RHYA 1OQKA 1M4ZA 1UJ0A 3URGA 2IVWA 3TU4K 3OMCA 3RDVA 4JJCA 4QQDA 1LPLA 1GL5A 2LDMA 1NJIC 4CI0C 2MMPA 3M0SA 2GF7A 3OYJA 2Y90A 4OGCA 1VQ8T 2CSQA 2RO0A 2DNUA 4Y92A 5GAOr 3HSBA 1OEBA 1YFNA 3JRZA 4X9CA 2KXCA 2K2VA 2LQ8A 4M77B 5GAN5 2DL5A 4ZGDB 1VQ8A 2P4RA 2XDDA 1M1KR 2O9SA 1W2BS 3P8DA 3QKJA 3MP8A 1GCQA 4FSSA 2F5TX 2G3RA 3M59A 3UWNA 3C94A 2HBWA 3OW2P 1VQ5T 2CH4A 2LTOA 2D0NA 2QK0A 2ABLA 3CCJA 3RESA 1SRLA 1I0CA 4OMPA 3MO8A 1GXIE 5KYUA 4HT8A 5D6XA 2LZ6B 3CCLA 4ORZA 3JCMd 3JB9F 2P4TA 3CCVQ 2L3RA 2QGGA 2JS2A 4F17A 1VQ5A 1WIEA 2WACA 1LCKA 5GANh 3OYBA 4Y91A 1NBEB 1ZQ1A 4JJNK 1YHQT 3EHQA 5GJVB 1OZ2A 2HMAA 1K9MC 5GAN3 2K3XA 1H8KA 1YIJQ 1K8AR 4M75A 3HKSA 4KT0E 4M7DB 2EWNA 4MZPA 1M2VB 5KYWB 1SPKA 2ESWA 1BBZA 3HRUA 1YHQA 2KDSA 1NE8A 2CZ1B 2J7IA 2KSSA 3EGDB 2FB7A 3PFSA 3QO3A 4QVDA 1X43A 3NTHA 4LDVA 1UGVA 1YWOA 1K73U 1LNXA 3QUIA 3JCMg 4C8QF 2V1QA 3GOXA 1UTIA 4AT1B 2L3SA 3CCEA 1QP2A 4J8OA 4LUEA 3OYMA 4R56A 2L5QA 4BDYA 4C8QG 3A98A 1QVPA 1NZ9A 3J80E 9ATCB 2L3PA 1VYUA 2K5FA 4EMHA 2DIQA 4E6RA 4OB3B 3FIFA 2LCSA 3HL8A 2LX7A 2DL3A 4N4IA 3CCUT 1SHGA 5CQYA 2LMJA 2AZSA 2DZ9A 4XK8E 4JDSA 1Q81U 2P0KA 3CBOA 2DA9A 2XU8A 3CCUA 4OVAA 1BI1A 3LGLA 4XU0A 3JCMV 2J6OA 1FMKA 3IQLA 5IAYA 4RTVA 2V26A 1QCOA 5GAOn 4M7AE 1QP3A 2IIMA 2NUPB 3MCAB 3G6ET 2VUBA 4MMKA 5CKFA 1VQ7T 1LVKA 2JXBA 4KBMB 4HKEA 1WJSA 1FX7A 1S1NA 2HQHA 2EYYA 5FWCA 1X01A 5I21A 2RK2A 5C6SA 2A36A 4F7UF 2RHIA 1JJ2P 1AOJA 1VQNQ 3G6EA 1GRIA 2DM1A 5IHNA 3CEYA 2E70A 2DTHA 2EGEA 3VJPA 2Y4XA 2CP2A 4PL6A 1O9SA 1GFDA 5D7UA 3JCMb 2A7YA 2JT4A 4NL3A 4WCIA 4E7SA 2OX7A 1UGSB 1WGSA 4IUVA 3I56A 1PSFA 5LJ5d 3EG3A 4LD6A 3UA6A 4C5IA 2D1XA 1VOMA 5GAOq 3PGGA 3ER0A 3QDFA 1VQ4Q 3REBB 3G71Q 5A0DA 3A8MB 2E10A 2DO3A 2O4XA 3HHTB 4JJDA 4E7ZA 4OB1B 5CCAA 3SEMA 5HY6A 2KYMA 3G4SA 2QGFB 4A4GA 4IUUA 4EDUA 1QVGA 4RTXA 2E65A 1VQ6Q 1K4US 2MWOA 3OB9A 1Q86U 2SEMA 2QA4Q 4J5YA 4BB7A 1UGPB 5GJWB 1YBYA 1H3ZA 3A5ZB 1NLOC 4J9EA 5IN1A 1C6VX 1N8RU 5LJ5g 2RF0A 3EFRA 1OU8A 1PD0A 1C1AA 2FG0A 2XIDA 2DL8A 4IUPA 5LL6S 1X6OA 4EMKA 3FJ5A 3VS1A 4J9CA 4JZ4A 1Q81R 3NTIA 3O5ZA 1G3TA 1ZSZB 3LH0A 3JCMf 1BB9A 1GCPA 4A4KA 4JPBW 4BY6B 1Q82C 2HL3A 4F16A 3MEUA 2LT4A 2M0YA 1M8MA 4IUQA 2QEXT 2KNBB 8AT1B 3RMSA 5GMKe 3SWNB 4OGEA 4C5GA 4PJMA 2EFIA 1PC0A 1GCQC 4X34A 3A8GB 1WXTA 6AT1B 4DOVA 2B86A 2PTKA 2CYZB 4PJOD 2EYZA 4FYVB 2GQIA 3QPHA 1SSHA 1X6GA 5KE2A 2R5MA 2QEXA 2KVQG 1WZOA 2AKLA 1N6AA 1AWOA 3PT9A 4Q5WA 4C8QB 3LH5A 1WHGA 4RUGA 3LWHA 3VYGA 4ZN3A 1VQPA 5M9OA 4BUGA 3M5AA 5CKBA 1K1ZA 2DKGA 5FW9A 4JS5A 4KULA 5AT1B 4M77D 1OZ3A 1ZUUA 3R6NA 5GAN4 5GAN8 2KEAA 3CCQT 1V1CA 4JRKA 3QSUA 2PNIA 1G3YA 3JCMQ 4HVVA 2RM4A 4M75F 1SEMA 1UHFA 3RUXA 1WHHA 2JUFA 2DL4A 2RNAA 5GANg 2COWA 3WXMB 3CCQA 2DTOA 2YUPA 2J6FA 3QZ5B 4E2FB 2OAUA 1U1TA 2K2MA 1YI2T 1U5SA 3CC7T 3E1SA 4M75G 1Y96A 2P0PA 4FT2A 2MOXA 2Z0WA 2KBTA 3CMEQ 4ATOA 4YTLA 2DFUA 3OYFA 1VQLQ 1SSFA 3OYEA 3X26B 1YI2A 3CC7A 2C06A 1Q7YU 2EIFA 1OX9A 2K6DA 1SKUB 1Y07A 4XTVA 1E6GA 2CDTA 3HFNA 1ZA2B 2RQRA 3CPFA 1BCMA 3QDRB 1N8RR 5FU6B 2GGRA 3OA6A 4M78D 1VQ9T 2DYBA 4M7DD 1BYMA 4LN2A 2E3HA 1YJ9A 3UA7A 4PJOE 2RD1A 2ED1A 4J7FA 2CREA 2X9HA 1ZBXA 4F7UB 4QVCA 4M78C 2ZPHB 4DBFA 4HCCA 1KD1R 1I4K1 1M2OA 1M90R 2RI3A 3V8JA 3CD6Q 1YJWT 1GBRA 4C92F 4O6JA 2CGHA 4HXJA 1X69A 1H641 2HKQB 4CC2A 4DEYA 1W2BP 2L0AA 5GAOp 5J26A 5LJ3d 1M1KU 5CAIA
chains in the Genus database with same CATH topology
1EX4A 1IHVA 1QMCA 4FW2A 1C6VX 5D7UA 1IHWA 1C0MA 1C1AA 4FW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EX4 A;  1IHV A;  1QMC A;  4FW2 A;  1C6V X;  5D7U A;  1IHW A;  1C0M A;  1C1A A;  4FW1 A; 
#chains in the Genus database with same CATH topology
 1YJW A;  4PJJ A;  4M77 E;  4RTU A;  4VUB A;  4C92 G;  2L8D A;  2KXD A;  5KYN A;  4J9H A;  4UC4 A;  5CO7 A;  5GAN e;  2EW3 A;  2VWF A;  1VQK T;  2GTO A;  5LJ5 f;  3X20 B;  3M56 A;  1NM7 A;  1YIT A;  2YUO A;  1NYG A;  2CP3 A;  3OBY A;  3A8O B;  4BI3 A;  1EZZ B;  3CC4 A;  2QQ9 A;  2D8J A;  5IXF A;  5J39 A;  2I0N A;  1MNE A;  1N9R A;  4L6V 5;  3M0P A;  4FW2 A;  2EYW A;  2E5Q A;  2DL7 A;  4N4G A;  5EG2 A;  2D0Q B;  4C0Z A;  1WHK A;  3JSC A;  1D0X A;  1JXM A;  3JAM E;  2LRQ A;  5LJ3 g;  3L2W A;  1UE9 A;  2DD4 A;  4BE2 A;  2J06 A;  1K8A U;  3DB3 A;  5GMK m;  2ZGW A;  2X3X D;  3QG1 A;  4PLL A;  4Z88 A;  3M53 A;  1AEY A;  5I2S A;  2I2L A;  1UG1 A;  4B6M A;  5GAN j;  2VC8 A;  4M7D E;  2LNV A;  2PQW A;  4NS5 A;  2MI6 A;  3GLX A;  4CRI A;  1CKB A;  2A3L A;  2CP0 A;  3M0T A;  4MDW A;  3OBW A;  1KIK A;  4HCK A;  1E7O A;  4J9F A;  3LYI A;  3CCM Q;  3QII A;  1F1B B;  2MIO A;  1ZHI A;  4C5E A;  3V7R A;  1T0H A;  2RH2 A;  3E9F A;  5CIU A;  2QAS A;  3OS5 A;  1FMV A;  1RLQ C;  1B34 B;  1KC8 C;  2FYK A;  4XTY A;  5A0G A;  4JLI A;  3BDU A;  1NPP A;  3OYH A;  1UJY A;  2LVM A;  1WJQ A;  4KRT A;  1TWB A;  2M51 A;  3JCM J;  2V1R A;  4EMK C;  3GIB A;  2CKK A;  3CCR Q;  4FIB A;  5ECA A;  2FRW A;  4MML A;  3OYG A;  4KH0 B;  4LNP A;  3OYI A;  2ZPB B;  3QYH B;  3CCV A;  3E2U A;  1D09 B;  2LQW A;  1AHJ B;  3L2V A;  1I5L A;  4CC4 B;  1YN8 A;  1QQJ A;  2KAF A;  3EG2 A;  4ESR A;  1OYX A;  3CMA T;  5LJ3 e;  5GAN 2;  3CCJ T;  1WYX A;  3CCS Q;  4PFO A;  1YIJ A;  2HCK A;  2CH4 W;  4M75 B;  2MPX C;  1IB8 A;  4E7J A;  3CBM A;  3TQ7 P;  3CCL T;  2E4H A;  1M8V A;  2QQS A;  2M0O A;  4NL2 A;  2KRS A;  2X4W A;  3CMA A;  1YJN Q;  3JB9 J;  4BAC A;  3QZ9 B;  2EAY A;  3E9G A;  1S72 T;  3L2Z A;  2LT1 A;  5CQX A;  2K4Y A;  4AFQ C;  5GAM h;  4V2S A;  1PD1 A;  4J9B A;  3JB9 D;  3S3O A;  2EQK A;  2L2P A;  3T9N A;  3R6O A;  3OS1 A;  3J7A F;  4M7A D;  2E12 A;  1S72 A;  2O31 A;  3V8K A;  2VVK A;  2RA2 A;  2FPD A;  1ZSG A;  1WHJ A;  4OMN A;  3PIO A;  5LJ3 j;  4M77 A;  1VQO T;  4M7A C;  4OB0 B;  1VYT A;  1PHT A;  1X6B A;  1U3O A;  1KQS A;  2KRO A;  1B07 A;  4HVW A;  7AT1 B;  3L2R A;  1VQ8 Q;  1PM3 A;  2YWW A;  2RJC A;  2LX9 A;  1PWT A;  3BE3 A;  3CCE T;  3AT1 B;  2VYT A;  1VQO A;  2RJF A;  1ACM B;  1PNJ A;  4D8D A;  5AYF A;  1YP5 A;  1MV0 B;  1K73 C;  1VA7 A;  1PG5 B;  4C92 B;  4C8Q D;  4BI8 B;  5DY9 A;  4OF1 A;  3EHR A;  3UDC A;  4B9W A;  1IRE B;  3OYY A;  1RAI B;  2BZX A;  2YUQ A;  5D6W A;  2LJ1 A;  4CC3 A;  3VS0 A;  1MND A;  2BKD N;  2MAM A;  3FRN A;  4Z8A A;  3MPU B;  3C95 A;  3N5B B;  4XU3 A;  4EPC A;  3M58 A;  4PNO A;  4FW1 A;  1B7T A;  2FEI A;  1OU9 A;  4FSX A;  1QVF A;  1OPK A;  2V8I A;  3EFO B;  3EGX A;  5CKE A;  1N9S A;  3PTA A;  4KUD K;  4M78 A;  2F2X A;  2E6N A;  2GBQ A;  2C0I A;  2PZ1 A;  4M7D A;  4RTW A;  1TXQ A;  1ZX6 A;  2QQB A;  1M2V A;  4C0D C;  2E41 A;  1VQN A;  2DXT A;  2AKK A;  3OYN A;  2K7A A;  3X24 B;  2K5L A;  2EGA A;  1EIF A;  3EGD A;  1UGR B;  1OI1 A;  3ZEH A;  4XTW A;  4A4E A;  4J83 A;  3RBB B;  2HL5 C;  1KSW A;  5IT9 E;  4ZGE B;  2NUZ A;  3A8H B;  3CBP A;  2BIV A;  3EG9 B;  2EQM A;  2O9V A;  4XTU A;  3RNJ A;  4RCC A;  5FU7 C;  2RQT A;  5FRM A;  2RQU A;  1IHV A;  1AVZ C;  1D1A A;  4P5N A;  3LWI A;  1Y57 A;  2CP6 A;  2NUT A;  4BI4 A;  4BE0 A;  5I22 A;  1SF9 A;  3EFS A;  5HCK A;  2XD0 A;  1NEG A;  5GAO l;  3OW2 A;  2JVV A;  3G71 A;  3ME9 A;  4PKC C;  4KH1 B;  4J6W A;  2PUO B;  3CPW A;  3E19 A;  1BI3 A;  3DKM A;  3I56 T;  3QWX X;  4C8Q E;  3CPW S;  1M3B A;  2EBP A;  1VQ6 A;  4RG8 A;  4KUI A;  2QA4 A;  1N5Z A;  2LCC A;  2LNH B;  1K9M R;  4FM4 B;  4LDX A;  2X35 A;  3EH2 A;  1QKW A;  1WQW A;  2BE7 D;  1QCF A;  2ZPI B;  3BW1 A;  3I35 A;  1M3A A;  2RB6 A;  3G4S T;  3GP8 A;  3RKW A;  4RTY A;  3V7S A;  1AWJ A;  2YRV A;  2DXC A;  5CKD A;  4XTZ A;  1TUG B;  3GBQ A;  5I2M A;  2DVE A;  2RPN A;  1HJD A;  2A37 A;  1JQQ A;  4A4H A;  1BKB A;  2ZPF B;  2OAW A;  2VGM A;  3G6E Q;  2DPP B;  3H8Z A;  3SB2 A;  1MV3 A;  2AK5 A;  1VQ7 Q;  3DB4 A;  1PKS A;  1QVG S;  1VQM T;  1Q86 C;  4BE1 A;  1H3H A;  2XHC A;  2FHD A;  4F14 A;  1SG5 A;  2BTT A;  1G83 A;  5I11 A;  3G7Z A;  3QWY A;  1VQM A;  2F2V A;  1T3S A;  4RTZ A;  1JBM A;  2EJF A;  2OJ2 A;  1IRX A;  1M3C A;  2HSE B;  1KD1 U;  1M90 U;  1R77 A;  4WF2 A;  2LC4 A;  2K9G A;  1IO6 A;  3P8B B;  3D7S B;  4F7U E;  2DMO A;  4AG2 C;  1YNZ A;  3ZBD A;  4QQ6 A;  2RMO A;  4N4H A;  4HCB A;  2C0O A;  1NYF A;  4E7K A;  2JM8 A;  1RAD B;  3HRS A;  2ENM A;  2QTV A;  1VQP T;  5GAN d;  4Z89 A;  1RAF B;  4OMM A;  1MMA A;  4JRP A;  1JO8 A;  4PJO C;  3J81 E;  2WSF E;  3PE0 A;  1HSQ A;  3CC2 T;  2ZPG B;  1ARK A;  3UAT A;  3QJ6 A;  1ABQ A;  3V8L A;  3NGP A;  1K0S A;  2F69 A;  1VQL A;  3UT1 A;  3MKD A;  3RR6 A;  5J3B A;  3X25 B;  4J9G A;  2KGT A;  4BDZ A;  3CC2 A;  4HVU A;  2QG9 B;  2YLC A;  1JJ2 A;  1GBQ A;  1YCS B;  2DRM A;  1OPL A;  3TSW A;  1ZSZ A;  2JMA A;  5GMK j;  4JS4 A;  3TEE A;  4M77 C;  4RKU E;  4M7A A;  2KRM A;  1M1G A;  1TSF A;  2X4Y A;  3CD6 T;  4M75 D;  5DM7 R;  3OSS C;  2EQU A;  3OYA A;  4OB2 B;  3I55 Q;  1EX4 A;  2CP5 A;  5KCO A;  2VXE A;  1UHC A;  1WJR A;  3INZ A;  4CC7 A;  2RI2 A;  3H9N A;  3JCM h;  4M77 G;  2DXB A;  4DBQ A;  5GMK i;  3ASK A;  3O8V A;  3CD6 A;  3MHX A;  1PRL C;  4ZN1 A;  4XU1 A;  1UB4 A;  2P0Q A;  2R5A A;  3Q1J A;  3M55 A;  4BD3 A;  5FLX E;  1M30 A;  1YJ9 T;  2DVJ A;  1MMG A;  1Q7Y C;  1IHW A;  1IGQ A;  2WSC E;  1IGU A;  3QXE B;  3PVQ A;  4LXC A;  1C0M A;  2OI3 A;  3U23 A;  1O75 A;  1NG2 A;  1G2B A;  2DD5 A;  3JCM X;  5FRN A;  1D3B B;  3TCJ A;  3S3N A;  2OTL T;  2MF2 A;  2W10 A;  4FU6 A;  4OML A;  1IZ6 A;  4M7D C;  2ECZ A;  2JTE A;  2XMF A;  4D6W A;  3MEV A;  2QDL A;  3M4Y A;  1X2K A;  3OQ5 A;  2PVO B;  2HQE A;  3CCQ Q;  2OTL A;  4EIK A;  1WA7 A;  3M0U A;  2A08 A;  2CZ7 B;  4C92 D;  3GF5 A;  1WDX A;  3VS5 A;  2DET A;  3LW5 E;  4J7I A;  3VS3 A;  3OYD A;  1XTD A;  4M78 G;  4M7D G;  1Q82 R;  4B9X A;  1YIT T;  3HRT A;  1XOV A;  2EKO A;  1M1K C;  2KR3 A;  2KI7 A;  5GAM e;  2MWP A;  5FRO A;  3NMZ C;  5CKH A;  4Z02 A;  2QDY B;  5KCH A;  2K3Y A;  1ABO A;  2HZY A;  3CC4 T;  2DBK A;  1YI2 Q;  4RG2 A;  4L5G A;  3CC7 Q;  2ZZD A;  1SRM A;  4AFS C;  1CSK A;  1NLP C;  4TVR A;  4M75 E;  4PJN A;  5IHI A;  4E47 A;  3KBG A;  5KYY B;  2ZPE B;  1JEG A;  3SHW A;  2FZC B;  5GAN 7;  1K9A A;  3H41 A;  4FYY B;  3SDZ A;  2RQW A;  3DLL A;  3A8L B;  4F7U A;  1RAB B;  3LGF A;  3CCM A;  2FO0 A;  4RCB A;  3OMG A;  2H3E B;  4XQ3 A;  3ZFJ A;  3TVT A;  1VQ9 Q;  2ZAE A;  4X9D A;  1I5O B;  1R0C B;  5GAM j;  1E6H A;  1K8A C;  3OY9 A;  5EC7 A;  3CQT A;  4FYW B;  3M57 A;  2EJ9 A;  2AHJ B;  1YJW Q;  1H92 A;  3L42 A;  3GPL A;  2DX1 A;  2DBM A;  2EKH A;  2RI5 A;  2RK1 A;  2X4X A;  1UEB A;  1NEB A;  1WHM A;  4PK4 A;  2M02 A;  2PUK B;  3GNF B;  2XDB A;  4C92 E;  3CCS A;  4C0F A;  1VQK Q;  2OTJ Q;  4LD9 K;  4O5V A;  4GBQ A;  2ROL A;  5IH2 A;  2DTI A;  2DEQ A;  3RKX A;  1YCY A;  3LLR A;  5LJ5 h;  2YRC A;  5GAN f;  3CCV T;  3PMT A;  1YJN A;  4JRQ A;  3VRY A;  5FWB A;  2EJG A;  2QQR A;  2QXF A;  1T3L A;  2AT1 B;  3VS4 A;  5C0M A;  2XK0 A;  1MUZ A;  2XI9 A;  4ELZ C;  2DZC A;  5KYU B;  1NJI U;  3UPU A;  1TOV A;  2JOY A;  1YIJ T;  4PLI A;  4AFZ C;  2M16 A;  1R8O B;  1ZUY A;  1UDL A;  2HNI A;  3OS2 A;  1I07 A;  1HK9 A;  1M5Q 1;  5KYX A;  3S6W A;  2ROT A;  3VS7 A;  1VYV A;  3L2U A;  2D6F A;  4X1V A;  2DIL A;  4A63 B;  1W2B A;  1D0Z A;  4N0A C;  4FL6 A;  4PJO A;  1J3T A;  4KGZ B;  5IXB A;  2HDA A;  4JJB A;  3EG1 A;  1TUD A;  2JN0 A;  1AZG B;  1M9S A;  2ZCF B;  1B34 A;  3ZL7 C;  2JW4 A;  2X4J A;  1TU0 B;  1I1J A;  2EYQ A;  3RER A;  2V8J A;  4R0K A;  5DLO A;  1HD3 A;  3JV3 A;  1KHC A;  4QT7 A;  1KG1 A;  4C0G A;  1Q95 G;  1D0Y A;  2KYB A;  2DYI A;  1M27 C;  2HQX A;  4KGX B;  4XU2 A;  3WVD B;  2J6K A;  3PIP A;  3CXC A;  1IXD A;  1KQ2 A;  3CPW P;  3M54 A;  3CXC S;  2NWM A;  1ZSZ C;  2BE9 B;  4ANJ A;  4BY6 C;  1U8R A;  2NYS A;  4M7A F;  2CT4 A;  2IG0 A;  1MGQ A;  1K9M U;  3VU3 C;  3SWN C;  1KQS S;  1QKX A;  2XG8 D;  1W70 A;  4A53 A;  3EGX B;  3JB9 G;  2DXU A;  2FVU A;  2GCX A;  3VKI A;  4M78 B;  4M7A G;  4HCZ A;  1AZE A;  1PCX A;  2BZ8 A;  3H0I A;  3CMA Q;  4M4Z A;  3CCJ Q;  4DQ2 A;  1LOJ A;  4LDW A;  1BI2 A;  2IPO B;  3PVL A;  2M1H A;  4JUV A;  5DLQ E;  1Y0M A;  4C8Q C;  1BCO A;  5LJ3 f;  2LJ0 A;  3PMI A;  3CCL Q;  1I8F A;  3H6Z A;  1KHI A;  1QVG P;  1VQ5 Q;  2LCL A;  1XJW B;  1RAA B;  1V29 B;  1K0X A;  1VQN T;  2JNG A;  4IKF A;  2DJQ A;  3F70 A;  1S72 Q;  1AWW A;  1LJO A;  2LQK A;  3HPW A;  1OX8 A;  1RAH B;  1KC8 R;  2VKN A;  3I5S A;  2DK3 A;  1QVF S;  3FDR A;  3VRZ A;  1NJI R;  4J6Y A;  2NUT B;  5KYW A;  1AD5 A;  1RAE B;  2R57 A;  1B3Q A;  3KXT A;  4DBR A;  1YHQ Q;  1M1F A;  4R55 A;  2CZ0 B;  3I9Q A;  4XAX B;  1Q81 C;  1YWP A;  1VQO Q;  1D1B A;  2QAZ A;  3WVE B;  4KGV B;  2EPD A;  1NPR A;  1VUB A;  1G3S A;  2YRD A;  3EAE A;  4OMO A;  4C92 A;  1JU5 C;  4C5H A;  4HA8 A;  3CCE Q;  3JCM P;  4Y28 E;  4E7H A;  3UF4 A;  3M0R A;  4DEX A;  4AG1 C;  2KT1 A;  3M4G A;  3LX7 A;  3ULR B;  2MK5 A;  3GNG A;  1VQ4 T;  3G71 T;  4FT4 A;  3MET A;  3VUB A;  2EQI A;  5FU6 C;  1JRI A;  2RQV A;  3C4S A;  3JCM c;  4RMO A;  2KE9 A;  1QWE A;  2RHZ A;  2D8H A;  2LP5 A;  2K5I A;  4QQG A;  2AIR B;  1VQ6 T;  2GQV A;  2WSE E;  1VQ4 A;  4EMG A;  4QKU A;  3EFO A;  2QA4 T;  2F1L A;  1ZA1 B;  2YSQ A;  3OYL A;  2O4X B;  4J9D A;  3OW2 S;  1ZLM A;  2MCN A;  1RI9 A;  5IHK A;  5LJ3 h;  2V8K A;  4DOW A;  4PFZ A;  1RLP C;  1BIA A;  1CKA A;  1GFC A;  1P92 A;  3MP6 A;  4XTX A;  3NFC A;  4L59 A;  4A54 A;  2O2O A;  3JCM e;  2DEU A;  3AHU A;  4IUT A;  2RN8 A;  1UEC A;  1VQ7 A;  2QQA A;  3QYG B;  3DLM A;  2CSI A;  3CCU Q;  3H0H A;  1WXU A;  3BY7 A;  4IIM A;  1RAC B;  4F7U G;  3MJX A;  2L3Q A;  3EG9 A;  3FC3 A;  4FYX B;  3H0F A;  4GY5 A;  3OSV A;  1TH7 A;  5CR2 A;  1V76 A;  1UUE A;  2NUP A;  2JS0 A;  4EMK B;  2F5K A;  2K3B A;  5HK0 A;  1RI0 A;  1MMD A;  3BFM A;  4LDU A;  1G8X A;  1PKT A;  2NLU A;  2D9T A;  4PJL A;  2DLP A;  4II1 A;  4D8K A;  1K73 R;  2BZY A;  5HKC A;  2DAQ A;  3THK A;  1XQH A;  2JZ2 A;  4ME7 A;  2QYZ A;  2FL7 A;  4J6X A;  4GLM A;  2KK4 A;  2YDL A;  1N8R C;  1VIF A;  2B8A A;  2KY9 A;  2PU9 B;  4OMF B;  4QW2 A;  3OYC A;  2W0Z A;  1W1F A;  1MMN A;  2JTF A;  3QJY A;  3FB9 A;  4FCY A;  4OMQ A;  1ZBJ A;  2JTM A;  2E64 A;  1WQ7 A;  2E1H A;  2PVD B;  2VV5 A;  1BU1 A;  3I56 Q;  1KD1 C;  1M90 C;  5L8R E;  3VS2 A;  3M9Q A;  3KUF A;  3JCM W;  1G3W A;  2KT8 A;  1BK2 A;  2J05 A;  3SD4 A;  3FLG A;  2YT6 A;  3G1J A;  3BDL A;  3I55 T;  1UFF A;  4DBH A;  2FPF A;  1WLP B;  4LDY A;  5GAM d;  1Q82 U;  3JB9 H;  5GAO m;  4M7A B;  2GFU A;  1AT1 B;  1OUL A;  1WXB A;  3HTR A;  3S3M A;  1RL2 A;  4N0A A;  3OS0 A;  3G4S Q;  3CME T;  1TS9 A;  1VQL T;  1FXX A;  1WX6 A;  3PNW C;  1DJ7 B;  1FYN A;  3I55 A;  4PJO F;  2FRY A;  5D6Y A;  3RKY A;  1Y96 B;  2BUD A;  4JLG A;  5CVI A;  3CME A;  2LQN A;  2SRC A;  2K57 A;  1WNL A;  2XKO C;  4LE9 A;  2RHU A;  4PJO G;  2CUD A;  1FMW A;  4AMC A;  1WFW A;  1VQM Q;  1D1C A;  1QWF A;  2VB6 A;  2K79 A;  2VXF A;  3C12 A;  1JJ2 S;  2A28 A;  2GNC A;  2EVR A;  2EGC A;  5GAM g;  4ZTJ A;  4ZTF A;  1PSE A;  1W4S A;  4M77 F;  3JB9 I;  4HT9 A;  2YXY A;  3SWN A;  1U06 A;  3RIR A;  2A0F B;  1Z9Z A;  3EG0 A;  4M75 C;  2C0T A;  4C0D B;  2H8H A;  5GAN 6;  2QEX Q;  3RMQ A;  2H3J A;  4K11 A;  2QTX A;  1Y7X A;  3NPF A;  4MDX A;  1TG0 A;  5LJ5 e;  2DJZ A;  1W6X A;  4ZNX A;  2GTJ A;  1VIE A;  1KJW A;  1U1S A;  4DA4 A;  4C8Q A;  1HXD A;  2ATC B;  4RTT A;  2KQW A;  1VQP Q;  1OOT A;  4MZT A;  3TRE A;  4E7L A;  2FZG B;  5GMK l;  3L2Q A;  2HSP A;  5FU7 B;  3QHS A;  3TSZ A;  1KFZ A;  3CC2 Q;  2HKN A;  3MEA A;  2VAS A;  2E3I A;  2EQJ A;  1RAG B;  4F04 B;  1Q86 R;  1N27 A;  3VV0 A;  1MHN A;  1TTH B;  1WPY A;  1R0B G;  3OYK A;  2O01 E;  5L23 A;  4M78 F;  3V7C A;  4M7D F;  3HP9 A;  3SFM A;  8ATC B;  3HFO A;  4AFU C;  1AWX A;  1FWZ A;  5KH6 A;  4GLK A;  3M0Q A;  4ZGJ B;  4QVZ A;  2GFA A;  1KK7 A;  4NOY A;  5LJ5 j;  1EFN A;  3A1P A;  1JXO A;  2CZ6 B;  3KFV A;  5HK3 A;  3NHN A;  4OP0 A;  4IUR A;  5A0L A;  2RJE A;  2AZV A;  2XDP A;  4C92 C;  1VQ9 A;  1SHF A;  2HEQ A;  3X28 B;  5KE3 A;  2KRN A;  3I5R A;  1X75 C;  2HD0 A;  2DIG A;  3C0C A;  3L1A A;  1I81 A;  1UGQ B;  2L89 A;  4LUD A;  1Y71 A;  4IIO A;  3MP1 A;  2DF6 A;  3NTK A;  1OV3 A;  2O88 A;  3CCM T;  1KQ1 A;  2COY A;  2P84 A;  1A0N B;  1BI0 A;  1K76 A;  3QBY A;  1WI7 A;  1YJ9 Q;  2E6Z A;  2MYS A;  1D3B A;  2CS7 A;  2OTJ T;  2YLB A;  1BIB A;  1T0J A;  1X2Q A;  5CK9 A;  5GMK h;  4PFP A;  3CXC P;  2G6F X;  2E5K A;  3VUZ A;  1HYO A;  2COZ A;  2HAX A;  1Z9Q A;  5A2Q E;  4MZM A;  2CT3 A;  2RHX A;  1VQK A;  3VYH B;  2OTJ A;  2OTL Q;  2LJ3 A;  3CCR T;  1KQS P;  4ELY C;  4J9I A;  2KMT A;  2CP7 A;  1XNI A;  1PRM C;  2ED0 A;  2PVG B;  1WHL A;  2CUB A;  2JM9 A;  2RJD A;  1QCN A;  2QI2 A;  2X3W D;  2X51 A;  4E7I A;  2FPE A;  3CCR A;  2EYX A;  4JRI A;  3CCS T;  3REA B;  2M9U A;  2F2W A;  2HBP A;  4WTO B;  1YIT Q;  3VS6 A;  3FJP A;  3EH1 A;  1RUW A;  1QW1 A;  2VGN A;  2JMC A;  2DRK A;  3FEO A;  4M78 E;  3EGU A;  1YJN T;  3CC4 Q;  5KYX B;  5KYY A;  2Y4Y A;  2YHT A;  3MEW A;  1X27 A;  2DER A;  1ZUK A;  5GAM f;  3P8H A;  4JZ3 A;  4A4F A;  1Q7Y R;  1TUC A;  2R58 A;  2YUN A;  2XIC A;  2DE0 X;  1JB0 E;  2JJ9 A;  1QVF P;  1G5V A;  1QLY A;  1QMC A;  2FZK B;  4PJO B;  1KC8 U;  2RHY A;  1OQK A;  1M4Z A;  1UJ0 A;  3URG A;  2IVW A;  3TU4 K;  3OMC A;  3RDV A;  4JJC A;  4QQD A;  1LPL A;  1GL5 A;  2LDM A;  1NJI C;  4CI0 C;  2MMP A;  3M0S A;  2GF7 A;  3OYJ A;  2Y90 A;  4OGC A;  1VQ8 T;  2CSQ A;  2RO0 A;  2DNU A;  4Y92 A;  5GAO r;  3HSB A;  1OEB A;  1YFN A;  3JRZ A;  4X9C A;  2KXC A;  2K2V A;  2LQ8 A;  4M77 B;  5GAN 5;  2DL5 A;  4ZGD B;  1VQ8 A;  2P4R A;  2XDD A;  1M1K R;  2O9S A;  1W2B S;  3P8D A;  3QKJ A;  3MP8 A;  1GCQ A;  4FSS A;  2F5T X;  2G3R A;  3M59 A;  3UWN A;  3C94 A;  2HBW A;  3OW2 P;  1VQ5 T;  2CH4 A;  2LTO A;  2D0N A;  2QK0 A;  2ABL A;  3CCJ A;  3RES A;  1SRL A;  1I0C A;  4OMP A;  3MO8 A;  1GXI E;  5KYU A;  4HT8 A;  5D6X A;  2LZ6 B;  3CCL A;  4ORZ A;  3JCM d;  3JB9 F;  2P4T A;  3CCV Q;  2L3R A;  2QGG A;  2JS2 A;  4F17 A;  1VQ5 A;  1WIE A;  2WAC A;  1LCK A;  5GAN h;  3OYB A;  4Y91 A;  1NBE B;  1ZQ1 A;  4JJN K;  1YHQ T;  3EHQ A;  5GJV B;  1OZ2 A;  2HMA A;  1K9M C;  5GAN 3;  2K3X A;  1H8K A;  1YIJ Q;  1K8A R;  4M75 A;  3HKS A;  4KT0 E;  4M7D B;  2EWN A;  4MZP A;  1M2V B;  5KYW B;  1SPK A;  2ESW A;  1BBZ A;  3HRU A;  1YHQ A;  2KDS A;  1NE8 A;  2CZ1 B;  2J7I A;  2KSS A;  3EGD B;  2FB7 A;  3PFS A;  3QO3 A;  4QVD A;  1X43 A;  3NTH A;  4LDV A;  1UGV A;  1YWO A;  1K73 U;  1LNX A;  3QUI A;  3JCM g;  4C8Q F;  2V1Q A;  3GOX A;  1UTI A;  4AT1 B;  2L3S A;  3CCE A;  1QP2 A;  4J8O A;  4LUE A;  3OYM A;  4R56 A;  2L5Q A;  4BDY A;  4C8Q G;  3A98 A;  1QVP A;  1NZ9 A;  3J80 E;  9ATC B;  2L3P A;  1VYU A;  2K5F A;  4EMH A;  2DIQ A;  4E6R A;  4OB3 B;  3FIF A;  2LCS A;  3HL8 A;  2LX7 A;  2DL3 A;  4N4I A;  3CCU T;  1SHG A;  5CQY A;  2LMJ A;  2AZS A;  2DZ9 A;  4XK8 E;  4JDS A;  1Q81 U;  2P0K A;  3CBO A;  2DA9 A;  2XU8 A;  3CCU A;  4OVA A;  1BI1 A;  3LGL A;  4XU0 A;  3JCM V;  2J6O A;  1FMK A;  3IQL A;  5IAY A;  4RTV A;  2V26 A;  1QCO A;  5GAO n;  4M7A E;  1QP3 A;  2IIM A;  2NUP B;  3MCA B;  3G6E T;  2VUB A;  4MMK A;  5CKF A;  1VQ7 T;  1LVK A;  2JXB A;  4KBM B;  4HKE A;  1WJS A;  1FX7 A;  1S1N A;  2HQH A;  2EYY A;  5FWC A;  1X01 A;  5I21 A;  2RK2 A;  5C6S A;  2A36 A;  4F7U F;  2RHI A;  1JJ2 P;  1AOJ A;  1VQN Q;  3G6E A;  1GRI A;  2DM1 A;  5IHN A;  3CEY A;  2E70 A;  2DTH A;  2EGE A;  3VJP A;  2Y4X A;  2CP2 A;  4PL6 A;  1O9S A;  1GFD A;  5D7U A;  3JCM b;  2A7Y A;  2JT4 A;  4NL3 A;  4WCI A;  4E7S A;  2OX7 A;  1UGS B;  1WGS A;  4IUV A;  3I56 A;  1PSF A;  5LJ5 d;  3EG3 A;  4LD6 A;  3UA6 A;  4C5I A;  2D1X A;  1VOM A;  5GAO q;  3PGG A;  3ER0 A;  3QDF A;  1VQ4 Q;  3REB B;  3G71 Q;  5A0D A;  3A8M B;  2E10 A;  2DO3 A;  2O4X A;  3HHT B;  4JJD A;  4E7Z A;  4OB1 B;  5CCA A;  3SEM A;  5HY6 A;  2KYM A;  3G4S A;  2QGF B;  4A4G A;  4IUU A;  4EDU A;  1QVG A;  4RTX A;  2E65 A;  1VQ6 Q;  1K4U S;  2MWO A;  3OB9 A;  1Q86 U;  2SEM A;  2QA4 Q;  4J5Y A;  4BB7 A;  1UGP B;  5GJW B;  1YBY A;  1H3Z A;  3A5Z B;  1NLO C;  4J9E A;  5IN1 A;  1C6V X;  1N8R U;  5LJ5 g;  2RF0 A;  3EFR A;  1OU8 A;  1PD0 A;  1C1A A;  2FG0 A;  2XID A;  2DL8 A;  4IUP A;  5LL6 S;  1X6O A;  4EMK A;  3FJ5 A;  3VS1 A;  4J9C A;  4JZ4 A;  1Q81 R;  3NTI A;  3O5Z A;  1G3T A;  1ZSZ B;  3LH0 A;  3JCM f;  1BB9 A;  1GCP A;  4A4K A;  4JPB W;  4BY6 B;  1Q82 C;  2HL3 A;  4F16 A;  3MEU A;  2LT4 A;  2M0Y A;  1M8M A;  4IUQ A;  2QEX T;  2KNB B;  8AT1 B;  3RMS A;  5GMK e;  3SWN B;  4OGE A;  4C5G A;  4PJM A;  2EFI A;  1PC0 A;  1GCQ C;  4X34 A;  3A8G B;  1WXT A;  6AT1 B;  4DOV A;  2B86 A;  2PTK A;  2CYZ B;  4PJO D;  2EYZ A;  4FYV B;  2GQI A;  3QPH A;  1SSH A;  1X6G A;  5KE2 A;  2R5M A;  2QEX A;  2KVQ G;  1WZO A;  2AKL A;  1N6A A;  1AWO A;  3PT9 A;  4Q5W A;  4C8Q B;  3LH5 A;  1WHG A;  4RUG A;  3LWH A;  3VYG A;  4ZN3 A;  1VQP A;  5M9O A;  4BUG A;  3M5A A;  5CKB A;  1K1Z A;  2DKG A;  5FW9 A;  4JS5 A;  4KUL A;  5AT1 B;  4M77 D;  1OZ3 A;  1ZUU A;  3R6N A;  5GAN 4;  5GAN 8;  2KEA A;  3CCQ T;  1V1C A;  4JRK A;  3QSU A;  2PNI A;  1G3Y A;  3JCM Q;  4HVV A;  2RM4 A;  4M75 F;  1SEM A;  1UHF A;  3RUX A;  1WHH A;  2JUF A;  2DL4 A;  2RNA A;  5GAN g;  2COW A;  3WXM B;  3CCQ A;  2DTO A;  2YUP A;  2J6F A;  3QZ5 B;  4E2F B;  2OAU A;  1U1T A;  2K2M A;  1YI2 T;  1U5S A;  3CC7 T;  3E1S A;  4M75 G;  1Y96 A;  2P0P A;  4FT2 A;  2MOX A;  2Z0W A;  2KBT A;  3CME Q;  4ATO A;  4YTL A;  2DFU A;  3OYF A;  1VQL Q;  1SSF A;  3OYE A;  3X26 B;  1YI2 A;  3CC7 A;  2C06 A;  1Q7Y U;  2EIF A;  1OX9 A;  2K6D A;  1SKU B;  1Y07 A;  4XTV A;  1E6G A;  2CDT A;  3HFN A;  1ZA2 B;  2RQR A;  3CPF A;  1BCM A;  3QDR B;  1N8R R;  5FU6 B;  2GGR A;  3OA6 A;  4M78 D;  1VQ9 T;  2DYB A;  4M7D D;  1BYM A;  4LN2 A;  2E3H A;  1YJ9 A;  3UA7 A;  4PJO E;  2RD1 A;  2ED1 A;  4J7F A;  2CRE A;  2X9H A;  1ZBX A;  4F7U B;  4QVC A;  4M78 C;  2ZPH B;  4DBF A;  4HCC A;  1KD1 R;  1I4K 1;  1M2O A;  1M90 R;  2RI3 A;  3V8J A;  3CD6 Q;  1YJW T;  1GBR A;  4C92 F;  4O6J A;  2CGH A;  4HXJ A;  1X69 A;  1H64 1;  2HKQ B;  4CC2 A;  4DEY A;  1W2B P;  2L0A A;  5GAO p;  5J26 A;  5LJ3 d;  1M1K U;  5CAI A; 
#chains in the Genus database with same CATH homology
 1EX4 A;  1IHV A;  1QMC A;  4FW2 A;  1C6V X;  5D7U A;  1IHW A;  1C0M A;  1C1A A;  4FW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...