1IHVA

Solution structure of the dna binding domain of hiv-1 integrase, nmr, minimized average structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
52
structure length
52
Chain Sequence
MIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the DNA binding domain of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna binding protein
total genus 5
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1ihvA00
1C6VX 1C1AA 1IHWA 1EX4A 5D7UA 1QMCA 1C0MA 4FW2A 4FW1A 1IHVA
chains in the Genus database with same CATH superfamily
2M0OA 3RESA 2K5LA 1M3AA 3G1JA 4GY5A 1ZUUA 3M58A 2RHYA 4JRKA 1TSFA 1AZEA 1BYMA 2X9HA 2KE9A 5DLQE 4ESRA 3RIRA 3HHTB 2LJ3A 4J83A 4F16A 1NJIC 1ABQA 3REBB 2LJ1A 1NYFA 2DBKA 1X6GA 2XG8D 2RD1A 2I2LA 1M2OA 5GMKe 2K3XA 2O31A 3UATA 2X4JA 1OULA 1ZSGA 2AZVA 5A0GA 4HCZA 2XDBA 3X26B 3M55A 2ENMA 4LD9K 2DM1A 4C8QB 4M78G 1QCNA 4OMPA 2CP0A 4WCIA 3EG1A 4N4HA 1T0HA 4DEYA 2MWPA 4ME7A 1AZGB 2CSIA 5FU6C 1Q95G 1VOMA 2CSQA 4M7AD 4C5IA 4M7AA 3CCMA 4NOYA 5I21A 3OSVA 3J81E 4OF1A 4LDWA 4L59A 1KIKA 4J7IA 1E6GA 2E1HA 2LJ0A 3PT9A 2W0ZA 1X01A 2KRNA 2GNCA 5D7UA 4KUIA 1MNEA 1J3TA 2X3WD 1G5VA 3CMAQ 3UF4A 1GL5A 2XIDA 4PKCC 2HAXA 2E6NA 3OYJA 4WF2A 4X1VA 1QVGP 1KQ1A 5KCOA 1MMAA 3QXEB 1M1KU 1AHJB 2C0OA 1KFZA 4N4IA 1K9AA 5M9OA 1W1FA 5LJ5g 2CUBA 3MO8A 3CC7Q 3R6OA 3HTRA 3EG9B 3LGFA 5KCHA 1VQKQ 5DM7R 1BCOA 1IHVA 4KBMB 4K11A 2NLUA 1C0MA 2XU8A 3F70A 3A8OB 3JSCA 4M78D 2A08A 3A8LB 4M78A 2AZSA 3OB9A 3M56A 4PJOD 5IXBA 4E7KA 5GAOp 4PJOA 4QVZA 1RLQC 5IT9E 3EH1A 1JQQA 2C0TA 1Y96B 3JCMc 5CKEA 1QVFS 1EFNA 4LE9A 3DLLA 3CBOA 4M77D 3L2UA 3JV3A 1GCPA 3SFMA 4J8OA 4M77A 1QVFA 1W6XA 2O9SA 1M90R 1AWWA 3CMAT 2DYBA 5LJ3f 4ANJA 1TS9A 7AT1B 1Z9QA 1Y7XA 4FW2A 1VQOT 3BFMA 2KXDA 2DMOA 1A0NB 5FRMA 2EW3A 5LJ3e 2RHXA 3CC7T 5HY6A 4M7AF 2F1LA 2E3IA 3GNGA 2L2PA 2EBPA 3V8KA 1TUCA 3RMQA 1KQSA 1PWTA 3CMAA 2K7AA 3RMSA 1BI2A 1M3CA 2DBMA 2HL3A 2M0YA 2EYXA 1MMGA 3QIIA 2KRMA 3OS5A 4XU1A 4C8QE 4J6WA 4Y28E 2LVMA 3M54A 1HXDA 3S3OA 3CEYA 1X2KA 3CC7A 3ASKA 1N9SA 1O9SA 3JCMJ 4RTVA 1VQKA 3JCMg 4F7UB 2HQHA 3L42A 1FXXA 4FL6A 3JCMQ 2LQNA 4E7ZA 3DB4A 3CCRT 5GANg 2D0NA 2QQ9A 5LJ3h 3BDLA 1FWZA 4M78F 3OW2P 3P8HA 1I1JA 3OYMA 5LJ3d 3CCQT 3FC3A 1H3ZA 2ZZDA 1ZA1B 5KH6A 4V2SA 1UGQB 4KGVB 1K8AR 1IGQA 4HA8A 5GAN5 2RQWA 4MMLA 5I22A 2A3LA 3NTKA 2RJEA 1KJWA 4ZTFA 1IRXA 4J9HA 2BIVA 2L3SA 3UA7A 2JM8A 2COYA 1AWOA 1M1FA 3ULRB 3UA6A 4AFQC 1NZ9A 2B86A 5CKDA 2F69A 3OQ5A 5IHIA 4HVUA 3RDVA 3TSWA 1BCMA 2RF0A 4HKEA 1BK2A 1OEBA 4CRIA 1TWBA 3PNWC 4AFZC 3ZL7C 2F2VA 4WTOB 5DY9A 4OMOA 3CCJQ 2RB6A 1VA7A 3UDCA 2RQTA 5I11A 2ZPIB 2IIMA 1SRLA 2DXCA 2CZ1B 3CBPA 5HK0A 3VS4A 4GLKA 3RR6A 3OMCA 2LCLA 4C5EA 1R77A 5CK9A 1NEGA 2EYZA 3NTHA 2FZCB 2BZYA 2EKHA 2YLCA 3EGDB 3E9GA 1TH7A 3FRNA 4XAXB 5GAMg 1I5LA 1Q82C 2KRSA 2DEQA 4PJLA 1FMWA 4R55A 1PC0A 2FEIA 2PNIA 1KQ2A 3S3NA 1M3BA 2R57A 3ZFJA 3QWXX 5D6YA 3FJ5A 4JLIA 3MEWA 2VV5A 3OMGA 3QKJA 1X2QA 1PD1A 3GF5A 2DXTA 1WFWA 2NUTB 1VQ9T 3CMET 1V76A 1WGSA 1U06A 1VQNQ 2EYWA 4M75B 5KYNA 5DLOA 3VS1A 2CDTA 2GBQA 2M02A 5GAOl 4ZGJB 1ZQ1A 3HFOA 2KBTA 5L8RE 1RLPC 1M8MA 1K9MR 4EMKC 2JNGA 1C6VX 2DD5A 4F7UE 1BIAA 1BB9A 4LXCA 4C0DB 2EAYA 1Q81U 2CH4A 1Q86C 3NGPA 1WLPB 3LH0A 2NUPB 1ZSZA 3BDUA 4M7DE 1YWOA 1VQ9A 2ECZA 2YLBA 4B9XA 2OTJQ 3QDRB 2RJCA 2QYZA 1QVFP 1NJIR 4CI0C 2QQSA 3CCJA 3PVQA 1K4US 2KROA 5IN1A 2LT1A 3SB2A 4JJBA 4KUDK 3JCMb 4PL6A 1T3LA 4C92B 3CD6T 4GBQA 3CQTA 5I2SA 1GBRA 3EGXB 1FMVA 3FJPA 3L2RA 3OYGA 4ZN1A 4FW1A 4LDXA 2K79A 2PVDB 1OPLA 4OP0A 4KGXB 2MK5A 4BDYA 5FROA 2KI7A 1Q7YR 1YNZA 3DB3A 3FB9A 2A0FB 2QA4Q 5J3BA 3GNFB 1S72Q 2CUDA 1NYGA 4M7AC 2HNIA 1X6OA 1VQLQ 2JM9A 2KVQG 1M2VB 1FMKA 2BE9B 2DZCA 4AG1C 1VQNA 2DXUA 1ACMB 4Y92A 3H8ZA 3SDZA 2KYMA 2DEUA 4JPBW 1RACB 2JOYA 1SHFA 1TUGB 4LD6A 3VV0A 4C8QD 4C8QA 2LZ6B 2NUZA 2X4YA 2EGAA 3JCMh 1QCFA 1YJWT 1PRLC 2H3JA 3CCUT 1O75A 3G6ET 2YUOA 4BI3A 1HK9A 1N27A 1NLPC 3THKA 2EQUA 2YUQA 1RI9A 3KBGA 4DQ2A 2JW4A 2K2MA 2R58A 1I81A 3M9QA 2OTJA 1M30A 4JRPA 1GFDA 5IXFA 4LDUA 4M78C 3LLRA 4F14A 1VQ5Q 2P4RA 5D6XA 4M75E 3AT1B 3HKSA 3H0HA 1ABOA 1S72T 4KH1B 2ZPHB 3CCUA 1XJWB 1PCXA 2DL5A 2RMOA 2CT4A 2VKNA 3QUIA 2LCSA 4HT9A 4MDWA 5IHNA 4ZN3A 4DOVA 4EPCA 2KT1A 2MI6A 3X25B 5FWBA 3QG1A 3EG9A 1VUBA 2EGCA 3QZ5B 4JJNK 5GAOn 1JXMA 1PNJA 3KFVA 3INZA 4LN2A 1E6HA 1JXOA 1KHIA 4MDXA 1RADB 2JT4A 2LQKA 2QA4A 5FWCA 4JJCA 4RCBA 4X34A 3OYIA 1S72A 3RKWA 4AFUC 1Y96A 1M90U 2L3QA 3G71Q 4IIOA 2DNUA 5IH2A 2V1QA 4RTYA 1EIFA 2SEMA 4F7UG 2HKQB 4C92E 1W2BA 1W70A 3VS6A 3EFOB 4MZPA 1WX6A 1UEBA 3JCMP 3KXTA 1RUWA 2EJ9A 2RI5A 3QO3A 1QP2A 1NE8A 3C4SA 5A0LA 3HRSA 3MP8A 4XU3A 3M0TA 1GBQA 1WA7A 4BE0A 1VQMT 2JMCA 4NL2A 2KSSA 1LVKA 4FT2A 4RG2A 5CCAA 2DA9A 3I56Q 2DD4A 4YTLA 1V1CA 1UGRB 1YCYA 2HEQA 4E7LA 4J9BA 1Y0MA 2R5MA 3NTIA 1G3WA 1YHQQ 3OS2A 3CCMT 3QZ9B 2E64A 4LDVA 4XU2A 4PJNA 3DKMA 1VQ5A 3OYKA 3X28B 3RNJA 4A53A 2FG0A 4Z8AA 2A36A 2L3RA 1GCQC 3CCEQ 4OMLA 1R0CB 3G71T 2DPPB 2XDDA 1VQMA 5FLXE 3MKDA 4PJOG 4RTZA 3TQ7P 2AHJB 3M4YA 5LJ5j 3EG0A 3HRTA 5HKCA 4F7UA 4NS5A 2JJ9A 1AVZC 3H41A 1D09B 4M7DD 4BUGA 1HJDA 4IUPA 1SHGA 4M7DA 1ZBJA 1K8AU 1RL2A 2ZCFB 4O5VA 1PG5B 2MF2A 2WSCE 1SSHA 4M77G 2X3XD 3A8GB 2D9TA 2J06A 2FZGB 4E7SA 1WHLA 1M27C 1WQ7A 2QQAA 3G7ZA 3I56T 1VIFA 3G71A 4JS4A 1D3BB 3VUBA 1K0XA 4A4HA 4EMGA 2MYSA 1NM7A 1D1BA 4J9DA 2JS2A 5KYYB 1QWEA 3MJXA 1BKBA 2O9VA 3OY9A 2YSQA 3A98A 5CO7A 1RAGB 4PNOA 4ATOA 2GQIA 3I56A 4RUGA 2QQRA 1WPYA 3QPHA 2XHCA 3MP6A 1AEYA 2E6ZA 1GXIE 2HBWA 1IREB 4J7FA 1YIJQ 4PLLA 4HCKA 1YHQA 3E19A 3EG3A 2KY9A 1KHCA 5ECAA 1KD1R 2VWFA 4FT4A 2DJZA 3PMIA 5I2MA 2IVWA 1KC8C 3Q1JA 4EDUA 5GMKl 2HL5C 2NYSA 1G8XA 2XKOC 5A2QE 1RAHB 2XICA 4Y91A 1D1CA 2IG0A 3CCEA 2COZA 1IO6A 1MMDA 3EGDA 4E6RA 2C06A 3P8DA 1JBMA 3PIPA 2A37A 1TTHB 4F7UF 4VUBA 2OTLQ 4IUUA 3JRZA 1ZHIA 5GAN4 3LH5A 1X43A 2XK0A 1F1BB 3CC2Q 1VQKT 3OBWA 5KE2A 1AWJA 2RI2A 2AK5A 2LRQA 1KQSS 2RO0A 5GANj 1N8RC 1KK7A 1K73R 2NUTA 1ZSZC 5KYWB 2J6FA 4L6V5 4J6YA 4B9WA 4FYWB 4AG2C 5C0MA 4M75D 1QW1A 1TXQA 1OZ2A 2AKLA 1K9MU 4M75A 2M16A 4BY6C 1Q81C 1MMNA 2PTKA 3M0SA 2KR3A 1IGUA 1SSFA 3ME9A 2EGEA 4A4KA 4DA4A 4MZTA 4KGZB 4J9EA 3QYGB 1MNDA 2QGGA 2E65A 1M5Q1 2DTIA 3H9NA 4HCBA 4A4FA 1ARKA 4L5GA 1NJIU 1OPKA 2YXYA 2NUPA 3LWHA 3MP1A 3PTAA 2KAFA 1P92A 4M7DB 2CP6A 1KG1A 1PSFA 3JB9I 1UFFA 2FVUA 4RG8A 2SRCA 1MHNA 4PJOF 2XI9A 2A28A 4JZ4A 3C0CA 3TEEA 2L3PA 1YIJA 1NPRA 2E41A 3LYIA 2LTOA 2YT6A 3EFSA 4O6JA 1WDXA 3CC2T 5HK3A 4C92D 2J6OA 1BI3A 4J9IA 1MV3A 1TG0A 4C92A 4PJMA 2P0PA 5CIUA 2E10A 3C94A 3U23A 4M77F 3EGXA 1Q7YU 1H3HA 1VQ6Q 2YDLA 5GAN2 2ATCB 3A8MB 5EG2A 1VQ4Q 3VJPA 4J9FA 4C8QC 1QKXA 2G3RA 3OYEA 3SWNB 3PIOA 5GAMj 1XNIA 2OTLA 2JTEA 5GAN3 4IUVA 5LL6S 3VUZA 2GTOA 2V26A 3ZBDA 3HRUA 3CC2A 5LJ5f 2YRDA 3QBYA 2ZAEA 1VQ8Q 2P0KA 1M2VA 1E7OA 5KYXB 4HCCA 2J7IA 2D6FA 5LJ5e 1TUDA 4PJJA 1Y07A 1GRIA 1LPLA 1OX9A 2CYZB 4AFSC 2BUDA 2IPOB 3QJYA 3V7RA 2HMAA 3OYNA 1W4SA 2EFIA 4HXJA 2BTTA 5FU7B 3L2QA 1R0BG 2YRCA 3RERA 3MEUA 3JB9J 3ER0A 1JJ2S 4E47A 1SPKA 1H92A 1VQ6T 2P4TA 1AD5A 4ORZA 3P8BB 4QKUA 2ROLA 4AMCA 2RQUA 1VYTA 1JJ2A 1WHKA 2X51A 2MIOA 1K1ZA 4J5YA 3HL8A 4JUVA 3E1SA 2O4XB 1OOTA 2DVJA 1N6AA 3VS5A 5LJ5h 2C0IA 3CCJT 2CKKA 2WSEE 2RQRA 2FHDA 2H8HA 3VS3A 1DJ7B 4ZNXA 5LJ5d 2QEXQ 2MMPA 1VQ8T 1X75C 4IKFA 3JB9G 3LGLA 3CCSQ 2CGHA 1VQ6A 3OYCA 4QT7A 1D0YA 2DAQA 5CAIA 1M90C 3CXCS 2CREA 2LNHB 2AIRB 4OB1B 3BW1A 3EHRA 4OMFB 2JZ2A 2M9UA 5EC7A 3CXCA 3L2VA 1VQPQ 4BB7A 2HKNA 3E9FA 4BACA 3OBYA 1VIEA 1SRMA 3G4SQ 1QWFA 4C8QG 3J7AF 2H3EB 2YWWA 1MV0B 2V8KA 3JCMf 3GBQA 4JRIA 1VQ8A 4BE1A 1OI1A 3DLMA 5GANf 1OX8A 2DKGA 2F2XA 4JS5A 3EFOA 2L8DA 2V8IA 2OAUA 3JCMe 4RKUE 1VQNT 5AT1B 3SEMA 3IQLA 2QTXA 5GANe 2D8HA 4HVVA 1UJ0A 2QAZA 3H0FA 1YWPA 1PD0A 2MOXA 2DYIA 2EKOA 3C95A 2QEXT 2PQWA 1KQSP 3JB9D 5FU6B 1OZ3A 2CZ6B 1U1SA 4X9DA 2LQ8A 2GQVA 2KQWA 3TSZA 1VYVA 2LX9A 4OB0B 1QVGA 3V8JA 1MUZA 2RA2A 4CC2A 2PVGB 2DE0X 1QLYA 2OTJT 2DF6A 3EHQA 1WXUA 2X4XA 3MCAB 4AT1B 4XTXA 2KEAA 4XTZA 3A5ZB 3M0RA 3G4ST 2EJGA 1U8RA 4E2FB 1UGVA 1PM3A 2JXBA 2QEXA 3VU3C 1BBZA 2FPEA 1UHCA 4OGCA 5GANh 3JCMd 3UWNA 4II1A 1WJQA 3HSBA 3OYFA 3S3MA 5GANd 1M1KC 2YHTA 1VQPA 3TVTA 4KULA 5C6SA 2JTMA 2PU9B 4HVWA 3X24B 3G4SA 5GAMf 3CC4Q 1UB4A 1RAFB 3RBBB 3TREA 4J9CA 1D3BA 4PJOC 2DTHA 3QDFA 5CR2A 2QA4T 4IURA 3CCLQ 4PFPA 1H641 3I55Q 2CZ7B 2P84A 1VQ7Q 2DJQA 1UG1A 5CQYA 5D6WA 5GAMe 1VQLT 5J26A 1HSQA 1R8OB 1KC8R 1CKAA 5KYYA 2FYKA 4M77C 1CSKA 1Y71A 3BY7A 4FYYB 3V7SA 4R0KA 3CBMA 1PKTA 3GOXA 2YUNA 3I5SA 1AWXA 3JB9F 1KD1U 5GJVB 4OMNA 2QASA 2ESWA 2YRVA 1B34B 1YBYA 2L5QA 3I35A 1W2BS 1OU9A 2F5KA 4UC4A 1VQLA 1N8RR 1LJOA 4FYVB 1PKSA 1WIEA 4X9CA 1QVPA 1UE9A 4Q5WA 2FZKB 2RHUA 3PGGA 3O5ZA 3CC4T 4XTWA 2E5KA 4M7DG 2DRMA 1VQ5T 5GAMh 5LJ3g 1I0CA 4C8QF 1EX4A 3NMZC 4RTUA 1AT1B 2DL7A 1JJ2P 5GAMd 1VQ7T 3VS2A 3MEAA 5CQXA 1UUEA 4EMKA 4MZMA 2RH2A 1K73U 3OYBA 2RN8A 1Z9ZA 4QQGA 1RABB 2HCKA 4DBHA 1K9MC 2RJDA 2V8JA 2EQKA 4JLGA 4C0GA 1YCSB 1CKBA 2WSFE 4QW2A 4ZTJA 2EPDA 1WNLA 5KYWA 1WXBA 3OA6A 1ZA2B 3CC4A 2HQXA 3M5AA 3N5BB 5GMKi 1YJ9Q 1ZBXA 2OI3A 3CCLA 3VYGA 4C5GA 1G3YA 3I55A 1WJSA 1VQ7A 4D8KA 3T9NA 3OYDA 2O88A 1B07A 5GJWB 3CXCP 2K57A 2K5FA 4Z02A 1TOVA 2E70A 4E7IA 1GFCA 1WQWA 3MPUB 4C92C 3EH2A 2QDYB 4OB2B 4PK4A 1QKWA 1SF9A 2CP3A 2MPXC 1FYNA 4XTYA 4C0ZA 4XTUA 4NL3A 3V7CA 1WHHA 3M0PA 1G83A 3MEVA 4N0AA 2R5AA 5GAOm 2EYQA 1Q7YC 2LQWA 2M51A 2DETA 3JCMX 4XTVA 4HT8A 1PHTA 1BI1A 3M57A 4LNPA 3QYHB 2A7YA 3FDRA 1NLOC 1YHQT 5KYUA 5J39A 2MAMA 4R56A 4C5HA 2E3HA 2KT8A 3FEOA 2E4HA 1YJ9T 3NPFA 2DO3A 4DBRA 1ZUYA 3D7SB 5GMKh 2ZPFB 3V8LA 2CP7A 3VS7A 3LX7A 2VB6A 2J6KA 3CCET 4DOWA 2RQVA 3SWNA 3QHSA 2BE7D 3CPWS 1VQOQ 2Z0WA 4M75G 1Q82R 1I5OB 2LDMA 3VRYA 1JB0E 4XQ3A 3PE0A 3OS1A 1B3QA 3CPWA 2QGFB 4FM4B 1IZ6A 2L89A 1G3SA 5KYXA 4FCYA 2K3BA 1YJ9A 1N5ZA 5AYFA 3GIBA 3MHXA 2DVEA 1YITQ 3QSUA 1IHWA 4F17A 2RJFA 1EZZB 4RTWA 1M9SA 2JUFA 3GP8A 2M1HA 4EMKB 2FPDA 3WVEB 2LX7A 4E7JA 2GFUA 5KE3A 2G6FX 3O8VA 4M7DF 4BI8B 3CCRQ 4C92G 1Q86R 2JS0A 1WHGA 1D0XA 1UHFA 3OYAA 2VXEA 3HP9A 2O4XA 2VVKA 4DEXA 3CCQQ 1SG5A 1K0SA 3I5RA 4PFOA 2KGTA 2MCNA 2PVOB 2WACA 1YIJT 4J9GA 1OYXA 4FIBA 2DILA 2GFAA 3A8HB 5FRNA 3GLXA 2JVVA 3LW5E 1UGSB 3X20B 3VKIA 3LWIA 1I07A 3EG2A 2W10A 2VASA 1YN8A 2ZPGB 1AOJA 4RMOA 1YITT 3FLGA 1Y57A 1VQOA 2DERA 4J6XA 1G2BA 3VS0A 1IB8A 2KK4A 8ATCB 1W2BP 1JEGA 1YFNA 3PMTA 4ZGEB 2OTLT 2LP5A 2CP2A 3H0IA 1N9RA 2DFUA 3SD4A 4IUQA 1PRMC 1XOVA 2KDSA 4A4GA 1T0JA 4M7AB 4E7HA 1KSWA 4QVDA 2P0QA 1TU0B 1YI2Q 5KYUB 1UTIA 1WHMA 2QG9B 4JJDA 2E5QA 3OYHA 4ELYC 1BI0A 1V29B 2COWA 2LC4A 1QCOA 1GCQA 1JRIA 3C12A 1YITA 1PSEA 4N4GA 3CPFA 4LUEA 2DX1A 4XK8E 3JCMW 1X27A 4JZ3A 1I4K1 3UPUA 2LNVA 3EAEA 1FX7A 4P5NA 1SKUB 5GAN8 1BIBA 4QQ6A 3CCRA 1HYOA 2BKDN 5L23A 1M1KR 1WJRA 2X35A 2E12A 5CVIA 2HZYA 2LCCA 2K2VA 3CCQA 1ZLMA 1VQ9Q 4M75F 3CMEQ 4M78B 4DBQA 2ED0A 4PJOB 1XTDA 2CP5A 2DK3A 1UECA 2CH4W 2V1RA 1LNXA 1NEBA 1WI7A 2KXCA 2XD0A 2CZ0B 1YI2T 2ZGWA 5CKHA 1G3TA 1M8VA 2AT1B 2EVRA 4M77B 3BE3A 3GPLA 2K5IA 4EMHA 1BU1A 4BE2A 5IHKA 1OU8A 4D6WA 3RKXA 1VQ4T 3ZEHA 1D0ZA 1JU5C 4FSSA 3EGUA 1YJNQ 5FW9A 2X4WA 2RI3A 4CC4B 2DRKA 1KC8U 2DL4A 2DL3A 4MMKA 3JAME 2GTJA 4C92F 1YI2A 3TCJA 1X69A 2CT3A 2OAWA 2I0NA 3CD6Q 1QP3A 3FIFA 4LDYA 1KD1C 1ZX6A 2O01E 1ZUKA 3OS0A 5IAYA 3QJ6A 1SEMA 2ED1A 3CPWP 3L2ZA 3L2WA 1VQ4A 2AKKA 2FL7A 3M0QA 1LCKA 1K76A 1N8RU 1RAIB 3E2UA 3JB9H 5GMKj 1U3OA 1B34A 4IIMA 2DL8A 3H6ZA 2OX7A 2JTFA 2F2WA 2VYTA 2YUPA 4OB3B 3META 3AHUA 4M7AE 1M4ZA 5CKBA 4QVCA 1M1GA 1K73C 5GAOq 5A0DA 4OMMA 3CMEA 4JRQA 1C1AA 3NHNA 1YJNT 3WXMB 1NBEB 4D8DA 4JDSA 2PUKB 2QI2A 4RCCA 2ZPEB 4KH0B 2HBPA 2EIFA 2QXFA 3HFNA 1NPPA 3SHWA 1YJWQ 3CCUQ 3R6NA 2L0AA 3G6EQ 3M59A 4EIKA 1OV3A 2ZPBB 1WHJA 3CCST 1RI0A 3S6WA 2RNAA 2RHZA 4IUTA 2F5TX 5GAN7 4LUDA 2EQMA 1QVGS 1T3SA 2MWOA 3KUFA 4QQDA 2QQBA 2Y4YA 1RAEB 1RAAB 4BDZA 2J05A 5GMKm 2KYBA 6AT1B 3EFRA 1VYUA 2EQJA 3JCMV 2XMFA 4M7DC 1YJNA 2JMAA 1VQPT 4CC7A 4B6MA 1LOJA 2RPNA 2JN0A 4N0AC 4M78E 2B8AA 2QK0A 3WVDB 4PJOE 4XU0A 4RTTA 2FB7A 4BD3A 1YP5A 1K8AC 3OYYA 3CCVQ 2VXFA 1QQJA 3CD6A 2EJFA 4OGEA 4Z88A 3CCSA 4KT0E 1I8FA 2BZ8A 2EQIA 3NFCA 4PFZA 4BI4A 4M77E 3J80E 2KNBB 4ZGDB 2EYYA 2HDAA 2DZ9A 1MGQA 1XQHA 2XDPA 4TVRA 2KMTA 1WXTA 4FSXA 3L1AA 2GF7A 3VRZA 1X6BA 3SWNC 4KRTA 2HQEA 3M53A 3M0UA 1IXDA 1H8KA 1OQKA 2VGMA 4FYXB 3OYLA 2DTOA 2PUOB 3RUXA 2RM4A 2K6DA 2D1XA 2DLPA 4M4ZA 1B7TA 1D1AA 5GAN6 4OMQA 5GAOr 2Y4XA 2K4YA 4CC3A 1Q82U 1UDLA 4OVAA 2QTVA 3M4GA 2QDLA 2OJ2A 2GCXA 5LJ3j 4PLIA 3I9QA 1U5SA 4A54A 2Y90A 4FU6A 1YJWA 2EWNA 3PFSA 2DIGA 2FRYA 3CCVT 4GLMA 3G6EA 3QWYA 5CKFA 8AT1B 2RHIA 1S1NA 5FU7C 2HSPA 1VQMQ 5HCKA 2O2OA 2LT4A 4RTXA 1WZOA 2NWMA 2BZXA 4A63B 1UGPB 3VYHB 2FPFA 2ABLA 2VGNA 2HD0A 4C0FA 2ROTA 2RK2A 3OSSC 3REAB 1NG2A 4A4EA 3CCMQ 2FO0A 3PVLA 3UT1A 4DBFA 3A1PA 1ZSZB 4F04B 2VUBA 3URGA 1WYXA 2HSEB 2K9GA 2CS7A 2PZ1A 1HD3A 4BY6B 2D0QB 2LMJA 1Q81R 1UJYA 3HPWA 3CCVA 1JO8A 4M75C 3OW2S 4ELZC 2VC8A 3CCLT 2DIQA 3I55T 1Q86U 2GGRA 3OW2A 2FRWA 2DXBA 1QMCA 4M7AG 3TU4K 2RK1A 9ATCB 2K3YA 3RKYA 4C0DC 1U1TA 4Z89A 2D8JA
chains in the Genus database with same CATH topology
1C6VX 1C1AA 1IHWA 1EX4A 5D7UA 1QMCA 1C0MA 4FW2A 4FW1A 1IHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C6V X;  1C1A A;  1IHW A;  1EX4 A;  5D7U A;  1QMC A;  1C0M A;  4FW2 A;  4FW1 A;  1IHV A; 
#chains in the Genus database with same CATH topology
 2M0O A;  3RES A;  2K5L A;  1M3A A;  3G1J A;  4GY5 A;  1ZUU A;  3M58 A;  2RHY A;  4JRK A;  1TSF A;  1AZE A;  1BYM A;  2X9H A;  2KE9 A;  5DLQ E;  4ESR A;  3RIR A;  3HHT B;  2LJ3 A;  4J83 A;  4F16 A;  1NJI C;  1ABQ A;  3REB B;  2LJ1 A;  1NYF A;  2DBK A;  1X6G A;  2XG8 D;  2RD1 A;  2I2L A;  1M2O A;  5GMK e;  2K3X A;  2O31 A;  3UAT A;  2X4J A;  1OUL A;  1ZSG A;  2AZV A;  5A0G A;  4HCZ A;  2XDB A;  3X26 B;  3M55 A;  2ENM A;  4LD9 K;  2DM1 A;  4C8Q B;  4M78 G;  1QCN A;  4OMP A;  2CP0 A;  4WCI A;  3EG1 A;  4N4H A;  1T0H A;  4DEY A;  2MWP A;  4ME7 A;  1AZG B;  2CSI A;  5FU6 C;  1Q95 G;  1VOM A;  2CSQ A;  4M7A D;  4C5I A;  4M7A A;  3CCM A;  4NOY A;  5I21 A;  3OSV A;  3J81 E;  4OF1 A;  4LDW A;  4L59 A;  1KIK A;  4J7I A;  1E6G A;  2E1H A;  2LJ0 A;  3PT9 A;  2W0Z A;  1X01 A;  2KRN A;  2GNC A;  5D7U A;  4KUI A;  1MNE A;  1J3T A;  2X3W D;  1G5V A;  3CMA Q;  3UF4 A;  1GL5 A;  2XID A;  4PKC C;  2HAX A;  2E6N A;  3OYJ A;  4WF2 A;  4X1V A;  1QVG P;  1KQ1 A;  5KCO A;  1MMA A;  3QXE B;  1M1K U;  1AHJ B;  2C0O A;  1KFZ A;  4N4I A;  1K9A A;  5M9O A;  1W1F A;  5LJ5 g;  2CUB A;  3MO8 A;  3CC7 Q;  3R6O A;  3HTR A;  3EG9 B;  3LGF A;  5KCH A;  1VQK Q;  5DM7 R;  1BCO A;  1IHV A;  4KBM B;  4K11 A;  2NLU A;  1C0M A;  2XU8 A;  3F70 A;  3A8O B;  3JSC A;  4M78 D;  2A08 A;  3A8L B;  4M78 A;  2AZS A;  3OB9 A;  3M56 A;  4PJO D;  5IXB A;  4E7K A;  5GAO p;  4PJO A;  4QVZ A;  1RLQ C;  5IT9 E;  3EH1 A;  1JQQ A;  2C0T A;  1Y96 B;  3JCM c;  5CKE A;  1QVF S;  1EFN A;  4LE9 A;  3DLL A;  3CBO A;  4M77 D;  3L2U A;  3JV3 A;  1GCP A;  3SFM A;  4J8O A;  4M77 A;  1QVF A;  1W6X A;  2O9S A;  1M90 R;  1AWW A;  3CMA T;  2DYB A;  5LJ3 f;  4ANJ A;  1TS9 A;  7AT1 B;  1Z9Q A;  1Y7X A;  4FW2 A;  1VQO T;  3BFM A;  2KXD A;  2DMO A;  1A0N B;  5FRM A;  2EW3 A;  5LJ3 e;  2RHX A;  3CC7 T;  5HY6 A;  4M7A F;  2F1L A;  2E3I A;  3GNG A;  2L2P A;  2EBP A;  3V8K A;  1TUC A;  3RMQ A;  1KQS A;  1PWT A;  3CMA A;  2K7A A;  3RMS A;  1BI2 A;  1M3C A;  2DBM A;  2HL3 A;  2M0Y A;  2EYX A;  1MMG A;  3QII A;  2KRM A;  3OS5 A;  4XU1 A;  4C8Q E;  4J6W A;  4Y28 E;  2LVM A;  3M54 A;  1HXD A;  3S3O A;  3CEY A;  1X2K A;  3CC7 A;  3ASK A;  1N9S A;  1O9S A;  3JCM J;  4RTV A;  1VQK A;  3JCM g;  4F7U B;  2HQH A;  3L42 A;  1FXX A;  4FL6 A;  3JCM Q;  2LQN A;  4E7Z A;  3DB4 A;  3CCR T;  5GAN g;  2D0N A;  2QQ9 A;  5LJ3 h;  3BDL A;  1FWZ A;  4M78 F;  3OW2 P;  3P8H A;  1I1J A;  3OYM A;  5LJ3 d;  3CCQ T;  3FC3 A;  1H3Z A;  2ZZD A;  1ZA1 B;  5KH6 A;  4V2S A;  1UGQ B;  4KGV B;  1K8A R;  1IGQ A;  4HA8 A;  5GAN 5;  2RQW A;  4MML A;  5I22 A;  2A3L A;  3NTK A;  2RJE A;  1KJW A;  4ZTF A;  1IRX A;  4J9H A;  2BIV A;  2L3S A;  3UA7 A;  2JM8 A;  2COY A;  1AWO A;  1M1F A;  3ULR B;  3UA6 A;  4AFQ C;  1NZ9 A;  2B86 A;  5CKD A;  2F69 A;  3OQ5 A;  5IHI A;  4HVU A;  3RDV A;  3TSW A;  1BCM A;  2RF0 A;  4HKE A;  1BK2 A;  1OEB A;  4CRI A;  1TWB A;  3PNW C;  4AFZ C;  3ZL7 C;  2F2V A;  4WTO B;  5DY9 A;  4OMO A;  3CCJ Q;  2RB6 A;  1VA7 A;  3UDC A;  2RQT A;  5I11 A;  2ZPI B;  2IIM A;  1SRL A;  2DXC A;  2CZ1 B;  3CBP A;  5HK0 A;  3VS4 A;  4GLK A;  3RR6 A;  3OMC A;  2LCL A;  4C5E A;  1R77 A;  5CK9 A;  1NEG A;  2EYZ A;  3NTH A;  2FZC B;  2BZY A;  2EKH A;  2YLC A;  3EGD B;  3E9G A;  1TH7 A;  3FRN A;  4XAX B;  5GAM g;  1I5L A;  1Q82 C;  2KRS A;  2DEQ A;  4PJL A;  1FMW A;  4R55 A;  1PC0 A;  2FEI A;  2PNI A;  1KQ2 A;  3S3N A;  1M3B A;  2R57 A;  3ZFJ A;  3QWX X;  5D6Y A;  3FJ5 A;  4JLI A;  3MEW A;  2VV5 A;  3OMG A;  3QKJ A;  1X2Q A;  1PD1 A;  3GF5 A;  2DXT A;  1WFW A;  2NUT B;  1VQ9 T;  3CME T;  1V76 A;  1WGS A;  1U06 A;  1VQN Q;  2EYW A;  4M75 B;  5KYN A;  5DLO A;  3VS1 A;  2CDT A;  2GBQ A;  2M02 A;  5GAO l;  4ZGJ B;  1ZQ1 A;  3HFO A;  2KBT A;  5L8R E;  1RLP C;  1M8M A;  1K9M R;  4EMK C;  2JNG A;  1C6V X;  2DD5 A;  4F7U E;  1BIA A;  1BB9 A;  4LXC A;  4C0D B;  2EAY A;  1Q81 U;  2CH4 A;  1Q86 C;  3NGP A;  1WLP B;  3LH0 A;  2NUP B;  1ZSZ A;  3BDU A;  4M7D E;  1YWO A;  1VQ9 A;  2ECZ A;  2YLB A;  4B9X A;  2OTJ Q;  3QDR B;  2RJC A;  2QYZ A;  1QVF P;  1NJI R;  4CI0 C;  2QQS A;  3CCJ A;  3PVQ A;  1K4U S;  2KRO A;  5IN1 A;  2LT1 A;  3SB2 A;  4JJB A;  4KUD K;  3JCM b;  4PL6 A;  1T3L A;  4C92 B;  3CD6 T;  4GBQ A;  3CQT A;  5I2S A;  1GBR A;  3EGX B;  1FMV A;  3FJP A;  3L2R A;  3OYG A;  4ZN1 A;  4FW1 A;  4LDX A;  2K79 A;  2PVD B;  1OPL A;  4OP0 A;  4KGX B;  2MK5 A;  4BDY A;  5FRO A;  2KI7 A;  1Q7Y R;  1YNZ A;  3DB3 A;  3FB9 A;  2A0F B;  2QA4 Q;  5J3B A;  3GNF B;  1S72 Q;  2CUD A;  1NYG A;  4M7A C;  2HNI A;  1X6O A;  1VQL Q;  2JM9 A;  2KVQ G;  1M2V B;  1FMK A;  2BE9 B;  2DZC A;  4AG1 C;  1VQN A;  2DXU A;  1ACM B;  4Y92 A;  3H8Z A;  3SDZ A;  2KYM A;  2DEU A;  4JPB W;  1RAC B;  2JOY A;  1SHF A;  1TUG B;  4LD6 A;  3VV0 A;  4C8Q D;  4C8Q A;  2LZ6 B;  2NUZ A;  2X4Y A;  2EGA A;  3JCM h;  1QCF A;  1YJW T;  1PRL C;  2H3J A;  3CCU T;  1O75 A;  3G6E T;  2YUO A;  4BI3 A;  1HK9 A;  1N27 A;  1NLP C;  3THK A;  2EQU A;  2YUQ A;  1RI9 A;  3KBG A;  4DQ2 A;  2JW4 A;  2K2M A;  2R58 A;  1I81 A;  3M9Q A;  2OTJ A;  1M30 A;  4JRP A;  1GFD A;  5IXF A;  4LDU A;  4M78 C;  3LLR A;  4F14 A;  1VQ5 Q;  2P4R A;  5D6X A;  4M75 E;  3AT1 B;  3HKS A;  3H0H A;  1ABO A;  1S72 T;  4KH1 B;  2ZPH B;  3CCU A;  1XJW B;  1PCX A;  2DL5 A;  2RMO A;  2CT4 A;  2VKN A;  3QUI A;  2LCS A;  4HT9 A;  4MDW A;  5IHN A;  4ZN3 A;  4DOV A;  4EPC A;  2KT1 A;  2MI6 A;  3X25 B;  5FWB A;  3QG1 A;  3EG9 A;  1VUB A;  2EGC A;  3QZ5 B;  4JJN K;  5GAO n;  1JXM A;  1PNJ A;  3KFV A;  3INZ A;  4LN2 A;  1E6H A;  1JXO A;  1KHI A;  4MDX A;  1RAD B;  2JT4 A;  2LQK A;  2QA4 A;  5FWC A;  4JJC A;  4RCB A;  4X34 A;  3OYI A;  1S72 A;  3RKW A;  4AFU C;  1Y96 A;  1M90 U;  2L3Q A;  3G71 Q;  4IIO A;  2DNU A;  5IH2 A;  2V1Q A;  4RTY A;  1EIF A;  2SEM A;  4F7U G;  2HKQ B;  4C92 E;  1W2B A;  1W70 A;  3VS6 A;  3EFO B;  4MZP A;  1WX6 A;  1UEB A;  3JCM P;  3KXT A;  1RUW A;  2EJ9 A;  2RI5 A;  3QO3 A;  1QP2 A;  1NE8 A;  3C4S A;  5A0L A;  3HRS A;  3MP8 A;  4XU3 A;  3M0T A;  1GBQ A;  1WA7 A;  4BE0 A;  1VQM T;  2JMC A;  4NL2 A;  2KSS A;  1LVK A;  4FT2 A;  4RG2 A;  5CCA A;  2DA9 A;  3I56 Q;  2DD4 A;  4YTL A;  1V1C A;  1UGR B;  1YCY A;  2HEQ A;  4E7L A;  4J9B A;  1Y0M A;  2R5M A;  3NTI A;  1G3W A;  1YHQ Q;  3OS2 A;  3CCM T;  3QZ9 B;  2E64 A;  4LDV A;  4XU2 A;  4PJN A;  3DKM A;  1VQ5 A;  3OYK A;  3X28 B;  3RNJ A;  4A53 A;  2FG0 A;  4Z8A A;  2A36 A;  2L3R A;  1GCQ C;  3CCE Q;  4OML A;  1R0C B;  3G71 T;  2DPP B;  2XDD A;  1VQM A;  5FLX E;  3MKD A;  4PJO G;  4RTZ A;  3TQ7 P;  2AHJ B;  3M4Y A;  5LJ5 j;  3EG0 A;  3HRT A;  5HKC A;  4F7U A;  4NS5 A;  2JJ9 A;  1AVZ C;  3H41 A;  1D09 B;  4M7D D;  4BUG A;  1HJD A;  4IUP A;  1SHG A;  4M7D A;  1ZBJ A;  1K8A U;  1RL2 A;  2ZCF B;  4O5V A;  1PG5 B;  2MF2 A;  2WSC E;  1SSH A;  4M77 G;  2X3X D;  3A8G B;  2D9T A;  2J06 A;  2FZG B;  4E7S A;  1WHL A;  1M27 C;  1WQ7 A;  2QQA A;  3G7Z A;  3I56 T;  1VIF A;  3G71 A;  4JS4 A;  1D3B B;  3VUB A;  1K0X A;  4A4H A;  4EMG A;  2MYS A;  1NM7 A;  1D1B A;  4J9D A;  2JS2 A;  5KYY B;  1QWE A;  3MJX A;  1BKB A;  2O9V A;  3OY9 A;  2YSQ A;  3A98 A;  5CO7 A;  1RAG B;  4PNO A;  4ATO A;  2GQI A;  3I56 A;  4RUG A;  2QQR A;  1WPY A;  3QPH A;  2XHC A;  3MP6 A;  1AEY A;  2E6Z A;  1GXI E;  2HBW A;  1IRE B;  4J7F A;  1YIJ Q;  4PLL A;  4HCK A;  1YHQ A;  3E19 A;  3EG3 A;  2KY9 A;  1KHC A;  5ECA A;  1KD1 R;  2VWF A;  4FT4 A;  2DJZ A;  3PMI A;  5I2M A;  2IVW A;  1KC8 C;  3Q1J A;  4EDU A;  5GMK l;  2HL5 C;  2NYS A;  1G8X A;  2XKO C;  5A2Q E;  1RAH B;  2XIC A;  4Y91 A;  1D1C A;  2IG0 A;  3CCE A;  2COZ A;  1IO6 A;  1MMD A;  3EGD A;  4E6R A;  2C06 A;  3P8D A;  1JBM A;  3PIP A;  2A37 A;  1TTH B;  4F7U F;  4VUB A;  2OTL Q;  4IUU A;  3JRZ A;  1ZHI A;  5GAN 4;  3LH5 A;  1X43 A;  2XK0 A;  1F1B B;  3CC2 Q;  1VQK T;  3OBW A;  5KE2 A;  1AWJ A;  2RI2 A;  2AK5 A;  2LRQ A;  1KQS S;  2RO0 A;  5GAN j;  1N8R C;  1KK7 A;  1K73 R;  2NUT A;  1ZSZ C;  5KYW B;  2J6F A;  4L6V 5;  4J6Y A;  4B9W A;  4FYW B;  4AG2 C;  5C0M A;  4M75 D;  1QW1 A;  1TXQ A;  1OZ2 A;  2AKL A;  1K9M U;  4M75 A;  2M16 A;  4BY6 C;  1Q81 C;  1MMN A;  2PTK A;  3M0S A;  2KR3 A;  1IGU A;  1SSF A;  3ME9 A;  2EGE A;  4A4K A;  4DA4 A;  4MZT A;  4KGZ B;  4J9E A;  3QYG B;  1MND A;  2QGG A;  2E65 A;  1M5Q 1;  2DTI A;  3H9N A;  4HCB A;  4A4F A;  1ARK A;  4L5G A;  1NJI U;  1OPK A;  2YXY A;  2NUP A;  3LWH A;  3MP1 A;  3PTA A;  2KAF A;  1P92 A;  4M7D B;  2CP6 A;  1KG1 A;  1PSF A;  3JB9 I;  1UFF A;  2FVU A;  4RG8 A;  2SRC A;  1MHN A;  4PJO F;  2XI9 A;  2A28 A;  4JZ4 A;  3C0C A;  3TEE A;  2L3P A;  1YIJ A;  1NPR A;  2E41 A;  3LYI A;  2LTO A;  2YT6 A;  3EFS A;  4O6J A;  1WDX A;  3CC2 T;  5HK3 A;  4C92 D;  2J6O A;  1BI3 A;  4J9I A;  1MV3 A;  1TG0 A;  4C92 A;  4PJM A;  2P0P A;  5CIU A;  2E10 A;  3C94 A;  3U23 A;  4M77 F;  3EGX A;  1Q7Y U;  1H3H A;  1VQ6 Q;  2YDL A;  5GAN 2;  2ATC B;  3A8M B;  5EG2 A;  1VQ4 Q;  3VJP A;  4J9F A;  4C8Q C;  1QKX A;  2G3R A;  3OYE A;  3SWN B;  3PIO A;  5GAM j;  1XNI A;  2OTL A;  2JTE A;  5GAN 3;  4IUV A;  5LL6 S;  3VUZ A;  2GTO A;  2V26 A;  3ZBD A;  3HRU A;  3CC2 A;  5LJ5 f;  2YRD A;  3QBY A;  2ZAE A;  1VQ8 Q;  2P0K A;  1M2V A;  1E7O A;  5KYX B;  4HCC A;  2J7I A;  2D6F A;  5LJ5 e;  1TUD A;  4PJJ A;  1Y07 A;  1GRI A;  1LPL A;  1OX9 A;  2CYZ B;  4AFS C;  2BUD A;  2IPO B;  3QJY A;  3V7R A;  2HMA A;  3OYN A;  1W4S A;  2EFI A;  4HXJ A;  2BTT A;  5FU7 B;  3L2Q A;  1R0B G;  2YRC A;  3RER A;  3MEU A;  3JB9 J;  3ER0 A;  1JJ2 S;  4E47 A;  1SPK A;  1H92 A;  1VQ6 T;  2P4T A;  1AD5 A;  4ORZ A;  3P8B B;  4QKU A;  2ROL A;  4AMC A;  2RQU A;  1VYT A;  1JJ2 A;  1WHK A;  2X51 A;  2MIO A;  1K1Z A;  4J5Y A;  3HL8 A;  4JUV A;  3E1S A;  2O4X B;  1OOT A;  2DVJ A;  1N6A A;  3VS5 A;  5LJ5 h;  2C0I A;  3CCJ T;  2CKK A;  2WSE E;  2RQR A;  2FHD A;  2H8H A;  3VS3 A;  1DJ7 B;  4ZNX A;  5LJ5 d;  2QEX Q;  2MMP A;  1VQ8 T;  1X75 C;  4IKF A;  3JB9 G;  3LGL A;  3CCS Q;  2CGH A;  1VQ6 A;  3OYC A;  4QT7 A;  1D0Y A;  2DAQ A;  5CAI A;  1M90 C;  3CXC S;  2CRE A;  2LNH B;  2AIR B;  4OB1 B;  3BW1 A;  3EHR A;  4OMF B;  2JZ2 A;  2M9U A;  5EC7 A;  3CXC A;  3L2V A;  1VQP Q;  4BB7 A;  2HKN A;  3E9F A;  4BAC A;  3OBY A;  1VIE A;  1SRM A;  3G4S Q;  1QWF A;  4C8Q G;  3J7A F;  2H3E B;  2YWW A;  1MV0 B;  2V8K A;  3JCM f;  3GBQ A;  4JRI A;  1VQ8 A;  4BE1 A;  1OI1 A;  3DLM A;  5GAN f;  1OX8 A;  2DKG A;  2F2X A;  4JS5 A;  3EFO A;  2L8D A;  2V8I A;  2OAU A;  3JCM e;  4RKU E;  1VQN T;  5AT1 B;  3SEM A;  3IQL A;  2QTX A;  5GAN e;  2D8H A;  4HVV A;  1UJ0 A;  2QAZ A;  3H0F A;  1YWP A;  1PD0 A;  2MOX A;  2DYI A;  2EKO A;  3C95 A;  2QEX T;  2PQW A;  1KQS P;  3JB9 D;  5FU6 B;  1OZ3 A;  2CZ6 B;  1U1S A;  4X9D A;  2LQ8 A;  2GQV A;  2KQW A;  3TSZ A;  1VYV A;  2LX9 A;  4OB0 B;  1QVG A;  3V8J A;  1MUZ A;  2RA2 A;  4CC2 A;  2PVG B;  2DE0 X;  1QLY A;  2OTJ T;  2DF6 A;  3EHQ A;  1WXU A;  2X4X A;  3MCA B;  4AT1 B;  4XTX A;  2KEA A;  4XTZ A;  3A5Z B;  3M0R A;  3G4S T;  2EJG A;  1U8R A;  4E2F B;  1UGV A;  1PM3 A;  2JXB A;  2QEX A;  3VU3 C;  1BBZ A;  2FPE A;  1UHC A;  4OGC A;  5GAN h;  3JCM d;  3UWN A;  4II1 A;  1WJQ A;  3HSB A;  3OYF A;  3S3M A;  5GAN d;  1M1K C;  2YHT A;  1VQP A;  3TVT A;  4KUL A;  5C6S A;  2JTM A;  2PU9 B;  4HVW A;  3X24 B;  3G4S A;  5GAM f;  3CC4 Q;  1UB4 A;  1RAF B;  3RBB B;  3TRE A;  4J9C A;  1D3B A;  4PJO C;  2DTH A;  3QDF A;  5CR2 A;  2QA4 T;  4IUR A;  3CCL Q;  4PFP A;  1H64 1;  3I55 Q;  2CZ7 B;  2P84 A;  1VQ7 Q;  2DJQ A;  1UG1 A;  5CQY A;  5D6W A;  5GAM e;  1VQL T;  5J26 A;  1HSQ A;  1R8O B;  1KC8 R;  1CKA A;  5KYY A;  2FYK A;  4M77 C;  1CSK A;  1Y71 A;  3BY7 A;  4FYY B;  3V7S A;  4R0K A;  3CBM A;  1PKT A;  3GOX A;  2YUN A;  3I5S A;  1AWX A;  3JB9 F;  1KD1 U;  5GJV B;  4OMN A;  2QAS A;  2ESW A;  2YRV A;  1B34 B;  1YBY A;  2L5Q A;  3I35 A;  1W2B S;  1OU9 A;  2F5K A;  4UC4 A;  1VQL A;  1N8R R;  1LJO A;  4FYV B;  1PKS A;  1WIE A;  4X9C A;  1QVP A;  1UE9 A;  4Q5W A;  2FZK B;  2RHU A;  3PGG A;  3O5Z A;  3CC4 T;  4XTW A;  2E5K A;  4M7D G;  2DRM A;  1VQ5 T;  5GAM h;  5LJ3 g;  1I0C A;  4C8Q F;  1EX4 A;  3NMZ C;  4RTU A;  1AT1 B;  2DL7 A;  1JJ2 P;  5GAM d;  1VQ7 T;  3VS2 A;  3MEA A;  5CQX A;  1UUE A;  4EMK A;  4MZM A;  2RH2 A;  1K73 U;  3OYB A;  2RN8 A;  1Z9Z A;  4QQG A;  1RAB B;  2HCK A;  4DBH A;  1K9M C;  2RJD A;  2V8J A;  2EQK A;  4JLG A;  4C0G A;  1YCS B;  1CKB A;  2WSF E;  4QW2 A;  4ZTJ A;  2EPD A;  1WNL A;  5KYW A;  1WXB A;  3OA6 A;  1ZA2 B;  3CC4 A;  2HQX A;  3M5A A;  3N5B B;  5GMK i;  1YJ9 Q;  1ZBX A;  2OI3 A;  3CCL A;  3VYG A;  4C5G A;  1G3Y A;  3I55 A;  1WJS A;  1VQ7 A;  4D8K A;  3T9N A;  3OYD A;  2O88 A;  1B07 A;  5GJW B;  3CXC P;  2K57 A;  2K5F A;  4Z02 A;  1TOV A;  2E70 A;  4E7I A;  1GFC A;  1WQW A;  3MPU B;  4C92 C;  3EH2 A;  2QDY B;  4OB2 B;  4PK4 A;  1QKW A;  1SF9 A;  2CP3 A;  2MPX C;  1FYN A;  4XTY A;  4C0Z A;  4XTU A;  4NL3 A;  3V7C A;  1WHH A;  3M0P A;  1G83 A;  3MEV A;  4N0A A;  2R5A A;  5GAO m;  2EYQ A;  1Q7Y C;  2LQW A;  2M51 A;  2DET A;  3JCM X;  4XTV A;  4HT8 A;  1PHT A;  1BI1 A;  3M57 A;  4LNP A;  3QYH B;  2A7Y A;  3FDR A;  1NLO C;  1YHQ T;  5KYU A;  5J39 A;  2MAM A;  4R56 A;  4C5H A;  2E3H A;  2KT8 A;  3FEO A;  2E4H A;  1YJ9 T;  3NPF A;  2DO3 A;  4DBR A;  1ZUY A;  3D7S B;  5GMK h;  2ZPF B;  3V8L A;  2CP7 A;  3VS7 A;  3LX7 A;  2VB6 A;  2J6K A;  3CCE T;  4DOW A;  2RQV A;  3SWN A;  3QHS A;  2BE7 D;  3CPW S;  1VQO Q;  2Z0W A;  4M75 G;  1Q82 R;  1I5O B;  2LDM A;  3VRY A;  1JB0 E;  4XQ3 A;  3PE0 A;  3OS1 A;  1B3Q A;  3CPW A;  2QGF B;  4FM4 B;  1IZ6 A;  2L89 A;  1G3S A;  5KYX A;  4FCY A;  2K3B A;  1YJ9 A;  1N5Z A;  5AYF A;  3GIB A;  3MHX A;  2DVE A;  1YIT Q;  3QSU A;  1IHW A;  4F17 A;  2RJF A;  1EZZ B;  4RTW A;  1M9S A;  2JUF A;  3GP8 A;  2M1H A;  4EMK B;  2FPD A;  3WVE B;  2LX7 A;  4E7J A;  2GFU A;  5KE3 A;  2G6F X;  3O8V A;  4M7D F;  4BI8 B;  3CCR Q;  4C92 G;  1Q86 R;  2JS0 A;  1WHG A;  1D0X A;  1UHF A;  3OYA A;  2VXE A;  3HP9 A;  2O4X A;  2VVK A;  4DEX A;  3CCQ Q;  1SG5 A;  1K0S A;  3I5R A;  4PFO A;  2KGT A;  2MCN A;  2PVO B;  2WAC A;  1YIJ T;  4J9G A;  1OYX A;  4FIB A;  2DIL A;  2GFA A;  3A8H B;  5FRN A;  3GLX A;  2JVV A;  3LW5 E;  1UGS B;  3X20 B;  3VKI A;  3LWI A;  1I07 A;  3EG2 A;  2W10 A;  2VAS A;  1YN8 A;  2ZPG B;  1AOJ A;  4RMO A;  1YIT T;  3FLG A;  1Y57 A;  1VQO A;  2DER A;  4J6X A;  1G2B A;  3VS0 A;  1IB8 A;  2KK4 A;  8ATC B;  1W2B P;  1JEG A;  1YFN A;  3PMT A;  4ZGE B;  2OTL T;  2LP5 A;  2CP2 A;  3H0I A;  1N9R A;  2DFU A;  3SD4 A;  4IUQ A;  1PRM C;  1XOV A;  2KDS A;  4A4G A;  1T0J A;  4M7A B;  4E7H A;  1KSW A;  4QVD A;  2P0Q A;  1TU0 B;  1YI2 Q;  5KYU B;  1UTI A;  1WHM A;  2QG9 B;  4JJD A;  2E5Q A;  3OYH A;  4ELY C;  1BI0 A;  1V29 B;  2COW A;  2LC4 A;  1QCO A;  1GCQ A;  1JRI A;  3C12 A;  1YIT A;  1PSE A;  4N4G A;  3CPF A;  4LUE A;  2DX1 A;  4XK8 E;  3JCM W;  1X27 A;  4JZ3 A;  1I4K 1;  3UPU A;  2LNV A;  3EAE A;  1FX7 A;  4P5N A;  1SKU B;  5GAN 8;  1BIB A;  4QQ6 A;  3CCR A;  1HYO A;  2BKD N;  5L23 A;  1M1K R;  1WJR A;  2X35 A;  2E12 A;  5CVI A;  2HZY A;  2LCC A;  2K2V A;  3CCQ A;  1ZLM A;  1VQ9 Q;  4M75 F;  3CME Q;  4M78 B;  4DBQ A;  2ED0 A;  4PJO B;  1XTD A;  2CP5 A;  2DK3 A;  1UEC A;  2CH4 W;  2V1R A;  1LNX A;  1NEB A;  1WI7 A;  2KXC A;  2XD0 A;  2CZ0 B;  1YI2 T;  2ZGW A;  5CKH A;  1G3T A;  1M8V A;  2AT1 B;  2EVR A;  4M77 B;  3BE3 A;  3GPL A;  2K5I A;  4EMH A;  1BU1 A;  4BE2 A;  5IHK A;  1OU8 A;  4D6W A;  3RKX A;  1VQ4 T;  3ZEH A;  1D0Z A;  1JU5 C;  4FSS A;  3EGU A;  1YJN Q;  5FW9 A;  2X4W A;  2RI3 A;  4CC4 B;  2DRK A;  1KC8 U;  2DL4 A;  2DL3 A;  4MMK A;  3JAM E;  2GTJ A;  4C92 F;  1YI2 A;  3TCJ A;  1X69 A;  2CT3 A;  2OAW A;  2I0N A;  3CD6 Q;  1QP3 A;  3FIF A;  4LDY A;  1KD1 C;  1ZX6 A;  2O01 E;  1ZUK A;  3OS0 A;  5IAY A;  3QJ6 A;  1SEM A;  2ED1 A;  3CPW P;  3L2Z A;  3L2W A;  1VQ4 A;  2AKK A;  2FL7 A;  3M0Q A;  1LCK A;  1K76 A;  1N8R U;  1RAI B;  3E2U A;  3JB9 H;  5GMK j;  1U3O A;  1B34 A;  4IIM A;  2DL8 A;  3H6Z A;  2OX7 A;  2JTF A;  2F2W A;  2VYT A;  2YUP A;  4OB3 B;  3MET A;  3AHU A;  4M7A E;  1M4Z A;  5CKB A;  4QVC A;  1M1G A;  1K73 C;  5GAO q;  5A0D A;  4OMM A;  3CME A;  4JRQ A;  1C1A A;  3NHN A;  1YJN T;  3WXM B;  1NBE B;  4D8D A;  4JDS A;  2PUK B;  2QI2 A;  4RCC A;  2ZPE B;  4KH0 B;  2HBP A;  2EIF A;  2QXF A;  3HFN A;  1NPP A;  3SHW A;  1YJW Q;  3CCU Q;  3R6N A;  2L0A A;  3G6E Q;  3M59 A;  4EIK A;  1OV3 A;  2ZPB B;  1WHJ A;  3CCS T;  1RI0 A;  3S6W A;  2RNA A;  2RHZ A;  4IUT A;  2F5T X;  5GAN 7;  4LUD A;  2EQM A;  1QVG S;  1T3S A;  2MWO A;  3KUF A;  4QQD A;  2QQB A;  2Y4Y A;  1RAE B;  1RAA B;  4BDZ A;  2J05 A;  5GMK m;  2KYB A;  6AT1 B;  3EFR A;  1VYU A;  2EQJ A;  3JCM V;  2XMF A;  4M7D C;  1YJN A;  2JMA A;  1VQP T;  4CC7 A;  4B6M A;  1LOJ A;  2RPN A;  2JN0 A;  4N0A C;  4M78 E;  2B8A A;  2QK0 A;  3WVD B;  4PJO E;  4XU0 A;  4RTT A;  2FB7 A;  4BD3 A;  1YP5 A;  1K8A C;  3OYY A;  3CCV Q;  2VXF A;  1QQJ A;  3CD6 A;  2EJF A;  4OGE A;  4Z88 A;  3CCS A;  4KT0 E;  1I8F A;  2BZ8 A;  2EQI A;  3NFC A;  4PFZ A;  4BI4 A;  4M77 E;  3J80 E;  2KNB B;  4ZGD B;  2EYY A;  2HDA A;  2DZ9 A;  1MGQ A;  1XQH A;  2XDP A;  4TVR A;  2KMT A;  1WXT A;  4FSX A;  3L1A A;  2GF7 A;  3VRZ A;  1X6B A;  3SWN C;  4KRT A;  2HQE A;  3M53 A;  3M0U A;  1IXD A;  1H8K A;  1OQK A;  2VGM A;  4FYX B;  3OYL A;  2DTO A;  2PUO B;  3RUX A;  2RM4 A;  2K6D A;  2D1X A;  2DLP A;  4M4Z A;  1B7T A;  1D1A A;  5GAN 6;  4OMQ A;  5GAO r;  2Y4X A;  2K4Y A;  4CC3 A;  1Q82 U;  1UDL A;  4OVA A;  2QTV A;  3M4G A;  2QDL A;  2OJ2 A;  2GCX A;  5LJ3 j;  4PLI A;  3I9Q A;  1U5S A;  4A54 A;  2Y90 A;  4FU6 A;  1YJW A;  2EWN A;  3PFS A;  2DIG A;  2FRY A;  3CCV T;  4GLM A;  3G6E A;  3QWY A;  5CKF A;  8AT1 B;  2RHI A;  1S1N A;  5FU7 C;  2HSP A;  1VQM Q;  5HCK A;  2O2O A;  2LT4 A;  4RTX A;  1WZO A;  2NWM A;  2BZX A;  4A63 B;  1UGP B;  3VYH B;  2FPF A;  2ABL A;  2VGN A;  2HD0 A;  4C0F A;  2ROT A;  2RK2 A;  3OSS C;  3REA B;  1NG2 A;  4A4E A;  3CCM Q;  2FO0 A;  3PVL A;  3UT1 A;  4DBF A;  3A1P A;  1ZSZ B;  4F04 B;  2VUB A;  3URG A;  1WYX A;  2HSE B;  2K9G A;  2CS7 A;  2PZ1 A;  1HD3 A;  4BY6 B;  2D0Q B;  2LMJ A;  1Q81 R;  1UJY A;  3HPW A;  3CCV A;  1JO8 A;  4M75 C;  3OW2 S;  4ELZ C;  2VC8 A;  3CCL T;  2DIQ A;  3I55 T;  1Q86 U;  2GGR A;  3OW2 A;  2FRW A;  2DXB A;  1QMC A;  4M7A G;  3TU4 K;  2RK1 A;  9ATC B;  2K3Y A;  3RKY A;  4C0D C;  1U1T A;  4Z89 A;  2D8J A; 
#chains in the Genus database with same CATH homology
 1C6V X;  1C1A A;  1IHW A;  1EX4 A;  5D7U A;  1QMC A;  1C0M A;  4FW2 A;  4FW1 A;  1IHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...