1IHVA

Solution structure of the dna binding domain of hiv-1 integrase, nmr, minimized average structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
52
structure length
52
Chain Sequence
MIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the DNA binding domain of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna binding protein
molecule keywords HIV-1 INTEGRASE
total genus 5
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1ihvA00
1IHVA 4FW2A 1C6VX 1EX4A 4FW1A 1QMCA 1IHWA 5D7UA 1C0MA 1C1AA
chains in the Genus database with same CATH superfamily
1AVZC 3OS2A 1D3BA 3JB9I 1TXQA 2GFUA 1C6VX 4AT1B 2VUBA 5FW9A 1BCOA 4RTUA 3FEOA 2FPEA 3CBOA 1X01A 3RKWA 2DO3A 2DXBA 3X24B 1WXUA 4M75G 3MCAB 3JCMf 3J7AF 2RMOA 2HQXA 4PJOD 3KUFA 1Q81R 1Y0MA 3OYIA 2JJ9A 2E64A 4BDZA 1NYGA 2RK2A 3EH1A 4C0FA 1QP2A 2P84A 5HKCA 2DK3A 5LJ3e 2RA2A 5LJ5j 2PUKB 4ELYC 2M51A 1NEBA 4IUQA 2RQVA 1B7TA 4D8DA 2K2MA 2YUPA 2M1HA 3REBB 2LP5A 3SWNB 2ZPFB 4JZ4A 2BE9B 4EPCA 5IT9E 2LCLA 3HFNA 5GAOn 3M54A 4C0DB 4M7AF 3CCLQ 1Q82R 4A63B 1KQ2A 2J06A 2QGFB 2KT1A 2YUOA 2GQIA 1NZ9A 1M90U 1G5VA 2VKNA 4OMLA 1MNDA 1BBZA 2FG0A 2MF2A 3JCMP 3CCVT 1KQSS 2KYMA 3L1AA 1YJWQ 1E6HA 1Z9QA 4XTYA 3X25B 4JDSA 1V29B 2LDMA 1UG1A 3PMTA 1RABB 2L5QA 2MI6A 1M1GA 1GCQC 2EQJA 3CCQT 2RHIA 3I9QA 4RTZA 1E7OA 1VIFA 4C0GA 4M7AA 2M16A 2JMAA 2SEMA 4N0AA 4A53A 2CUBA 3C12A 4MDWA 4X34A 2D8HA 3N5BB 2CT4A 3OYEA 1K73C 3QZ9B 1NM7A 4K11A 1U3OA 1VQ4T 2DA9A 2QAZA 3CC4Q 3CC7A 2ROLA 2EVRA 3A5ZB 1QLYA 3VS3A 1OV3A 3M4YA 2JVVA 3L2WA 2D8JA 2KGTA 1KD1U 1N9RA 2CZ6B 3NPFA 3S3MA 4RUGA 1XNIA 2RH2A 2HL5C 3NHNA 2LTOA 4MDXA 2JM9A 2JMCA 1UB4A 1ZSZB 5CVIA 2FRWA 1RI9A 4RG2A 1QWFA 2ED1A 2X35A 1LCKA 4C8QE 3CD6A 1N27A 2DMOA 1NYFA 5HCKA 4HCZA 2F2WA 3CCRT 4J9CA 1IGQA 3RKYA 2ED0A 2BIVA 2OJ2A 1YCYA 3MP8A 1TSFA 1KQSP 3THKA 4QT7A 1YJNA 4II1A 4J9EA 2WSFE 3L2RA 1VQ5A 1N5ZA 5C0MA 2KMTA 1KD1R 4M75E 1IGUA 3MJXA 2DAQA 3SFMA 2EIFA 2M0YA 4DBFA 1JB0E 2OTJA 4IKFA 1VQNQ 1OYXA 2LQNA 4M4ZA 2DE0X 1PC0A 3PT9A 3L2UA 1N9SA 4ATOA 1H3ZA 5LJ3f 1N8RR 3M0TA 2V26A 4WCIA 3JCMg 1MMDA 1M90C 1X2KA 3CCMQ 1OU9A 2CGHA 2JM8A 4J9DA 3QJ6A 4M75F 2KAFA 4CI0C 3EG2A 2DTHA 4FL6A 1T3SA 1IB8A 4ESRA 2E3HA 3A8LB 2V8JA 5GAN2 5CKFA 3CMAT 1QCNA 2DVJA 5CR2A 2DPPB 3SB2A 2YSQA 5LJ5e 1ZLMA 1UEBA 2OTLA 1OX9A 2VVKA 1ZBXA 2YDLA 2EQIA 3J80E 3I56T 1OULA 2ZPIB 1VQ9T 2J6OA 4XTXA 3U23A 1YJWT 1K73U 2KR3A 3A8HB 4M75A 1PM3A 2DXUA 3GNFB 3NTIA 2QDYB 3MP1A 4M75C 1JXOA 5GANg 1UGPB 1M3BA 2EYWA 3I55T 1I5OB 3CCUA 2VWFA 1K8AU 4XU2A 1VQKT 1J3TA 2XKOC 3P8DA 4JUVA 3G6EA 4LE9A 5GJVB 2DEUA 3LGFA 1Q86C 4RMOA 1WXTA 1GXIE 3MKDA 4HT9A 4X9DA 1LJOA 4E7HA 3E9FA 3GBQA 1WHJA 1R0CB 4LDWA 3GOXA 2CKKA 5KYUA 1NE8A 4KGZB 1TH7A 2ATCB 3ZFJA 1RLPC 1YITQ 1UGRB 1HYOA 3R6NA 1UHCA 2BUDA 3H0HA 3REAB 3VS2A 2NYSA 1X6BA 4HXJA 5GJWB 1OX8A 1SF9A 4BD3A 1MUZA 3RKXA 3JCMV 4KRTA 1SHGA 4YTLA 3FDRA 1BIAA 2L3RA 4XQ3A 1D1CA 5GAOm 3JCMd 2VASA 2K5FA 3Q1JA 5GMKi 4A54A 3I55A 1YJ9T 1VQ7T 2HL3A 5J39A 2E41A 3CCUT 1FWZA 1FXXA 5L23A 1IXDA 2J6KA 5KYWB 2P0QA 1B34B 1S1NA 4FYVB 1EZZB 1ZX6A 1WJQA 3A8MB 1YP5A 3A8OB 3VS1A 5GMKm 1W6XA 5GMKh 1TG0A 5D7UA 1W2BA 3GIBA 2PUOB 2FZGB 2HCKA 1BYMA 2FO0A 3HRTA 3S6WA 2CP6A 1VQKA 4MZTA 4C8QA 1PSFA 2DEQA 4FT2A 2DTOA 1T3LA 3UDCA 2RHYA 1W4SA 1VQ8A 5HK0A 1QP3A 2FEIA 4PJOG 2QGGA 5FROA 2GFAA 4JJDA 1GCQA 2RB6A 1FMVA 4LDUA 2GQVA 1KSWA 3NTHA 2DFUA 5FU6B 3GP8A 5KCOA 4MZPA 1ABOA 1CKAA 1QVFA 3O5ZA 5LJ5d 1YJ9A 1YIJA 4QVDA 2HBWA 2LQ8A 1K8AC 4P5NA 4LDXA 3AHUA 1HJDA 3ZL7C 1Y7XA 1VQ6T 5DLQE 2QQ9A 3EG3A 2LX9A 2QQRA 2RI5A 1PWTA 3JCMJ 1D3BB 1QMCA 2D0QB 2EQUA 2JN0A 2CP0A 1AWOA 2X3WD 1M1KC 3LGLA 4ZNXA 4FYXB 2M9UA 2OI3A 4J83A 4PFOA 2EPDA 1VYTA 1WNLA 2O9VA 4OMMA 5FU7C 2RM4A 3G4ST 3RDVA 2E4HA 2KRMA 4QKUA 2YLCA 4KUDK 1IRXA 2VB6A 4E7JA 4N4GA 2X3XD 1K73R 2D9TA 1Q82C 2A7YA 3QG1A 2AIRB 1WHGA 3QUIA 3SDZA 3M55A 3PTAA 3VU3C 3CCVQ 3M4GA 1I0CA 3M0SA 1PCXA 2F1LA 3QDRB 2KNBB 1I1JA 2A37A 4RG8A 2GTOA 3EAEA 1VQ9A 1U5SA 2CT3A 1UTIA 2QG9B 4RTTA 5D6YA 1YJWA 2HNIA 3UWNA 2C0TA 5HK3A 1OI1A 4BE1A 3MHXA 4EDUA 2P0KA 3OMGA 2B8AA 1B3QA 4PJMA 3CXCP 1YIJT 3ASKA 3VS7A 2L2PA 4PJLA 1CSKA 3CC2A 4OMOA 1VQLT 1PRMC 3I5SA 2EGCA 1YITT 2RHZA 1I4K1 4OF1A 2RQRA 3GF5A 2ZPHB 4FM4B 4M77E 1M8VA 1M30A 2DIGA 3OYBA 2E6ZA 2NUZA 2EFIA 1VQ6A 1VQ4A 1VYUA 1RI0A 2QA4Q 3CPWA 1VQPA 2EJFA 1C0MA 1OZ3A 5IXFA 1YHQT 2Y4YA 4JLGA 2FVUA 4Y92A 3RR6A 2AK5A 2P4TA 3CMEA 2XU8A 1VQ4Q 4KUIA 1UDLA 3E9GA 2YUQA 4Q5WA 2BZYA 4J7IA 3MP6A 2KQWA 3OYGA 2RHUA 1H92A 5IHIA 2AKLA 3EHRA 3JB9G 1K8AR 3CPFA 1PRLC 2QA4A 2V1RA 2CP3A 5GAMd 4BB7A 2WSEE 4M7DD 3JB9D 4J9FA 1VQ7A 3TQ7P 3H6ZA 4NL2A 3I35A 1UUEA 3BDUA 4A4HA 1FYNA 2FPFA 3CEYA 3CCST 3RMSA 1K9AA 2DM1A 5IH2A 2GBQA 1M27C 1X2QA 1W70A 3QYHB 1M4ZA 2K5IA 2NUTB 3OSSC 1BU1A 5LL6S 5GMKl 5CQXA 3M58A 1I81A 4PNOA 1VQPT 5GANh 3VUZA 2EAYA 1M1FA 2L8DA 4XK8E 3O8VA 3FLGA 1EIFA 4OP0A 1VQ6Q 2LNHB 1MHNA 3SEMA 1AOJA 4M78E 1V76A 3LH5A 4OGCA 1YHQQ 2OAWA 2I0NA 2RO0A 3SWNA 1IHWA 2WACA 4R0KA 2GTJA 1M2VA 3RIRA 1ACMB 1XTDA 2E70A 4M7AB 4Y28E 5M9OA 2KYBA 3EGDB 2BZ8A 2PNIA 5GANf 3JCMX 4V2SA 4Z88A 3H8ZA 2VV5A 3MEAA 1M1KR 2XK0A 1JJ2P 3CCLA 1U06A 3OS1A 2SRCA 2AHJB 1AWXA 2HKQB 5I21A 1FX7A 1NEGA 1WFWA 4KH1B 3JRZA 1NJIC 3AT1B 4OVAA 2CS7A 4HVUA 3I55Q 2BZXA 1E6GA 4AFUC 2CH4A 5GMKe 2JS0A 3H0FA 2KI7A 5A0LA 2GNCA 2DL4A 3CCSA 1KC8U 2XMFA 1AZGB 1D1AA 1WA7A 2MOXA 2DKGA 4BDYA 2JTEA 1KK7A 2QEXA 5I2MA 1Q86R 4C8QB 1UGQB 2ESWA 4OMNA 2HAXA 3FIFA 2NUPA 1VYVA 4JJCA 2B86A 5GAN8 1EX4A 4D6WA 2K5LA 1G83A 4M75D 3CCEA 2DXTA 1PKTA 5LJ3d 3S3OA 3SD4A 2O2OA 1VQMA 2YT6A 2PZ1A 3CMAQ 1T0HA 2ECZA 2OTLQ 4M78A 1R77A 1OQKA 3VUBA 4OB2B 4EMGA 2L3QA 5KYUB 3OMCA 1X27A 2KXCA 2CP7A 4PK4A 3CXCA 1WDXA 4FIBA 2KY9A 4PFPA 4AMCA 3META 4B6MA 2DJQA 2CP2A 1VQOQ 3NFCA 2XDBA 1N6AA 1U1TA 3BY7A 4HCBA 2XDDA 2CSQA 2DZ9A 2JW4A 4LDVA 3OYFA 3CC2T 1Z9ZA 2CZ7B 2RQUA 1B34A 3G6EQ 2QI2A 4IIOA 4PFZA 3OYMA 1RAAB 2RQTA 1QVGS 5GAMg 3E19A 5LJ3g 3CCUQ 3JV3A 1KQSA 5GAOr 5IHNA 1X43A 1WHKA 3S3NA 3VS5A 2J6FA 4M77B 3PMIA 1FMWA 2K4YA 2VGMA 3OW2A 4C5EA 3OYDA 2HEQA 2IIMA 1YI2Q 2VGNA 2DBKA 5GAOl 4IUPA 3M0QA 2HD0A 1BI1A 5CK9A 1K9MC 3SWNC 4RTYA 3EHQA 3CCSQ 2CDTA 2CREA 3JCMe 1KHCA 2Z0WA 5D6XA 2FZCB 1AWJA 4M78D 1X6GA 2O88A 4RCCA 2ZPEB 3D7SB 4M7DC 2DX1A 1VQ8Q 1HXDA 2E3IA 2DBMA 3JAME 2RPNA 1Y07A 1Q81U 3H41A 4WTOB 1YJ9Q 3TVTA 2E5QA 1ZHIA 1NJIU 4EMKC 2D0NA 5CAIA 3JCMh 3X26B 3TCJA 4BE2A 3HRUA 1KC8C 3T9NA 2LJ0A 3INZA 3CCJQ 1K4US 4XTZA 2F5TX 1GBRA 4BE0A 2J7IA 3F70A 2HKNA 4J9HA 4XU3A 4QQ6A 2DF6A 3V8KA 2LC4A 4E7LA 4A4EA 2LT4A 4HT8A 1D0YA 4VUBA 1K76A 4M7DE 2A36A 2DVEA 3A1PA 2LCSA 2ABLA 3OY9A 3OYAA 1K0SA 2LX7A 4ZGJB 3HP9A 2K6DA 4M7DB 3G71A 2KRSA 1OU8A 1I07A 1M5Q1 4ZN1A 5AYFA 3OYNA 3BDLA 4M7DF 1GFCA 4M7AD 3M57A 3QKJA 3CD6T 2XD0A 3CCJT 4J5YA 2E65A 1Y57A 5A0DA 2JNGA 2C0OA 3OS5A 1W1FA 2J05A 2O31A 2RD1A 3VRYA 2MK5A 2MWOA 4M77G 1YN8A 3QPHA 2YUNA 2QK0A 2JS2A 3BE3A 4UC4A 5HY6A 1VQ9Q 2ZGWA 4FW1A 4XTWA 1TOVA 3ULRB 1SG5A 2KRNA 3I56Q 2K3BA 3QIIA 3IQLA 4J9GA 4CRIA 5LJ3j 2BE7D 3OW2P 4PJOB 4KT0E 4C8QC 3RUXA 1VUBA 2DZCA 1Q7YR 2VYTA 4ORZA 2IVWA 2C0IA 4DEXA 2KDSA 3M0UA 4MZMA 5GAN4 3UF4A 4JRQA 2YWWA 1K9MU 1RAEB 2NWMA 3FJ5A 5GAMe 4C92F 5I11A 2OTJT 3WVDB 4FT4A 2PVGB 5GAN3 2VC8A 1SSHA 2JZ2A 4M7DA 1SRLA 2ZZDA 3JB9J 5GANd 3TSZA 2GCXA 1G3YA 1M2VB 1Q81C 1YFNA 3CMET 2P4RA 1PNJA 3CPWS 3EGUA 1NLPC 3NGPA 1AD5A 3OYJA 3BFMA 2MYSA 1M3AA 2DL8A 2MIOA 3FC3A 2K9GA 1NG2A 4BY6B 2V8KA 2LNVA 3LWHA 3WXMB 3CC7Q 1YCSB 2X4JA 2P0PA 5I22A 3M9QA 2CH4W 1D1BA 1W2BP 1IREB 3DKMA 4J6XA 4J9IA 3EG9B 3JB9H 2MAMA 3FB9A 2LJ1A 1RAFB 2DTIA 2HDAA 3M0PA 1M1KU 2QQBA 2KXDA 3TREA 5LJ5f 2QASA 4FYYB 1PD1A 2BKDN 4BI8B 1QW1A 3V7SA 1ABQA 3CC7T 1VIEA 4QQGA 2RK1A 4OMQA 4TVRA 1NPPA 3L2QA 4JRKA 3URGA 3PVLA 4XU0A 2KBTA 4HCCA 4AG1C 4Z89A 5AT1B 2F69A 3CC4A 4PJOF 1Q82U 2EJGA 4M77A 2BTTA 2EJ9A 4E7ZA 2H8HA 1VQ7Q 3VV0A 4R56A 1WQ7A 1UHFA 1PG5B 2FHDA 1VQOA 1RAGB 2X4YA 4C5GA 1R8OB 3CMEQ 1KIKA 2K57A 1N8RU 1LVKA 1MMNA 5LJ5h 1U8RA 1UFFA 4ZN3A 5DM7R 5C6SA 1WPYA 2LQWA 4KULA 4M78G 2KEAA 1VQNA 1TUCA 3HPWA 2ZCFB 1RACB 1QKXA 2FRYA 2DYIA 2QTXA 1S72A 4JPBW 4GLMA 3VRZA 1RAHB 3CCMT 3VYHB 3UATA 1P92A 4DOWA 1KJWA 3JCMW 1LNXA 2M0OA 4OB1B 5DLOA 1Y71A 4IUUA 4ELZC 1H641 3OYCA 1MMGA 2R5MA 2HMAA 1MV0B 2EQMA 5FWBA 5LJ5g 2F2XA 4C92D 3LLRA 2JXBA 2DRKA 5KYXA 4A4KA 2LQKA 4M7AC 3H0IA 2OAUA 3A98A 3GPLA 2E1HA 4C92G 2W0ZA 3EGXA 3BW1A 3QDFA 3M53A 4ZTFA 2QYZA 1O75A 1V1CA 3V8LA 1ZQ1A 3CBPA 4J8OA 2A28A 3UPUA 1WGSA 2OX7A 2RJCA 2MMPA 4QW2A 5KH6A 4PL6A 4E6RA 2L3SA 3OSVA 1LOJA 2OTLT 2E6NA 3JCMc 3C4SA 5A2QE 3EGDA 2FL7A 2EGAA 5GAMj 3CCQA 3CMAA 1PHTA 1U1SA 2Y90A 1HK9A 1YNZA 1TTHB 3KXTA 4BI3A 1BK2A 2R58A 1VQ5Q 4C8QD 4XU1A 5KE2A 1SEMA 3UA7A 4J6YA 4B9WA 2MCNA 4DBQA 4FSXA 4FSSA 2EYYA 4IUTA 2IG0A 1Q7YC 2I2LA 3CXCS 3G6ET 5ECAA 3JB9F 2RNAA 2RJDA 2CZ0B 1WHHA 4JRPA 2F2VA 4OB0B 2FPDA 3QHSA 2FYKA 2PTKA 2LMJA 4GBQA 3H9NA 3RNJA 4KH0B 7AT1B 2VXFA 3OQ5A 3CCEQ 2YRCA 3EFSA 1MMAA 1G3WA 2L0AA 2JOYA 2NUPB 1UGSB 1D0ZA 4BI4A 1M2OA 1YWOA 1YIJQ 4FU6A 3VJPA 1WHMA 2NUTA 4C0DC 1VQLQ 3C95A 3PVQA 2OTJQ 3PGGA 2PU9B 5FU7B 1MGQA 2COYA 4M7AG 5KYYB 2EBPA 4J9BA 4LUEA 2X4WA 1XOVA 4ZGDB 1RLQC 1UGVA 1O9SA 5KYXB 2AZVA 2QXFA 4PJNA 1VQLA 3QYGB 2KSSA 3LW5E 3HTRA 2L89A 2EQKA 5L8RE 4OMPA 2KVQG 3JCMQ 1XJWB 2JUFA 1KQ1A 4EMKA 1JQQA 3NTKA 4NS5A 5CO7A 3CCRA 1ZA2B 2LVMA 1JBMA 2EYZA 4LD9K 1IO6A 1PKSA 2LT1A 2Y4XA 3OYHA 3R6OA 1UJ0A 4KBMB 3PIOA 3OB9A 1F1BB 3VS4A 3G7ZA 5DY9A 2VXEA 2O4XB 5GAOp 2EKHA 4JS5A 3TSWA 2EW3A 1HSQA 1BB9A 3G71T 1AZEA 4DQ2A 2DYBA 1VA7A 1H8KA 1ZUKA 2KK4A 4PJOE 4KGXB 5FRMA 4CC4B 1X6OA 3EFOB 2D1XA 2EKOA 4O6JA 3CCJA 1JEGA 4LUDA 2QDLA 3DB4A 4ME7A 1WLPB 2QTVA 5IHKA 4KGVB 4M75B 4HCKA 5IN1A 2EGEA 4CC3A 3CCQQ 2DILA 3CCVA 4DEYA 4GLKA 4F7UG 3V7CA 1OEBA 1JXMA 3HHTB 1SHFA 1UJYA 5EG2A 1AEYA 3LX7A 3HFOA 2DLPA 2G3RA 5EC7A 3V7RA 2W10A 1YI2A 5A0GA 4RKUE 4BY6C 1QCFA 4QQDA 3M59A 1LPLA 2V8IA 3EH2A 2NLUA 5FRNA 1YBYA 3MEUA 4AFQC 2HQEA 2O01E 2AKKA 3I56A 4JJNK 1PSEA 4WF2A 5GAN7 4FYWB 3OYYA 1D0XA 5FU6C 3VYGA 4E7IA 1EFNA 2LZ6B 3QJYA 3OYKA 2RF0A 1WJRA 1IZ6A 4F17A 2YRDA 2CP5A 1T0JA 2QQSA 4B9XA 3G1JA 5IAYA 4BUGA 1BKBA 3ER0A 1Q95G 2XDPA 1OOTA 5GMKj 2GGRA 5CQYA 1GCPA 3G4SA 2DNUA 4EIKA 3FRNA 5CKEA 1QQJA 9ATCB 4JRIA 1WZOA 1KD1C 5KE3A 3OA6A 4IIMA 4LN2A 3DB3A 1VQKQ 4M78C 3CC2Q 4C0ZA 4RCBA 1QVPA 3QO3A 3EG0A 3PIPA 1H3HA 3P8BB 1WI7A 4NOYA 4X1VA 1ZBJA 4C5IA 1TUGB 2PVDB 5GAN6 4ANJA 2HZYA 2K2VA 3G4SQ 5FWCA 2DD5A 3EG1A 2A08A 2K7AA 4F7UE 6AT1B 1WQWA 5IXBA 2AZSA 5CKHA 1YI2T 1TUDA 4OMFB 3TU4K 2FB7A 1SKUB 5GANe 4F7UB 2KROA 3HSBA 2PQWA 3CCET 1M9SA 3RERA 2ZAEA 2DL3A 2DIQA 1KC8R 1K1ZA 4M7DG 1RUWA 1BCMA 2DXCA 3ZBDA 3V8JA 1I8FA 1GL5A 4LDYA 4E7KA 4F14A 2CZ1B 4EMHA 4PJJA 5KYWA 2DRMA 1YHQA 4HKEA 1WX6A 2KT8A 1QVGA 2EYXA 1PD0A 3EFRA 2QA4T 2RJFA 4XAXB 5CKBA 1VQNT 3QSUA 2LCCA 2M02A 4HA8A 3VS6A 1QWEA 2QQAA 3ME9A 1VQ8T 2HQHA 3EGXB 1JRIA 1ZSZC 4IURA 3LH0A 4NL3A 3QBYA 4M77C 4IUVA 1G3SA 1W2BS 2DL5A 3SHWA 3OW2S 2MWPA 1HD3A 1VQPQ 3PNWC 4MMKA 1S72T 4AG2C 3KBGA 1NPRA 3EG9A 2HBPA 4DA4A 2QEXQ 1BIBA 1WHLA 4PKCC 1XQHA 2K3XA 3E2UA 4RTXA 3QZ5B 1TS9A 8AT1B 1S72Q 2F5KA 1G2BA 3MO8A 1G3TA 4PJOA 1K0XA 5GAMh 4M77F 2ENMA 2A0FB 4BACA 4OGEA 2H3EB 2E5KA 3MEWA 4JS4A 4J6WA 2XICA 2D6FA 2K3YA 4CC7A 4XTVA 3VKIA 2KE9A 4F7UA 4AFSC 1IHVA 4C8QG 3CPWP 5KYNA 2O9SA 2XIDA 1CKBA 2RI3A 2K79A 2ZPGB 1JO8A 2EYQA 2X4XA 1QCOA 2E12A 1ZUUA 3HKSA 1ZUYA 3HRSA 1VOMA 3E1SA 2DD4A 3CD6Q 1Q86U 1K9MR 2DL7A 3ZEHA 2COWA 4L5GA 3VS0A 4E47A 5FLXE 4MMLA 4A4FA 2DJZA 1VQMQ 1OPLA 5J26A 2RQWA 3GNGA 1ZSGA 4N4HA 2X9HA 4F7UF 3MPUB 1DJ7B 2V1QA 1BI0A 4Z8AA 3C0CA 3HL8A 4M7AE 1RADB 3TEEA 4L6V5 1SRMA 3X20B 5J3BA 5D6WA 2IPOB 2JTFA 1YJNT 2PVOB 1YITA 3L42A 2CYZB 4M77D 4JZ3A 4F16A 4XTUA 3EFOA 5LJ3h 2DETA 3C94A 3M5AA 1M90R 4OB3B 4FCYA 1OPKA 1TWBA 4N4IA 2JT4A 4AFZC 1N8RC 1B07A 3UA6A 1A0NB 2H3JA 3LWIA 1NBEB 3JCMb 4PJOC 1YJNQ 4CC2A 4D8KA 4LXCA 3X28B 4E2FB 1YWPA 4C92E 4LNPA 3RESA 4QVCA 2RN8A 4QVZA 1G8XA 3L2ZA 3OBYA 1ZA1B 1VQOT 2XG8D 1Y96B 2ZPBB 1X69A 5GAOq 2HSEB 4M78B 1MNEA 2A3LA 3NMZC 1QVGP 5I2SA 2ROTA 2LRQA 3CBMA 2FZKB 1VQMT 2XHCA 1ARKA 2CSIA 4JJBA 5KCHA 2XI9A 3LYIA 1GFDA 3M56A 3RMQA 1JJ2A 1QKWA 3J81E 2R57A 1I5LA 3FJPA 2C06A 4PLIA 3CCMA 1GBQA 2CUDA 1MV3A 1JU5C 3OYLA 2HSPA 4Y91A 3WVEB 1AWWA 1WJSA 1WIEA 2COZA 4Z02A 1RL2A 3DLMA 1BI2A 2RJEA 2GF7A 2O4XA 1QVFP 4RTVA 4DOVA 4C92B 2JTMA 1FMKA 4C92A 4ZTJA 4PLLA 3MEVA 4C92C 1X75C 4F04B 3JSCA 4O5VA 1WYXA 1UECA 4R55A 2RHXA 3UT1A 2L3PA 1KHIA 3KFVA 5CCAA 1SSFA 4E7SA 4N0AC 3G71Q 4RTWA 1KG1A 4EMKB 4C8QF 5CKDA 2DERA 1D09B 4J7FA 3A8GB 4C5HA 4GY5A 4LD6A 3L2VA 2MPXC 3OS0A 1C1AA 2G6FX 3QXEB 1NJIR 3GLXA 1GRIA 1Q7YU 3I5RA 3CCLT 2YHTA 5CIUA 4X9CA 4L59A 5KYYA 3QWXX 1AT1B 1M3CA 4HVVA 1SPKA 3M0RA 4FW2A 1BI3A 4ZGEB 3DLLA 4JLIA 1RAIB 4DBHA 4DBRA 3P8HA 3CC4T 2LJ3A 2E10A 2X51A 5GAN5 1VQ5T 1UE9A 2YRVA 1ZSZA 3PFSA 5GANj 1M8MA 2QEXT 3OBWA 2R5AA 4M78F 1KFZA 2YXYA 3QWYA 1JJ2S 2AT1B 3CCRQ 3PE0A 1OZ2A 1NLOC 1AHJB 4HVWA 1WXBA 3RBBB 1Y96A 1TU0B 4A4GA 2RI2A 1R0BG 8ATCB 1QVFS 2WSCE 2YLBA 5GAMf 2EWNA 3CQTA
chains in the Genus database with same CATH topology
1IHVA 4FW2A 1C6VX 1EX4A 4FW1A 1QMCA 1IHWA 5D7UA 1C0MA 1C1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IHV A;  4FW2 A;  1C6V X;  1EX4 A;  4FW1 A;  1QMC A;  1IHW A;  5D7U A;  1C0M A;  1C1A A; 
#chains in the Genus database with same CATH topology
 1AVZ C;  3OS2 A;  1D3B A;  3JB9 I;  1TXQ A;  2GFU A;  1C6V X;  4AT1 B;  2VUB A;  5FW9 A;  1BCO A;  4RTU A;  3FEO A;  2FPE A;  3CBO A;  1X01 A;  3RKW A;  2DO3 A;  2DXB A;  3X24 B;  1WXU A;  4M75 G;  3MCA B;  3JCM f;  3J7A F;  2RMO A;  2HQX A;  4PJO D;  3KUF A;  1Q81 R;  1Y0M A;  3OYI A;  2JJ9 A;  2E64 A;  4BDZ A;  1NYG A;  2RK2 A;  3EH1 A;  4C0F A;  1QP2 A;  2P84 A;  5HKC A;  2DK3 A;  5LJ3 e;  2RA2 A;  5LJ5 j;  2PUK B;  4ELY C;  2M51 A;  1NEB A;  4IUQ A;  2RQV A;  1B7T A;  4D8D A;  2K2M A;  2YUP A;  2M1H A;  3REB B;  2LP5 A;  3SWN B;  2ZPF B;  4JZ4 A;  2BE9 B;  4EPC A;  5IT9 E;  2LCL A;  3HFN A;  5GAO n;  3M54 A;  4C0D B;  4M7A F;  3CCL Q;  1Q82 R;  4A63 B;  1KQ2 A;  2J06 A;  2QGF B;  2KT1 A;  2YUO A;  2GQI A;  1NZ9 A;  1M90 U;  1G5V A;  2VKN A;  4OML A;  1MND A;  1BBZ A;  2FG0 A;  2MF2 A;  3JCM P;  3CCV T;  1KQS S;  2KYM A;  3L1A A;  1YJW Q;  1E6H A;  1Z9Q A;  4XTY A;  3X25 B;  4JDS A;  1V29 B;  2LDM A;  1UG1 A;  3PMT A;  1RAB B;  2L5Q A;  2MI6 A;  1M1G A;  1GCQ C;  2EQJ A;  3CCQ T;  2RHI A;  3I9Q A;  4RTZ A;  1E7O A;  1VIF A;  4C0G A;  4M7A A;  2M16 A;  2JMA A;  2SEM A;  4N0A A;  4A53 A;  2CUB A;  3C12 A;  4MDW A;  4X34 A;  2D8H A;  3N5B B;  2CT4 A;  3OYE A;  1K73 C;  3QZ9 B;  1NM7 A;  4K11 A;  1U3O A;  1VQ4 T;  2DA9 A;  2QAZ A;  3CC4 Q;  3CC7 A;  2ROL A;  2EVR A;  3A5Z B;  1QLY A;  3VS3 A;  1OV3 A;  3M4Y A;  2JVV A;  3L2W A;  2D8J A;  2KGT A;  1KD1 U;  1N9R A;  2CZ6 B;  3NPF A;  3S3M A;  4RUG A;  1XNI A;  2RH2 A;  2HL5 C;  3NHN A;  2LTO A;  4MDX A;  2JM9 A;  2JMC A;  1UB4 A;  1ZSZ B;  5CVI A;  2FRW A;  1RI9 A;  4RG2 A;  1QWF A;  2ED1 A;  2X35 A;  1LCK A;  4C8Q E;  3CD6 A;  1N27 A;  2DMO A;  1NYF A;  5HCK A;  4HCZ A;  2F2W A;  3CCR T;  4J9C A;  1IGQ A;  3RKY A;  2ED0 A;  2BIV A;  2OJ2 A;  1YCY A;  3MP8 A;  1TSF A;  1KQS P;  3THK A;  4QT7 A;  1YJN A;  4II1 A;  4J9E A;  2WSF E;  3L2R A;  1VQ5 A;  1N5Z A;  5C0M A;  2KMT A;  1KD1 R;  4M75 E;  1IGU A;  3MJX A;  2DAQ A;  3SFM A;  2EIF A;  2M0Y A;  4DBF A;  1JB0 E;  2OTJ A;  4IKF A;  1VQN Q;  1OYX A;  2LQN A;  4M4Z A;  2DE0 X;  1PC0 A;  3PT9 A;  3L2U A;  1N9S A;  4ATO A;  1H3Z A;  5LJ3 f;  1N8R R;  3M0T A;  2V26 A;  4WCI A;  3JCM g;  1MMD A;  1M90 C;  1X2K A;  3CCM Q;  1OU9 A;  2CGH A;  2JM8 A;  4J9D A;  3QJ6 A;  4M75 F;  2KAF A;  4CI0 C;  3EG2 A;  2DTH A;  4FL6 A;  1T3S A;  1IB8 A;  4ESR A;  2E3H A;  3A8L B;  2V8J A;  5GAN 2;  5CKF A;  3CMA T;  1QCN A;  2DVJ A;  5CR2 A;  2DPP B;  3SB2 A;  2YSQ A;  5LJ5 e;  1ZLM A;  1UEB A;  2OTL A;  1OX9 A;  2VVK A;  1ZBX A;  2YDL A;  2EQI A;  3J80 E;  3I56 T;  1OUL A;  2ZPI B;  1VQ9 T;  2J6O A;  4XTX A;  3U23 A;  1YJW T;  1K73 U;  2KR3 A;  3A8H B;  4M75 A;  1PM3 A;  2DXU A;  3GNF B;  3NTI A;  2QDY B;  3MP1 A;  4M75 C;  1JXO A;  5GAN g;  1UGP B;  1M3B A;  2EYW A;  3I55 T;  1I5O B;  3CCU A;  2VWF A;  1K8A U;  4XU2 A;  1VQK T;  1J3T A;  2XKO C;  3P8D A;  4JUV A;  3G6E A;  4LE9 A;  5GJV B;  2DEU A;  3LGF A;  1Q86 C;  4RMO A;  1WXT A;  1GXI E;  3MKD A;  4HT9 A;  4X9D A;  1LJO A;  4E7H A;  3E9F A;  3GBQ A;  1WHJ A;  1R0C B;  4LDW A;  3GOX A;  2CKK A;  5KYU A;  1NE8 A;  4KGZ B;  1TH7 A;  2ATC B;  3ZFJ A;  1RLP C;  1YIT Q;  1UGR B;  1HYO A;  3R6N A;  1UHC A;  2BUD A;  3H0H A;  3REA B;  3VS2 A;  2NYS A;  1X6B A;  4HXJ A;  5GJW B;  1OX8 A;  1SF9 A;  4BD3 A;  1MUZ A;  3RKX A;  3JCM V;  4KRT A;  1SHG A;  4YTL A;  3FDR A;  1BIA A;  2L3R A;  4XQ3 A;  1D1C A;  5GAO m;  3JCM d;  2VAS A;  2K5F A;  3Q1J A;  5GMK i;  4A54 A;  3I55 A;  1YJ9 T;  1VQ7 T;  2HL3 A;  5J39 A;  2E41 A;  3CCU T;  1FWZ A;  1FXX A;  5L23 A;  1IXD A;  2J6K A;  5KYW B;  2P0Q A;  1B34 B;  1S1N A;  4FYV B;  1EZZ B;  1ZX6 A;  1WJQ A;  3A8M B;  1YP5 A;  3A8O B;  3VS1 A;  5GMK m;  1W6X A;  5GMK h;  1TG0 A;  5D7U A;  1W2B A;  3GIB A;  2PUO B;  2FZG B;  2HCK A;  1BYM A;  2FO0 A;  3HRT A;  3S6W A;  2CP6 A;  1VQK A;  4MZT A;  4C8Q A;  1PSF A;  2DEQ A;  4FT2 A;  2DTO A;  1T3L A;  3UDC A;  2RHY A;  1W4S A;  1VQ8 A;  5HK0 A;  1QP3 A;  2FEI A;  4PJO G;  2QGG A;  5FRO A;  2GFA A;  4JJD A;  1GCQ A;  2RB6 A;  1FMV A;  4LDU A;  2GQV A;  1KSW A;  3NTH A;  2DFU A;  5FU6 B;  3GP8 A;  5KCO A;  4MZP A;  1ABO A;  1CKA A;  1QVF A;  3O5Z A;  5LJ5 d;  1YJ9 A;  1YIJ A;  4QVD A;  2HBW A;  2LQ8 A;  1K8A C;  4P5N A;  4LDX A;  3AHU A;  1HJD A;  3ZL7 C;  1Y7X A;  1VQ6 T;  5DLQ E;  2QQ9 A;  3EG3 A;  2LX9 A;  2QQR A;  2RI5 A;  1PWT A;  3JCM J;  1D3B B;  1QMC A;  2D0Q B;  2EQU A;  2JN0 A;  2CP0 A;  1AWO A;  2X3W D;  1M1K C;  3LGL A;  4ZNX A;  4FYX B;  2M9U A;  2OI3 A;  4J83 A;  4PFO A;  2EPD A;  1VYT A;  1WNL A;  2O9V A;  4OMM A;  5FU7 C;  2RM4 A;  3G4S T;  3RDV A;  2E4H A;  2KRM A;  4QKU A;  2YLC A;  4KUD K;  1IRX A;  2VB6 A;  4E7J A;  4N4G A;  2X3X D;  1K73 R;  2D9T A;  1Q82 C;  2A7Y A;  3QG1 A;  2AIR B;  1WHG A;  3QUI A;  3SDZ A;  3M55 A;  3PTA A;  3VU3 C;  3CCV Q;  3M4G A;  1I0C A;  3M0S A;  1PCX A;  2F1L A;  3QDR B;  2KNB B;  1I1J A;  2A37 A;  4RG8 A;  2GTO A;  3EAE A;  1VQ9 A;  1U5S A;  2CT3 A;  1UTI A;  2QG9 B;  4RTT A;  5D6Y A;  1YJW A;  2HNI A;  3UWN A;  2C0T A;  5HK3 A;  1OI1 A;  4BE1 A;  3MHX A;  4EDU A;  2P0K A;  3OMG A;  2B8A A;  1B3Q A;  4PJM A;  3CXC P;  1YIJ T;  3ASK A;  3VS7 A;  2L2P A;  4PJL A;  1CSK A;  3CC2 A;  4OMO A;  1VQL T;  1PRM C;  3I5S A;  2EGC A;  1YIT T;  2RHZ A;  1I4K 1;  4OF1 A;  2RQR A;  3GF5 A;  2ZPH B;  4FM4 B;  4M77 E;  1M8V A;  1M30 A;  2DIG A;  3OYB A;  2E6Z A;  2NUZ A;  2EFI A;  1VQ6 A;  1VQ4 A;  1VYU A;  1RI0 A;  2QA4 Q;  3CPW A;  1VQP A;  2EJF A;  1C0M A;  1OZ3 A;  5IXF A;  1YHQ T;  2Y4Y A;  4JLG A;  2FVU A;  4Y92 A;  3RR6 A;  2AK5 A;  2P4T A;  3CME A;  2XU8 A;  1VQ4 Q;  4KUI A;  1UDL A;  3E9G A;  2YUQ A;  4Q5W A;  2BZY A;  4J7I A;  3MP6 A;  2KQW A;  3OYG A;  2RHU A;  1H92 A;  5IHI A;  2AKL A;  3EHR A;  3JB9 G;  1K8A R;  3CPF A;  1PRL C;  2QA4 A;  2V1R A;  2CP3 A;  5GAM d;  4BB7 A;  2WSE E;  4M7D D;  3JB9 D;  4J9F A;  1VQ7 A;  3TQ7 P;  3H6Z A;  4NL2 A;  3I35 A;  1UUE A;  3BDU A;  4A4H A;  1FYN A;  2FPF A;  3CEY A;  3CCS T;  3RMS A;  1K9A A;  2DM1 A;  5IH2 A;  2GBQ A;  1M27 C;  1X2Q A;  1W70 A;  3QYH B;  1M4Z A;  2K5I A;  2NUT B;  3OSS C;  1BU1 A;  5LL6 S;  5GMK l;  5CQX A;  3M58 A;  1I81 A;  4PNO A;  1VQP T;  5GAN h;  3VUZ A;  2EAY A;  1M1F A;  2L8D A;  4XK8 E;  3O8V A;  3FLG A;  1EIF A;  4OP0 A;  1VQ6 Q;  2LNH B;  1MHN A;  3SEM A;  1AOJ A;  4M78 E;  1V76 A;  3LH5 A;  4OGC A;  1YHQ Q;  2OAW A;  2I0N A;  2RO0 A;  3SWN A;  1IHW A;  2WAC A;  4R0K A;  2GTJ A;  1M2V A;  3RIR A;  1ACM B;  1XTD A;  2E70 A;  4M7A B;  4Y28 E;  5M9O A;  2KYB A;  3EGD B;  2BZ8 A;  2PNI A;  5GAN f;  3JCM X;  4V2S A;  4Z88 A;  3H8Z A;  2VV5 A;  3MEA A;  1M1K R;  2XK0 A;  1JJ2 P;  3CCL A;  1U06 A;  3OS1 A;  2SRC A;  2AHJ B;  1AWX A;  2HKQ B;  5I21 A;  1FX7 A;  1NEG A;  1WFW A;  4KH1 B;  3JRZ A;  1NJI C;  3AT1 B;  4OVA A;  2CS7 A;  4HVU A;  3I55 Q;  2BZX A;  1E6G A;  4AFU C;  2CH4 A;  5GMK e;  2JS0 A;  3H0F A;  2KI7 A;  5A0L A;  2GNC A;  2DL4 A;  3CCS A;  1KC8 U;  2XMF A;  1AZG B;  1D1A A;  1WA7 A;  2MOX A;  2DKG A;  4BDY A;  2JTE A;  1KK7 A;  2QEX A;  5I2M A;  1Q86 R;  4C8Q B;  1UGQ B;  2ESW A;  4OMN A;  2HAX A;  3FIF A;  2NUP A;  1VYV A;  4JJC A;  2B86 A;  5GAN 8;  1EX4 A;  4D6W A;  2K5L A;  1G83 A;  4M75 D;  3CCE A;  2DXT A;  1PKT A;  5LJ3 d;  3S3O A;  3SD4 A;  2O2O A;  1VQM A;  2YT6 A;  2PZ1 A;  3CMA Q;  1T0H A;  2ECZ A;  2OTL Q;  4M78 A;  1R77 A;  1OQK A;  3VUB A;  4OB2 B;  4EMG A;  2L3Q A;  5KYU B;  3OMC A;  1X27 A;  2KXC A;  2CP7 A;  4PK4 A;  3CXC A;  1WDX A;  4FIB A;  2KY9 A;  4PFP A;  4AMC A;  3MET A;  4B6M A;  2DJQ A;  2CP2 A;  1VQO Q;  3NFC A;  2XDB A;  1N6A A;  1U1T A;  3BY7 A;  4HCB A;  2XDD A;  2CSQ A;  2DZ9 A;  2JW4 A;  4LDV A;  3OYF A;  3CC2 T;  1Z9Z A;  2CZ7 B;  2RQU A;  1B34 A;  3G6E Q;  2QI2 A;  4IIO A;  4PFZ A;  3OYM A;  1RAA B;  2RQT A;  1QVG S;  5GAM g;  3E19 A;  5LJ3 g;  3CCU Q;  3JV3 A;  1KQS A;  5GAO r;  5IHN A;  1X43 A;  1WHK A;  3S3N A;  3VS5 A;  2J6F A;  4M77 B;  3PMI A;  1FMW A;  2K4Y A;  2VGM A;  3OW2 A;  4C5E A;  3OYD A;  2HEQ A;  2IIM A;  1YI2 Q;  2VGN A;  2DBK A;  5GAO l;  4IUP A;  3M0Q A;  2HD0 A;  1BI1 A;  5CK9 A;  1K9M C;  3SWN C;  4RTY A;  3EHQ A;  3CCS Q;  2CDT A;  2CRE A;  3JCM e;  1KHC A;  2Z0W A;  5D6X A;  2FZC B;  1AWJ A;  4M78 D;  1X6G A;  2O88 A;  4RCC A;  2ZPE B;  3D7S B;  4M7D C;  2DX1 A;  1VQ8 Q;  1HXD A;  2E3I A;  2DBM A;  3JAM E;  2RPN A;  1Y07 A;  1Q81 U;  3H41 A;  4WTO B;  1YJ9 Q;  3TVT A;  2E5Q A;  1ZHI A;  1NJI U;  4EMK C;  2D0N A;  5CAI A;  3JCM h;  3X26 B;  3TCJ A;  4BE2 A;  3HRU A;  1KC8 C;  3T9N A;  2LJ0 A;  3INZ A;  3CCJ Q;  1K4U S;  4XTZ A;  2F5T X;  1GBR A;  4BE0 A;  2J7I A;  3F70 A;  2HKN A;  4J9H A;  4XU3 A;  4QQ6 A;  2DF6 A;  3V8K A;  2LC4 A;  4E7L A;  4A4E A;  2LT4 A;  4HT8 A;  1D0Y A;  4VUB A;  1K76 A;  4M7D E;  2A36 A;  2DVE A;  3A1P A;  2LCS A;  2ABL A;  3OY9 A;  3OYA A;  1K0S A;  2LX7 A;  4ZGJ B;  3HP9 A;  2K6D A;  4M7D B;  3G71 A;  2KRS A;  1OU8 A;  1I07 A;  1M5Q 1;  4ZN1 A;  5AYF A;  3OYN A;  3BDL A;  4M7D F;  1GFC A;  4M7A D;  3M57 A;  3QKJ A;  3CD6 T;  2XD0 A;  3CCJ T;  4J5Y A;  2E65 A;  1Y57 A;  5A0D A;  2JNG A;  2C0O A;  3OS5 A;  1W1F A;  2J05 A;  2O31 A;  2RD1 A;  3VRY A;  2MK5 A;  2MWO A;  4M77 G;  1YN8 A;  3QPH A;  2YUN A;  2QK0 A;  2JS2 A;  3BE3 A;  4UC4 A;  5HY6 A;  1VQ9 Q;  2ZGW A;  4FW1 A;  4XTW A;  1TOV A;  3ULR B;  1SG5 A;  2KRN A;  3I56 Q;  2K3B A;  3QII A;  3IQL A;  4J9G A;  4CRI A;  5LJ3 j;  2BE7 D;  3OW2 P;  4PJO B;  4KT0 E;  4C8Q C;  3RUX A;  1VUB A;  2DZC A;  1Q7Y R;  2VYT A;  4ORZ A;  2IVW A;  2C0I A;  4DEX A;  2KDS A;  3M0U A;  4MZM A;  5GAN 4;  3UF4 A;  4JRQ A;  2YWW A;  1K9M U;  1RAE B;  2NWM A;  3FJ5 A;  5GAM e;  4C92 F;  5I11 A;  2OTJ T;  3WVD B;  4FT4 A;  2PVG B;  5GAN 3;  2VC8 A;  1SSH A;  2JZ2 A;  4M7D A;  1SRL A;  2ZZD A;  3JB9 J;  5GAN d;  3TSZ A;  2GCX A;  1G3Y A;  1M2V B;  1Q81 C;  1YFN A;  3CME T;  2P4R A;  1PNJ A;  3CPW S;  3EGU A;  1NLP C;  3NGP A;  1AD5 A;  3OYJ A;  3BFM A;  2MYS A;  1M3A A;  2DL8 A;  2MIO A;  3FC3 A;  2K9G A;  1NG2 A;  4BY6 B;  2V8K A;  2LNV A;  3LWH A;  3WXM B;  3CC7 Q;  1YCS B;  2X4J A;  2P0P A;  5I22 A;  3M9Q A;  2CH4 W;  1D1B A;  1W2B P;  1IRE B;  3DKM A;  4J6X A;  4J9I A;  3EG9 B;  3JB9 H;  2MAM A;  3FB9 A;  2LJ1 A;  1RAF B;  2DTI A;  2HDA A;  3M0P A;  1M1K U;  2QQB A;  2KXD A;  3TRE A;  5LJ5 f;  2QAS A;  4FYY B;  1PD1 A;  2BKD N;  4BI8 B;  1QW1 A;  3V7S A;  1ABQ A;  3CC7 T;  1VIE A;  4QQG A;  2RK1 A;  4OMQ A;  4TVR A;  1NPP A;  3L2Q A;  4JRK A;  3URG A;  3PVL A;  4XU0 A;  2KBT A;  4HCC A;  4AG1 C;  4Z89 A;  5AT1 B;  2F69 A;  3CC4 A;  4PJO F;  1Q82 U;  2EJG A;  4M77 A;  2BTT A;  2EJ9 A;  4E7Z A;  2H8H A;  1VQ7 Q;  3VV0 A;  4R56 A;  1WQ7 A;  1UHF A;  1PG5 B;  2FHD A;  1VQO A;  1RAG B;  2X4Y A;  4C5G A;  1R8O B;  3CME Q;  1KIK A;  2K57 A;  1N8R U;  1LVK A;  1MMN A;  5LJ5 h;  1U8R A;  1UFF A;  4ZN3 A;  5DM7 R;  5C6S A;  1WPY A;  2LQW A;  4KUL A;  4M78 G;  2KEA A;  1VQN A;  1TUC A;  3HPW A;  2ZCF B;  1RAC B;  1QKX A;  2FRY A;  2DYI A;  2QTX A;  1S72 A;  4JPB W;  4GLM A;  3VRZ A;  1RAH B;  3CCM T;  3VYH B;  3UAT A;  1P92 A;  4DOW A;  1KJW A;  3JCM W;  1LNX A;  2M0O A;  4OB1 B;  5DLO A;  1Y71 A;  4IUU A;  4ELZ C;  1H64 1;  3OYC A;  1MMG A;  2R5M A;  2HMA A;  1MV0 B;  2EQM A;  5FWB A;  5LJ5 g;  2F2X A;  4C92 D;  3LLR A;  2JXB A;  2DRK A;  5KYX A;  4A4K A;  2LQK A;  4M7A C;  3H0I A;  2OAU A;  3A98 A;  3GPL A;  2E1H A;  4C92 G;  2W0Z A;  3EGX A;  3BW1 A;  3QDF A;  3M53 A;  4ZTF A;  2QYZ A;  1O75 A;  1V1C A;  3V8L A;  1ZQ1 A;  3CBP A;  4J8O A;  2A28 A;  3UPU A;  1WGS A;  2OX7 A;  2RJC A;  2MMP A;  4QW2 A;  5KH6 A;  4PL6 A;  4E6R A;  2L3S A;  3OSV A;  1LOJ A;  2OTL T;  2E6N A;  3JCM c;  3C4S A;  5A2Q E;  3EGD A;  2FL7 A;  2EGA A;  5GAM j;  3CCQ A;  3CMA A;  1PHT A;  1U1S A;  2Y90 A;  1HK9 A;  1YNZ A;  1TTH B;  3KXT A;  4BI3 A;  1BK2 A;  2R58 A;  1VQ5 Q;  4C8Q D;  4XU1 A;  5KE2 A;  1SEM A;  3UA7 A;  4J6Y A;  4B9W A;  2MCN A;  4DBQ A;  4FSX A;  4FSS A;  2EYY A;  4IUT A;  2IG0 A;  1Q7Y C;  2I2L A;  3CXC S;  3G6E T;  5ECA A;  3JB9 F;  2RNA A;  2RJD A;  2CZ0 B;  1WHH A;  4JRP A;  2F2V A;  4OB0 B;  2FPD A;  3QHS A;  2FYK A;  2PTK A;  2LMJ A;  4GBQ A;  3H9N A;  3RNJ A;  4KH0 B;  7AT1 B;  2VXF A;  3OQ5 A;  3CCE Q;  2YRC A;  3EFS A;  1MMA A;  1G3W A;  2L0A A;  2JOY A;  2NUP B;  1UGS B;  1D0Z A;  4BI4 A;  1M2O A;  1YWO A;  1YIJ Q;  4FU6 A;  3VJP A;  1WHM A;  2NUT A;  4C0D C;  1VQL Q;  3C95 A;  3PVQ A;  2OTJ Q;  3PGG A;  2PU9 B;  5FU7 B;  1MGQ A;  2COY A;  4M7A G;  5KYY B;  2EBP A;  4J9B A;  4LUE A;  2X4W A;  1XOV A;  4ZGD B;  1RLQ C;  1UGV A;  1O9S A;  5KYX B;  2AZV A;  2QXF A;  4PJN A;  1VQL A;  3QYG B;  2KSS A;  3LW5 E;  3HTR A;  2L89 A;  2EQK A;  5L8R E;  4OMP A;  2KVQ G;  3JCM Q;  1XJW B;  2JUF A;  1KQ1 A;  4EMK A;  1JQQ A;  3NTK A;  4NS5 A;  5CO7 A;  3CCR A;  1ZA2 B;  2LVM A;  1JBM A;  2EYZ A;  4LD9 K;  1IO6 A;  1PKS A;  2LT1 A;  2Y4X A;  3OYH A;  3R6O A;  1UJ0 A;  4KBM B;  3PIO A;  3OB9 A;  1F1B B;  3VS4 A;  3G7Z A;  5DY9 A;  2VXE A;  2O4X B;  5GAO p;  2EKH A;  4JS5 A;  3TSW A;  2EW3 A;  1HSQ A;  1BB9 A;  3G71 T;  1AZE A;  4DQ2 A;  2DYB A;  1VA7 A;  1H8K A;  1ZUK A;  2KK4 A;  4PJO E;  4KGX B;  5FRM A;  4CC4 B;  1X6O A;  3EFO B;  2D1X A;  2EKO A;  4O6J A;  3CCJ A;  1JEG A;  4LUD A;  2QDL A;  3DB4 A;  4ME7 A;  1WLP B;  2QTV A;  5IHK A;  4KGV B;  4M75 B;  4HCK A;  5IN1 A;  2EGE A;  4CC3 A;  3CCQ Q;  2DIL A;  3CCV A;  4DEY A;  4GLK A;  4F7U G;  3V7C A;  1OEB A;  1JXM A;  3HHT B;  1SHF A;  1UJY A;  5EG2 A;  1AEY A;  3LX7 A;  3HFO A;  2DLP A;  2G3R A;  5EC7 A;  3V7R A;  2W10 A;  1YI2 A;  5A0G A;  4RKU E;  4BY6 C;  1QCF A;  4QQD A;  3M59 A;  1LPL A;  2V8I A;  3EH2 A;  2NLU A;  5FRN A;  1YBY A;  3MEU A;  4AFQ C;  2HQE A;  2O01 E;  2AKK A;  3I56 A;  4JJN K;  1PSE A;  4WF2 A;  5GAN 7;  4FYW B;  3OYY A;  1D0X A;  5FU6 C;  3VYG A;  4E7I A;  1EFN A;  2LZ6 B;  3QJY A;  3OYK A;  2RF0 A;  1WJR A;  1IZ6 A;  4F17 A;  2YRD A;  2CP5 A;  1T0J A;  2QQS A;  4B9X A;  3G1J A;  5IAY A;  4BUG A;  1BKB A;  3ER0 A;  1Q95 G;  2XDP A;  1OOT A;  5GMK j;  2GGR A;  5CQY A;  1GCP A;  3G4S A;  2DNU A;  4EIK A;  3FRN A;  5CKE A;  1QQJ A;  9ATC B;  4JRI A;  1WZO A;  1KD1 C;  5KE3 A;  3OA6 A;  4IIM A;  4LN2 A;  3DB3 A;  1VQK Q;  4M78 C;  3CC2 Q;  4C0Z A;  4RCB A;  1QVP A;  3QO3 A;  3EG0 A;  3PIP A;  1H3H A;  3P8B B;  1WI7 A;  4NOY A;  4X1V A;  1ZBJ A;  4C5I A;  1TUG B;  2PVD B;  5GAN 6;  4ANJ A;  2HZY A;  2K2V A;  3G4S Q;  5FWC A;  2DD5 A;  3EG1 A;  2A08 A;  2K7A A;  4F7U E;  6AT1 B;  1WQW A;  5IXB A;  2AZS A;  5CKH A;  1YI2 T;  1TUD A;  4OMF B;  3TU4 K;  2FB7 A;  1SKU B;  5GAN e;  4F7U B;  2KRO A;  3HSB A;  2PQW A;  3CCE T;  1M9S A;  3RER A;  2ZAE A;  2DL3 A;  2DIQ A;  1KC8 R;  1K1Z A;  4M7D G;  1RUW A;  1BCM A;  2DXC A;  3ZBD A;  3V8J A;  1I8F A;  1GL5 A;  4LDY A;  4E7K A;  4F14 A;  2CZ1 B;  4EMH A;  4PJJ A;  5KYW A;  2DRM A;  1YHQ A;  4HKE A;  1WX6 A;  2KT8 A;  1QVG A;  2EYX A;  1PD0 A;  3EFR A;  2QA4 T;  2RJF A;  4XAX B;  5CKB A;  1VQN T;  3QSU A;  2LCC A;  2M02 A;  4HA8 A;  3VS6 A;  1QWE A;  2QQA A;  3ME9 A;  1VQ8 T;  2HQH A;  3EGX B;  1JRI A;  1ZSZ C;  4IUR A;  3LH0 A;  4NL3 A;  3QBY A;  4M77 C;  4IUV A;  1G3S A;  1W2B S;  2DL5 A;  3SHW A;  3OW2 S;  2MWP A;  1HD3 A;  1VQP Q;  3PNW C;  4MMK A;  1S72 T;  4AG2 C;  3KBG A;  1NPR A;  3EG9 A;  2HBP A;  4DA4 A;  2QEX Q;  1BIB A;  1WHL A;  4PKC C;  1XQH A;  2K3X A;  3E2U A;  4RTX A;  3QZ5 B;  1TS9 A;  8AT1 B;  1S72 Q;  2F5K A;  1G2B A;  3MO8 A;  1G3T A;  4PJO A;  1K0X A;  5GAM h;  4M77 F;  2ENM A;  2A0F B;  4BAC A;  4OGE A;  2H3E B;  2E5K A;  3MEW A;  4JS4 A;  4J6W A;  2XIC A;  2D6F A;  2K3Y A;  4CC7 A;  4XTV A;  3VKI A;  2KE9 A;  4F7U A;  4AFS C;  1IHV A;  4C8Q G;  3CPW P;  5KYN A;  2O9S A;  2XID A;  1CKB A;  2RI3 A;  2K79 A;  2ZPG B;  1JO8 A;  2EYQ A;  2X4X A;  1QCO A;  2E12 A;  1ZUU A;  3HKS A;  1ZUY A;  3HRS A;  1VOM A;  3E1S A;  2DD4 A;  3CD6 Q;  1Q86 U;  1K9M R;  2DL7 A;  3ZEH A;  2COW A;  4L5G A;  3VS0 A;  4E47 A;  5FLX E;  4MML A;  4A4F A;  2DJZ A;  1VQM Q;  1OPL A;  5J26 A;  2RQW A;  3GNG A;  1ZSG A;  4N4H A;  2X9H A;  4F7U F;  3MPU B;  1DJ7 B;  2V1Q A;  1BI0 A;  4Z8A A;  3C0C A;  3HL8 A;  4M7A E;  1RAD B;  3TEE A;  4L6V 5;  1SRM A;  3X20 B;  5J3B A;  5D6W A;  2IPO B;  2JTF A;  1YJN T;  2PVO B;  1YIT A;  3L42 A;  2CYZ B;  4M77 D;  4JZ3 A;  4F16 A;  4XTU A;  3EFO A;  5LJ3 h;  2DET A;  3C94 A;  3M5A A;  1M90 R;  4OB3 B;  4FCY A;  1OPK A;  1TWB A;  4N4I A;  2JT4 A;  4AFZ C;  1N8R C;  1B07 A;  3UA6 A;  1A0N B;  2H3J A;  3LWI A;  1NBE B;  3JCM b;  4PJO C;  1YJN Q;  4CC2 A;  4D8K A;  4LXC A;  3X28 B;  4E2F B;  1YWP A;  4C92 E;  4LNP A;  3RES A;  4QVC A;  2RN8 A;  4QVZ A;  1G8X A;  3L2Z A;  3OBY A;  1ZA1 B;  1VQO T;  2XG8 D;  1Y96 B;  2ZPB B;  1X69 A;  5GAO q;  2HSE B;  4M78 B;  1MNE A;  2A3L A;  3NMZ C;  1QVG P;  5I2S A;  2ROT A;  2LRQ A;  3CBM A;  2FZK B;  1VQM T;  2XHC A;  1ARK A;  2CSI A;  4JJB A;  5KCH A;  2XI9 A;  3LYI A;  1GFD A;  3M56 A;  3RMQ A;  1JJ2 A;  1QKW A;  3J81 E;  2R57 A;  1I5L A;  3FJP A;  2C06 A;  4PLI A;  3CCM A;  1GBQ A;  2CUD A;  1MV3 A;  1JU5 C;  3OYL A;  2HSP A;  4Y91 A;  3WVE B;  1AWW A;  1WJS A;  1WIE A;  2COZ A;  4Z02 A;  1RL2 A;  3DLM A;  1BI2 A;  2RJE A;  2GF7 A;  2O4X A;  1QVF P;  4RTV A;  4DOV A;  4C92 B;  2JTM A;  1FMK A;  4C92 A;  4ZTJ A;  4PLL A;  3MEV A;  4C92 C;  1X75 C;  4F04 B;  3JSC A;  4O5V A;  1WYX A;  1UEC A;  4R55 A;  2RHX A;  3UT1 A;  2L3P A;  1KHI A;  3KFV A;  5CCA A;  1SSF A;  4E7S A;  4N0A C;  3G71 Q;  4RTW A;  1KG1 A;  4EMK B;  4C8Q F;  5CKD A;  2DER A;  1D09 B;  4J7F A;  3A8G B;  4C5H A;  4GY5 A;  4LD6 A;  3L2V A;  2MPX C;  3OS0 A;  1C1A A;  2G6F X;  3QXE B;  1NJI R;  3GLX A;  1GRI A;  1Q7Y U;  3I5R A;  3CCL T;  2YHT A;  5CIU A;  4X9C A;  4L59 A;  5KYY A;  3QWX X;  1AT1 B;  1M3C A;  4HVV A;  1SPK A;  3M0R A;  4FW2 A;  1BI3 A;  4ZGE B;  3DLL A;  4JLI A;  1RAI B;  4DBH A;  4DBR A;  3P8H A;  3CC4 T;  2LJ3 A;  2E10 A;  2X51 A;  5GAN 5;  1VQ5 T;  1UE9 A;  2YRV A;  1ZSZ A;  3PFS A;  5GAN j;  1M8M A;  2QEX T;  3OBW A;  2R5A A;  4M78 F;  1KFZ A;  2YXY A;  3QWY A;  1JJ2 S;  2AT1 B;  3CCR Q;  3PE0 A;  1OZ2 A;  1NLO C;  1AHJ B;  4HVW A;  1WXB A;  3RBB B;  1Y96 A;  1TU0 B;  4A4G A;  2RI2 A;  1R0B G;  8ATC B;  1QVF S;  2WSC E;  2YLB A;  5GAM f;  2EWN A;  3CQT A; 
#chains in the Genus database with same CATH homology
 1IHV A;  4FW2 A;  1C6V X;  1EX4 A;  4FW1 A;  1QMC A;  1IHW A;  5D7U A;  1C0M A;  1C1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...