1II4A

Crystal structure of ser252trp apert mutant fgf receptor 2 (fgfr2) in complex with fgf2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
134
structure length
134
Chain Sequence
FPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for fibroblast growth factor receptor 2 activation in Apert syndrome.
pubmed doi rcsb
molecule keywords HEPARIN-BINDING GROWTH FACTOR 2
molecule tags Growth factor/growth factor receptor
source organism Homo sapiens
total genus 30
structure length 134
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1ii4A00
4QO3A 4LO1A 1DIWA 4OUJA 1UPSA 4LO7C 1JLXA 1BARA 3BRFA 3AH4A 4OWJA 1CVSA 21BIA 2VSEA 4J23B 1JT3A 2HW9A 1AVUA 1ISWA 4I6IA 4A7ZA 5BXPA 1FGAA 3V79C 1JQZA 1V6WA 1HWPB 4I4XA 4EFRA 3O4BA 41BIA 4HJJA 4I4SA 2X2SA 1GGPB 3FUOA 1JY0A 3T8SA 1TWMA 4D0ZA 4P6AA 3BA5A 2VXTI 4JPZA 3N7MA 1K5UA 2DREA 1DZDA 3BADA 4EEEB 3N7LA 3AZWA 2FDBM 3CA5A 3FJ8A 3JRRA 5BP5A 2ZQNA 3V0AA 3BAOA 5EHAA 2ZR1B 3BAUA 3FJ9A 1S0CA 4XFUA 1SZ6B 4I4YA 1PUMB 2FFVA 4I1EA 2K4AB 4QD2C 5FNWA 1VCLA 2QN4A 5BQUC 3BRGC 3I2XA 4L4IA 2GO2A 2R9KB 3IM7A 5D63A 1ABRB 3OGFA 3O5WB 3WO4A 1JT7A 4ZLBB 3HOMA 6I1BA 5BVPI 3HSMA 4QC4A 3IAGC 3S8JA 1XHBA 1RZOB 1FMZA 4QBVA 2DS0A 4D8HA 2MC2A 4G6MA 5DUYA 1ITBA 3O4OA 4DCKC 2FO1A 2Y9FA 4R6UB 4FVVA 4LO3C 1TIEA 4IZXA 1SR4A 4IY8A 3WMUA 3IM5A 5D61A 1QQKA 3AKFA 3AH1A 1AVXB 3I2AA 4ZOTA 1IT0A 3AJ6A 2ERMA 4LO2C 4TLPA 3OGGA 2NVHA 4I7IA 4JKQA 4X39A 4Q91A 3CRGA 3VT0A 1PC8B 3AH2A 4H9WA 3FFZA 4OEFA 2Q9XA 1WBCA 4AN6A 3CRIA 2Z49A 3N0KA 3N7JA 3R4SA 4ENDA 3BRDA 4KC3A 4ZFUB 1DLLA 4USOA 1XYFA 3CA0A 5EC5A 1WBAA 3A21A 3H6SE 4ZFYB 4ZGRB 3RTIB 2ET2A 1F31A 4JP0A 1NUNA 1FMMS 1RG8A 4A7KA 1A8DA 3PG0A 4I96A 1M16A 4I37A 5BXTA 1L2HA 2NZ9A 3QR5A 1EPWA 4JAWA 5DZUA 4AN7B 3VSFA 4FGFA 1JT5A 1JLYA 1FQ9A 1S0FA 4JRAA 1YXWA 4X37A 3HBWA 2P39A 5FZYA 2VUAA 4GOVA 1PUUB 1BFCA 4QKRA 2DRYA 4GAFA 1FN0A 4JKXB 5BXRA 2HWAA 1ILR1 3AZVA 3P53A 3OJ2A 3A23A 4G6JA 1MD6A 1XZZA 2XOAA 3H6RA 5G00A 2MIBA 9ILBA 1PZZA 1IOBA 1T4QA 5I1BA 1BA7A 2L5XA 4Q9PA 4WBCA 2BEBA 3V0BB 4IONA 5BOWA 2LIEA 3D7WB 3CQAA 3ZC8A 3V0BA 2F8XC 1YYNA 3LLPA 5JMCA 5BQUA 3Q7YA 3E8LC 1CE7B 4ISRA 4I4RA 1WD4A 3UD9A 3ZXDA 3V0AB 1S0LA 3N7KA 1EV2A 1BFBA 1TOOA 2HWMA 2LIQA 3FJHA 1V6XA 3RTJB 4D0TA 3Q7XA 4LO0C 4XFSA 4IQPA 1Q03A 2RSTA 3P6IA 3ZX7A 3C9ZA 2UUSA 2RG9B 4OW4A 5DVHA 2F2FC 2VLCA 2ZQOA 1BFFA 1HWMB 3CA1A 4KEJA 1AF9A 3F1RA 2AXMA 3ZC9A 2BFHA 3NBCA 3P6JA 3UD7A 1AFCA 1TP0A 4JQ0A 4LO3A 2D24A 4G1RA 1YBIA 3FJJA 2K43A 3BB2A 5F8YA 1WD3A 1DFQA 2E4MC 4OWKA 4LO2A 8I1BA 1AVAC 4GOYA 1FV3A 3ZXGA 1HWNB 4KEIA 4J2YA 3RSJA 1II4A 4L4HA 2I1BA 4QBCA 1FWUA 1MC9A 1EYLA 2NTDA 4GP0A 1BLDA 1PWAA 1P63A 1W3GA 2FFUA 3AKHA 1HCDA 3BAQA 1JT4A 4USPA 3FJDA 5FNXA 1Q1UA 2AFGA 2Z48A 3NBNA 1IRPA 31BIA 1K5VA 1S0BA 3PUBA 2D44A 3O4AA 4G9MA 1R8NA 1RMLA 4DENA 3RMYA 1IHKA 2VSAA 3BAGA 3POKA 3B9UA 3O3QA 4LO7B 3CA6A 1G82A 3OJMA 1D0HA 2KLLA 5F8WA 1G9DA 3PHZA 4LO8B 1FV2A 5B2HA 2RQ9A 1XG6A 1I1BA 1NZKA 1M2TB 4J2SA 3HMYA 5FZZA 2D7RA 3CAHA 3FUQA 5JLVA 2Q3NB 3O49A 4P0LA 3AJ5A 3VUOA 1QQLA 4II0A 2IHOA 1IJTA 4ISQA 1HWOB 4Z8SB 3BX1C 5GAQA 3BTAA 3O4CA 1Z2VA 3O44A 2GZBA 3QYDA 1ISYA 4IZEA 1V6UA 4IY9A 1R8OA 3VWCA 3AKGA 4KBBA 4PC4A 4YOLA 2MLLB 7I1BA 3A22A 5F8SA 1DQGA 4I2SA 1OQLB 5FZUA 4F83A 3H6RB 3UJ4A 4P0JA 4LO0A 4EB2B 2D23A 1KNMA 2KI6B 4H04A 1BASA 3LTQA 2F2FA 3OBRA 2P23A 4QD2B 2NM1A 2DRZA 3WO3A 1JTCA 1W3FA 3H6QA 3EF2A 3WO2A 3I29B 1DJSB 1DQOA 5HPZA 2Y9XE 4I4QA 1TTUA 4GP3A 1ISZA 1RY7A 3KMVA 3WINC 4F34A 1G9AA 2VU9A 2E4MA 4OEGA 4J2KA 1QXMA 2YUGA 2Y9WC 4HR6C 1ISXA 2IWTB 1BLAA 3CA4A 3SNVA 4I4OA 4LO1C 3OJVA 2M49A 2ESUA 3BAVA 2NYYA 1T9FA 3WMVA 1Z4SA 2J3PA 3PMEA 4I4VA 4P0KA 2D43A 3ILAA 3F62B 2D1ZA 3TC2A 4I4UA 3UD8A 1DFCA 3FJKA 4EFQA 4ZBVB 3IIRA 2KKIA 3CRHA 3AKIA 5F90A 4XFTA 1DZCA 2AQZA 3VT1A 3A07A 1YF8B 4ZKTB 1BFGA 2FGFA 4G9NA 1YTOA 4IHZA 1EVTA 3FJAA 1E0OA 5DSSB 3CU1B 3UJ0A 4J2XA 1HIBA 4EFPA 1S0EA 4OEEA 2QYIB 4I3NA 5BP5C 3W9TA 3WA1A 4I0YA 3RMXA 3UDAA 3CA3A 4OWLA 4DEPA 1HKNA 4CJMA 3BA4A 2NP0A 3NBEA 1V6VA 3VSZA 3R4UA 1ISVA 1IILA 3K1XA 1AVWB 3NBDA 1FWVA 2K8RA 2D22A 1W3AA 3FJBA 4I8MA 4XKIA 4X38A 4QKSA 1G9BA 3O4DA 4Z9WB 1S0GA 4I1BA 3IM6A 4I4PA 3VEQA 3JUTA 3VT2A 3BA7A 5E24E 2KI4A 5BXSA 3NJ5A 3HALA 2KH2A 3BAHA 4X3AA 4ZA3B 4Q9GA 4EKXB 1S0DA 2D7IA 4KEKA 3Q7WA 2VXRA 2WRYA 2AAIB 1ONKB 4QALA 3HN1A 2HZ9A 1I1EA 1N4KA 1AXMA 3FJFA 4ZFWB 1SR4C 3OBTA 5EG6C 3MALA 1G9CA 4GAIA 3FGMA 3FJEA 1TWEA 3FJIA 1J0SA 1IRAX 1HCEA 3WINA 4HA2A 3MPPG 2WBCA 5D62A 4A7YA 1Z0HA 2D20A 1TFMB 2X2TA 3S8KA 4IYBA 2Y9GA 1Q04A 3FJCA 2BEAA
chains in the Genus database with same CATH superfamily
4QO3A 4LO1A 1DIWA 4OUJA 1UPSA 4LO7C 1JLXA 4UY4A 1BARA 3BRFA 3AH4A 4OWJA 1CVSA 21BIA 2VSEA 4J23B 1JT3A 2HW9A 1AVUA 1ISWA 4I6IA 4A7ZA 5BXPA 1FGAA 3V79C 1JQZA 1V6WA 1HWPB 4I4XA 4EFRA 3O4BA 41BIA 4HJJA 4I4SA 2X2SA 1GGPB 3FUOA 1JY0A 3T8SA 1TWMA 4D0ZA 4P6AA 3BA5A 2VXTI 4JPZA 3N7MA 1K5UA 2DREA 1DZDA 3BADA 4EEEB 3N7LA 3AZWA 2FDBM 3CA5A 3FJ8A 3JRRA 5BP5A 2ZQNA 3V0AA 3BAOA 5EHAA 2ZR1B 3BAUA 3FJ9A 1S0CA 4XFUA 1SZ6B 4I4YA 1PUMB 2FFVA 4I1EA 2K4AB 4QD2C 5FNWA 1VCLA 2QN4A 5BQUC 3BRGC 3I2XA 4L4IA 2GO2A 2R9KB 3IM7A 5D63A 1ABRB 3OGFA 3O5WB 3WO4A 1JT7A 4ZLBB 3HOMA 6I1BA 5BVPI 3HSMA 4QC4A 3IAGC 3S8JA 1XHBA 1RZOB 1FMZA 4QBVA 2DS0A 4D8HA 2MC2A 4G6MA 5DUYA 1ITBA 3O4OA 4DCKC 2FO1A 2Y9FA 4R6UB 4FVVA 4LO3C 1TIEA 4IZXA 1SR4A 4IY8A 3WMUA 3IM5A 5D61A 1QQKA 3AKFA 3AH1A 1AVXB 3I2AA 4ZOTA 1IT0A 3AJ6A 2ERMA 2NS2A 4LO2C 4TLPA 3OGGA 2NVHA 4I7IA 4JKQA 4X39A 4Q91A 3CRGA 3VT0A 1PC8B 3AH2A 4H9WA 3FFZA 4OEFA 2Q9XA 1WBCA 4AN6A 3CRIA 2Z49A 3N0KA 3N7JA 3R4SA 4ENDA 3BRDA 4KC3A 4ZFUB 1DLLA 4USOA 1XYFA 3CA0A 5EC5A 1WBAA 3A21A 3H6SE 4ZFYB 4ZGRB 3RTIB 2ET2A 1F31A 4JP0A 1NUNA 1FMMS 1RG8A 4A7KA 1A8DA 3PG0A 4I96A 1M16A 4I37A 5BXTA 1L2HA 2NZ9A 3QR5A 1EPWA 4JAWA 5DZUA 4AN7B 3VSFA 4FGFA 1JT5A 1JLYA 1FQ9A 1S0FA 4JRAA 1YXWA 4X37A 3HBWA 2P39A 5FZYA 2VUAA 4GOVA 1PUUB 1BFCA 4QKRA 2DRYA 4GAFA 1FN0A 4JKXB 5BXRA 2HWAA 1ILR1 3AZVA 3P53A 3OJ2A 3A23A 4G6JA 1MD6A 1XZZA 2XOAA 3H6RA 5G00A 2MIBA 9ILBA 1PZZA 1IOBA 1T4QA 5I1BA 1BA7A 2L5XA 4Q9PA 4WBCA 2BEBA 3V0BB 4IONA 5BOWA 2LIEA 3D7WB 3CQAA 3ZC8A 3V0BA 2F8XC 1YYNA 3LLPA 5JMCA 5BQUA 3Q7YA 3E8LC 1CE7B 4ISRA 4MZFB 4I4RA 1WD4A 3UD9A 3ZXDA 3V0AB 1S0LA 3N7KA 1EV2A 1BFBA 1TOOA 2HWMA 2LIQA 3FJHA 1V6XA 3RTJB 4D0TA 3Q7XA 4LO0C 4XFSA 4IQPA 1Q03A 2RSTA 3P6IA 3ZX7A 3C9ZA 2UUSA 2RG9B 4OW4A 5DVHA 2F2FC 2VLCA 2ZQOA 1BFFA 1HWMB 3CA1A 4KEJA 1AF9A 3F1RA 2AXMA 3ZC9A 2BFHA 3NBCA 3P6JA 3UD7A 1AFCA 1TP0A 4JQ0A 4LO3A 2D24A 4G1RA 1YBIA 3FJJA 2K43A 3BB2A 5F8YA 1WD3A 1DFQA 2E4MC 4OWKA 4LO2A 8I1BA 1AVAC 4GOYA 4MZGB 1FV3A 3ZXGA 1HWNB 4KEIA 4J2YA 3RSJA 1II4A 4L4HA 2I1BA 4QBCA 1FWUA 1MC9A 1EYLA 2NTDA 4GP0A 1BLDA 1PWAA 1P63A 1W3GA 2FFUA 3AKHA 1HCDA 3BAQA 1JT4A 4USPA 3FJDA 5FNXA 1Q1UA 2AFGA 2Z48A 3NBNA 1IRPA 31BIA 1K5VA 1S0BA 3PUBA 2D44A 3O4AA 4G9MA 1R8NA 1RMLA 4DENA 3RMYA 1IHKA 2VSAA 3BAGA 3POKA 3B9UA 3O3QA 4LO7B 3CA6A 1G82A 3OJMA 1D0HA 2KLLA 5F8WA 1G9DA 3PHZA 4LO8B 1FV2A 5B2HA 2RQ9A 1XG6A 1I1BA 1NZKA 1M2TB 4J2SA 3HMYA 5FZZA 2D7RA 3CAHA 3FUQA 5JLVA 2Q3NB 3O49A 4P0LA 3AJ5A 3VUOA 1QQLA 4II0A 2IHOA 1IJTA 4ISQA 1HWOB 4Z8SB 3BX1C 5GAQA 3BTAA 3O4CA 1Z2VA 3O44A 2GZBA 3QYDA 1ISYA 4IZEA 1V6UA 4IY9A 1R8OA 3VWCA 3AKGA 4KBBA 4PC4A 4YOLA 2MLLB 7I1BA 3A22A 5F8SA 1DQGA 4I2SA 1OQLB 5FZUA 4F83A 3H6RB 3UJ4A 4MZHA 4P0JA 4LO0A 4EB2B 2D23A 4H75A 1KNMA 2KI6B 4H04A 1BASA 3LTQA 2F2FA 3OBRA 2P23A 4QD2B 2NM1A 2DRZA 3WO3A 1JTCA 1W3FA 3H6QA 3EF2A 3WO2A 3I29B 1DJSB 1DQOA 5HPZA 2Y9XE 4I4QA 1TTUA 4GP3A 1ISZA 1RY7A 3KMVA 3WINC 4F34A 1G9AA 2VU9A 2E4MA 4OEGA 4J2KA 1QXMA 2YUGA 2Y9WC 4HR6C 1ISXA 2IWTB 1BLAA 3CA4A 3SNVA 4I4OA 4LO1C 3OJVA 2M49A 2ESUA 3BAVA 2NYYA 1T9FA 3WMVA 1Z4SA 2J3PA 3PMEA 4I4VA 4P0KA 2D43A 3ILAA 3F62B 2D1ZA 3TC2A 4I4UA 3UD8A 1DFCA 3FJKA 4EFQA 4ZBVB 3IIRA 2KKIA 3CRHA 3AKIA 5F90A 4XFTA 1DZCA 2AQZA 3VT1A 3A07A 1YF8B 4ZKTB 1BFGA 2FGFA 4G9NA 1YTOA 4IHZA 1EVTA 3FJAA 1E0OA 5DSSB 3CU1B 3UJ0A 4J2XA 1HIBA 4EFPA 1S0EA 4OEEA 2QYIB 4I3NA 5BP5C 3W9TA 3WA1A 4I0YA 3RMXA 3UDAA 3CA3A 4OWLA 4DEPA 1HKNA 4CJMA 3BA4A 2NP0A 3NBEA 1V6VA 3VSZA 3R4UA 1ISVA 1IILA 3K1XA 1AVWB 3NBDA 1FWVA 2K8RA 2D22A 1W3AA 3FJBA 4I8MA 4XKIA 4X38A 4QKSA 1G9BA 3O4DA 4Z9WB 1S0GA 4I1BA 3IM6A 4I4PA 3VEQA 3JUTA 3VT2A 3BA7A 5E24E 2KI4A 5BXSA 3NJ5A 3HALA 2KH2A 3BAHA 4X3AA 4ZA3B 4Q9GA 4EKXB 1S0DA 2D7IA 4KEKA 3Q7WA 2VXRA 2WRYA 2AAIB 1ONKB 4QALA 3HN1A 2HZ9A 1I1EA 1N4KA 1AXMA 3FJFA 4ZFWB 1SR4C 3OBTA 5EG6C 3MALA 1G9CA 4GAIA 3FGMA 3FJEA 1TWEA 3FJIA 1J0SA 1IRAX 1HCEA 3WINA 4HA2A 3MPPG 2WBCA 5D62A 4A7YA 1Z0HA 2D20A 1TFMB 2X2TA 3S8KA 4IYBA 2Y9GA 1Q04A 3FJCA 2BEAA
chains in the Genus database with same CATH topology
4QO3A 4LO1A 1DIWA 4OUJA 1UPSA 4LO7C 1JLXA 4UY4A 1BARA 3BRFA 3AH4A 4OWJA 1CVSA 21BIA 2VSEA 4J23B 1JT3A 2HW9A 1AVUA 1ISWA 4I6IA 4A7ZA 5BXPA 1FGAA 3V79C 1JQZA 1V6WA 1HWPB 4I4XA 4EFRA 3O4BA 41BIA 4HJJA 4I4SA 2X2SA 1GGPB 3FUOA 1JY0A 3T8SA 1TWMA 4D0ZA 4P6AA 3BA5A 2VXTI 4JPZA 3N7MA 1K5UA 2DREA 1DZDA 3BADA 4EEEB 3N7LA 3AZWA 2FDBM 3CA5A 3FJ8A 3JRRA 5BP5A 2ZQNA 3V0AA 3BAOA 5EHAA 2ZR1B 3BAUA 3FJ9A 1S0CA 4XFUA 1SZ6B 4I4YA 1PUMB 2FFVA 4I1EA 2K4AB 4QD2C 5FNWA 1VCLA 2QN4A 5BQUC 3BRGC 3I2XA 4L4IA 2GO2A 2R9KB 3IM7A 5D63A 1ABRB 3OGFA 3O5WB 3WO4A 1JT7A 4ZLBB 3HOMA 6I1BA 5BVPI 3HSMA 4QC4A 3IAGC 3S8JA 1XHBA 1RZOB 1FMZA 4QBVA 2DS0A 4D8HA 2MC2A 4G6MA 5DUYA 1ITBA 3O4OA 4DCKC 2FO1A 2Y9FA 4R6UB 4FVVA 4LO3C 1TIEA 4IZXA 1SR4A 4IY8A 3WMUA 3IM5A 5D61A 1QQKA 3AKFA 3AH1A 1AVXB 3I2AA 4ZOTA 1IT0A 3AJ6A 2ERMA 2NS2A 4LO2C 4TLPA 3OGGA 2NVHA 4I7IA 4JKQA 4X39A 4Q91A 3CRGA 3VT0A 1PC8B 3AH2A 4H9WA 3FFZA 4OEFA 2Q9XA 1WBCA 4AN6A 3CRIA 2Z49A 3N0KA 3N7JA 3R4SA 4ENDA 3BRDA 4KC3A 4ZFUB 1DLLA 4USOA 1XYFA 3CA0A 5EC5A 1WBAA 3A21A 3H6SE 4ZFYB 4ZGRB 3RTIB 2ET2A 1F31A 4JP0A 1NUNA 1FMMS 1RG8A 4A7KA 1A8DA 3PG0A 4I96A 1M16A 4I37A 5BXTA 1L2HA 2NZ9A 3QR5A 1EPWA 4JAWA 5DZUA 4AN7B 3VSFA 4FGFA 1JT5A 1JLYA 1FQ9A 1S0FA 4JRAA 1YXWA 4X37A 3HBWA 2P39A 5FZYA 2VUAA 4GOVA 1PUUB 1BFCA 4QKRA 2DRYA 4GAFA 1FN0A 4JKXB 5BXRA 2HWAA 1ILR1 3AZVA 3P53A 3OJ2A 3A23A 4G6JA 1MD6A 1XZZA 2XOAA 3H6RA 5G00A 2MIBA 9ILBA 1PZZA 1IOBA 1T4QA 5I1BA 1BA7A 2L5XA 4Q9PA 4WBCA 2BEBA 3V0BB 4IONA 5BOWA 2LIEA 3D7WB 3CQAA 3ZC8A 3V0BA 2F8XC 1YYNA 3LLPA 5JMCA 5BQUA 3Q7YA 3E8LC 1CE7B 4ISRA 4MZFB 4I4RA 1WD4A 3UD9A 3ZXDA 3V0AB 1S0LA 3N7KA 1EV2A 1BFBA 1TOOA 2HWMA 2LIQA 3FJHA 1V6XA 3RTJB 4D0TA 3Q7XA 4LO0C 4XFSA 4IQPA 1Q03A 2RSTA 3P6IA 3ZX7A 3C9ZA 2UUSA 2RG9B 4OW4A 5DVHA 2F2FC 2VLCA 2ZQOA 1BFFA 1HWMB 3CA1A 4KEJA 1AF9A 3F1RA 2AXMA 3ZC9A 2BFHA 3NBCA 3P6JA 3UD7A 1AFCA 1TP0A 4JQ0A 4LO3A 2D24A 4G1RA 1YBIA 3FJJA 2K43A 3BB2A 5F8YA 1WD3A 1DFQA 2E4MC 4OWKA 4LO2A 8I1BA 1AVAC 4GOYA 4MZGB 1FV3A 3ZXGA 1HWNB 4KEIA 4J2YA 3RSJA 1II4A 4L4HA 2I1BA 4QBCA 1FWUA 1MC9A 1EYLA 2NTDA 4GP0A 1BLDA 1PWAA 1P63A 1W3GA 2FFUA 3AKHA 1HCDA 3BAQA 1JT4A 4USPA 3FJDA 5FNXA 1Q1UA 2AFGA 2Z48A 3NBNA 1IRPA 31BIA 1K5VA 1S0BA 3PUBA 2D44A 3O4AA 4G9MA 1R8NA 1RMLA 4DENA 3RMYA 1IHKA 2VSAA 3BAGA 3POKA 3B9UA 3O3QA 4LO7B 3CA6A 1G82A 3OJMA 1D0HA 2KLLA 5F8WA 1G9DA 3PHZA 4LO8B 1FV2A 5B2HA 2RQ9A 1XG6A 1I1BA 1NZKA 1M2TB 4J2SA 3HMYA 5FZZA 2D7RA 3CAHA 3FUQA 5JLVA 2Q3NB 3O49A 4P0LA 3AJ5A 3VUOA 1QQLA 4II0A 2IHOA 1IJTA 4ISQA 1HWOB 4Z8SB 3BX1C 5GAQA 3BTAA 3O4CA 1Z2VA 3O44A 2GZBA 3QYDA 1ISYA 4IZEA 1V6UA 4IY9A 1R8OA 3VWCA 3AKGA 4KBBA 4PC4A 4YOLA 2MLLB 7I1BA 3A22A 5F8SA 1DQGA 4I2SA 1OQLB 5FZUA 4F83A 3H6RB 3UJ4A 4MZHA 4P0JA 4LO0A 4EB2B 2D23A 4H75A 1KNMA 2KI6B 4H04A 1BASA 3LTQA 2F2FA 3OBRA 2P23A 4QD2B 2NM1A 2DRZA 3WO3A 1JTCA 1W3FA 3H6QA 3EF2A 3WO2A 3I29B 1DJSB 1DQOA 5HPZA 2Y9XE 4I4QA 1TTUA 4GP3A 1ISZA 1RY7A 3KMVA 3WINC 4F34A 1G9AA 2VU9A 2E4MA 4OEGA 4J2KA 1QXMA 2YUGA 2Y9WC 4HR6C 1ISXA 2IWTB 1BLAA 3CA4A 3SNVA 4I4OA 4LO1C 3OJVA 2M49A 2ESUA 3BAVA 2NYYA 1T9FA 3WMVA 1Z4SA 2J3PA 3PMEA 4I4VA 4P0KA 2D43A 3ILAA 3F62B 2D1ZA 3TC2A 4I4UA 3UD8A 1DFCA 3FJKA 4EFQA 4ZBVB 3IIRA 2KKIA 3CRHA 3AKIA 5F90A 4XFTA 1DZCA 2AQZA 3VT1A 3A07A 1YF8B 4ZKTB 1BFGA 2FGFA 4G9NA 1YTOA 4IHZA 1EVTA 3FJAA 1E0OA 5DSSB 3CU1B 3UJ0A 4J2XA 1HIBA 4EFPA 1S0EA 4OEEA 2QYIB 4I3NA 5BP5C 3W9TA 3WA1A 4I0YA 3RMXA 3UDAA 3CA3A 4OWLA 4DEPA 1HKNA 4CJMA 3BA4A 2NP0A 3NBEA 1V6VA 3VSZA 3R4UA 1ISVA 1IILA 3K1XA 1AVWB 3NBDA 1FWVA 2K8RA 2D22A 1W3AA 3FJBA 4I8MA 4XKIA 4X38A 4QKSA 1G9BA 3O4DA 4Z9WB 1S0GA 4I1BA 3IM6A 4I4PA 3VEQA 3JUTA 3VT2A 3BA7A 5E24E 2KI4A 5BXSA 3NJ5A 3HALA 2KH2A 3BAHA 4X3AA 4ZA3B 4Q9GA 4EKXB 1S0DA 2D7IA 4KEKA 3Q7WA 2VXRA 2WRYA 2AAIB 1ONKB 4QALA 3HN1A 2HZ9A 1I1EA 1N4KA 1AXMA 3FJFA 4ZFWB 1SR4C 3OBTA 5EG6C 3MALA 1G9CA 4GAIA 3FGMA 3FJEA 1TWEA 3FJIA 1J0SA 1IRAX 1HCEA 3WINA 4HA2A 3MPPG 2WBCA 5D62A 4A7YA 1Z0HA 2D20A 1TFMB 2X2TA 3S8KA 4IYBA 2Y9GA 1Q04A 3FJCA 2BEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QO3 A;  4LO1 A;  1DIW A;  4OUJ A;  1UPS A;  4LO7 C;  1JLX A;  1BAR A;  3BRF A;  3AH4 A;  4OWJ A;  1CVS A;  21BI A;  2VSE A;  4J23 B;  1JT3 A;  2HW9 A;  1AVU A;  1ISW A;  4I6I A;  4A7Z A;  5BXP A;  1FGA A;  3V79 C;  1JQZ A;  1V6W A;  1HWP B;  4I4X A;  4EFR A;  3O4B A;  41BI A;  4HJJ A;  4I4S A;  2X2S A;  1GGP B;  3FUO A;  1JY0 A;  3T8S A;  1TWM A;  4D0Z A;  4P6A A;  3BA5 A;  2VXT I;  4JPZ A;  3N7M A;  1K5U A;  2DRE A;  1DZD A;  3BAD A;  4EEE B;  3N7L A;  3AZW A;  2FDB M;  3CA5 A;  3FJ8 A;  3JRR A;  5BP5 A;  2ZQN A;  3V0A A;  3BAO A;  5EHA A;  2ZR1 B;  3BAU A;  3FJ9 A;  1S0C A;  4XFU A;  1SZ6 B;  4I4Y A;  1PUM B;  2FFV A;  4I1E A;  2K4A B;  4QD2 C;  5FNW A;  1VCL A;  2QN4 A;  5BQU C;  3BRG C;  3I2X A;  4L4I A;  2GO2 A;  2R9K B;  3IM7 A;  5D63 A;  1ABR B;  3OGF A;  3O5W B;  3WO4 A;  1JT7 A;  4ZLB B;  3HOM A;  6I1B A;  5BVP I;  3HSM A;  4QC4 A;  3IAG C;  3S8J A;  1XHB A;  1RZO B;  1FMZ A;  4QBV A;  2DS0 A;  4D8H A;  2MC2 A;  4G6M A;  5DUY A;  1ITB A;  3O4O A;  4DCK C;  2FO1 A;  2Y9F A;  4R6U B;  4FVV A;  4LO3 C;  1TIE A;  4IZX A;  1SR4 A;  4IY8 A;  3WMU A;  3IM5 A;  5D61 A;  1QQK A;  3AKF A;  3AH1 A;  1AVX B;  3I2A A;  4ZOT A;  1IT0 A;  3AJ6 A;  2ERM A;  4LO2 C;  4TLP A;  3OGG A;  2NVH A;  4I7I A;  4JKQ A;  4X39 A;  4Q91 A;  3CRG A;  3VT0 A;  1PC8 B;  3AH2 A;  4H9W A;  3FFZ A;  4OEF A;  2Q9X A;  1WBC A;  4AN6 A;  3CRI A;  2Z49 A;  3N0K A;  3N7J A;  3R4S A;  4END A;  3BRD A;  4KC3 A;  4ZFU B;  1DLL A;  4USO A;  1XYF A;  3CA0 A;  5EC5 A;  1WBA A;  3A21 A;  3H6S E;  4ZFY B;  4ZGR B;  3RTI B;  2ET2 A;  1F31 A;  4JP0 A;  1NUN A;  1FMM S;  1RG8 A;  4A7K A;  1A8D A;  3PG0 A;  4I96 A;  1M16 A;  4I37 A;  5BXT A;  1L2H A;  2NZ9 A;  3QR5 A;  1EPW A;  4JAW A;  5DZU A;  4AN7 B;  3VSF A;  4FGF A;  1JT5 A;  1JLY A;  1FQ9 A;  1S0F A;  4JRA A;  1YXW A;  4X37 A;  3HBW A;  2P39 A;  5FZY A;  2VUA A;  4GOV A;  1PUU B;  1BFC A;  4QKR A;  2DRY A;  4GAF A;  1FN0 A;  4JKX B;  5BXR A;  2HWA A;  1ILR 1;  3AZV A;  3P53 A;  3OJ2 A;  3A23 A;  4G6J A;  1MD6 A;  1XZZ A;  2XOA A;  3H6R A;  5G00 A;  2MIB A;  9ILB A;  1PZZ A;  1IOB A;  1T4Q A;  5I1B A;  1BA7 A;  2L5X A;  4Q9P A;  4WBC A;  2BEB A;  3V0B B;  4ION A;  5BOW A;  2LIE A;  3D7W B;  3CQA A;  3ZC8 A;  3V0B A;  2F8X C;  1YYN A;  3LLP A;  5JMC A;  5BQU A;  3Q7Y A;  3E8L C;  1CE7 B;  4ISR A;  4I4R A;  1WD4 A;  3UD9 A;  3ZXD A;  3V0A B;  1S0L A;  3N7K A;  1EV2 A;  1BFB A;  1TOO A;  2HWM A;  2LIQ A;  3FJH A;  1V6X A;  3RTJ B;  4D0T A;  3Q7X A;  4LO0 C;  4XFS A;  4IQP A;  1Q03 A;  2RST A;  3P6I A;  3ZX7 A;  3C9Z A;  2UUS A;  2RG9 B;  4OW4 A;  5DVH A;  2F2F C;  2VLC A;  2ZQO A;  1BFF A;  1HWM B;  3CA1 A;  4KEJ A;  1AF9 A;  3F1R A;  2AXM A;  3ZC9 A;  2BFH A;  3NBC A;  3P6J A;  3UD7 A;  1AFC A;  1TP0 A;  4JQ0 A;  4LO3 A;  2D24 A;  4G1R A;  1YBI A;  3FJJ A;  2K43 A;  3BB2 A;  5F8Y A;  1WD3 A;  1DFQ A;  2E4M C;  4OWK A;  4LO2 A;  8I1B A;  1AVA C;  4GOY A;  1FV3 A;  3ZXG A;  1HWN B;  4KEI A;  4J2Y A;  3RSJ A;  1II4 A;  4L4H A;  2I1B A;  4QBC A;  1FWU A;  1MC9 A;  1EYL A;  2NTD A;  4GP0 A;  1BLD A;  1PWA A;  1P63 A;  1W3G A;  2FFU A;  3AKH A;  1HCD A;  3BAQ A;  1JT4 A;  4USP A;  3FJD A;  5FNX A;  1Q1U A;  2AFG A;  2Z48 A;  3NBN A;  1IRP A;  31BI A;  1K5V A;  1S0B A;  3PUB A;  2D44 A;  3O4A A;  4G9M A;  1R8N A;  1RML A;  4DEN A;  3RMY A;  1IHK A;  2VSA A;  3BAG A;  3POK A;  3B9U A;  3O3Q A;  4LO7 B;  3CA6 A;  1G82 A;  3OJM A;  1D0H A;  2KLL A;  5F8W A;  1G9D A;  3PHZ A;  4LO8 B;  1FV2 A;  5B2H A;  2RQ9 A;  1XG6 A;  1I1B A;  1NZK A;  1M2T B;  4J2S A;  3HMY A;  5FZZ A;  2D7R A;  3CAH A;  3FUQ A;  5JLV A;  2Q3N B;  3O49 A;  4P0L A;  3AJ5 A;  3VUO A;  1QQL A;  4II0 A;  2IHO A;  1IJT A;  4ISQ A;  1HWO B;  4Z8S B;  3BX1 C;  5GAQ A;  3BTA A;  3O4C A;  1Z2V A;  3O44 A;  2GZB A;  3QYD A;  1ISY A;  4IZE A;  1V6U A;  4IY9 A;  1R8O A;  3VWC A;  3AKG A;  4KBB A;  4PC4 A;  4YOL A;  2MLL B;  7I1B A;  3A22 A;  5F8S A;  1DQG A;  4I2S A;  1OQL B;  5FZU A;  4F83 A;  3H6R B;  3UJ4 A;  4P0J A;  4LO0 A;  4EB2 B;  2D23 A;  1KNM A;  2KI6 B;  4H04 A;  1BAS A;  3LTQ A;  2F2F A;  3OBR A;  2P23 A;  4QD2 B;  2NM1 A;  2DRZ A;  3WO3 A;  1JTC A;  1W3F A;  3H6Q A;  3EF2 A;  3WO2 A;  3I29 B;  1DJS B;  1DQO A;  5HPZ A;  2Y9X E;  4I4Q A;  1TTU A;  4GP3 A;  1ISZ A;  1RY7 A;  3KMV A;  3WIN C;  4F34 A;  1G9A A;  2VU9 A;  2E4M A;  4OEG A;  4J2K A;  1QXM A;  2YUG A;  2Y9W C;  4HR6 C;  1ISX A;  2IWT B;  1BLA A;  3CA4 A;  3SNV A;  4I4O A;  4LO1 C;  3OJV A;  2M49 A;  2ESU A;  3BAV A;  2NYY A;  1T9F A;  3WMV A;  1Z4S A;  2J3P A;  3PME A;  4I4V A;  4P0K A;  2D43 A;  3ILA A;  3F62 B;  2D1Z A;  3TC2 A;  4I4U A;  3UD8 A;  1DFC A;  3FJK A;  4EFQ A;  4ZBV B;  3IIR A;  2KKI A;  3CRH A;  3AKI A;  5F90 A;  4XFT A;  1DZC A;  2AQZ A;  3VT1 A;  3A07 A;  1YF8 B;  4ZKT B;  1BFG A;  2FGF A;  4G9N A;  1YTO A;  4IHZ A;  1EVT A;  3FJA A;  1E0O A;  5DSS B;  3CU1 B;  3UJ0 A;  4J2X A;  1HIB A;  4EFP A;  1S0E A;  4OEE A;  2QYI B;  4I3N A;  5BP5 C;  3W9T A;  3WA1 A;  4I0Y A;  3RMX A;  3UDA A;  3CA3 A;  4OWL A;  4DEP A;  1HKN A;  4CJM A;  3BA4 A;  2NP0 A;  3NBE A;  1V6V A;  3VSZ A;  3R4U A;  1ISV A;  1IIL A;  3K1X A;  1AVW B;  3NBD A;  1FWV A;  2K8R A;  2D22 A;  1W3A A;  3FJB A;  4I8M A;  4XKI A;  4X38 A;  4QKS A;  1G9B A;  3O4D A;  4Z9W B;  1S0G A;  4I1B A;  3IM6 A;  4I4P A;  3VEQ A;  3JUT A;  3VT2 A;  3BA7 A;  5E24 E;  2KI4 A;  5BXS A;  3NJ5 A;  3HAL A;  2KH2 A;  3BAH A;  4X3A A;  4ZA3 B;  4Q9G A;  4EKX B;  1S0D A;  2D7I A;  4KEK A;  3Q7W A;  2VXR A;  2WRY A;  2AAI B;  1ONK B;  4QAL A;  3HN1 A;  2HZ9 A;  1I1E A;  1N4K A;  1AXM A;  3FJF A;  4ZFW B;  1SR4 C;  3OBT A;  5EG6 C;  3MAL A;  1G9C A;  4GAI A;  3FGM A;  3FJE A;  1TWE A;  3FJI A;  1J0S A;  1IRA X;  1HCE A;  3WIN A;  4HA2 A;  3MPP G;  2WBC A;  5D62 A;  4A7Y A;  1Z0H A;  2D20 A;  1TFM B;  2X2T A;  3S8K A;  4IYB A;  2Y9G A;  1Q04 A;  3FJC A;  2BEA A; 
#chains in the Genus database with same CATH topology
 4QO3 A;  4LO1 A;  1DIW A;  4OUJ A;  1UPS A;  4LO7 C;  1JLX A;  4UY4 A;  1BAR A;  3BRF A;  3AH4 A;  4OWJ A;  1CVS A;  21BI A;  2VSE A;  4J23 B;  1JT3 A;  2HW9 A;  1AVU A;  1ISW A;  4I6I A;  4A7Z A;  5BXP A;  1FGA A;  3V79 C;  1JQZ A;  1V6W A;  1HWP B;  4I4X A;  4EFR A;  3O4B A;  41BI A;  4HJJ A;  4I4S A;  2X2S A;  1GGP B;  3FUO A;  1JY0 A;  3T8S A;  1TWM A;  4D0Z A;  4P6A A;  3BA5 A;  2VXT I;  4JPZ A;  3N7M A;  1K5U A;  2DRE A;  1DZD A;  3BAD A;  4EEE B;  3N7L A;  3AZW A;  2FDB M;  3CA5 A;  3FJ8 A;  3JRR A;  5BP5 A;  2ZQN A;  3V0A A;  3BAO A;  5EHA A;  2ZR1 B;  3BAU A;  3FJ9 A;  1S0C A;  4XFU A;  1SZ6 B;  4I4Y A;  1PUM B;  2FFV A;  4I1E A;  2K4A B;  4QD2 C;  5FNW A;  1VCL A;  2QN4 A;  5BQU C;  3BRG C;  3I2X A;  4L4I A;  2GO2 A;  2R9K B;  3IM7 A;  5D63 A;  1ABR B;  3OGF A;  3O5W B;  3WO4 A;  1JT7 A;  4ZLB B;  3HOM A;  6I1B A;  5BVP I;  3HSM A;  4QC4 A;  3IAG C;  3S8J A;  1XHB A;  1RZO B;  1FMZ A;  4QBV A;  2DS0 A;  4D8H A;  2MC2 A;  4G6M A;  5DUY A;  1ITB A;  3O4O A;  4DCK C;  2FO1 A;  2Y9F A;  4R6U B;  4FVV A;  4LO3 C;  1TIE A;  4IZX A;  1SR4 A;  4IY8 A;  3WMU A;  3IM5 A;  5D61 A;  1QQK A;  3AKF A;  3AH1 A;  1AVX B;  3I2A A;  4ZOT A;  1IT0 A;  3AJ6 A;  2ERM A;  2NS2 A;  4LO2 C;  4TLP A;  3OGG A;  2NVH A;  4I7I A;  4JKQ A;  4X39 A;  4Q91 A;  3CRG A;  3VT0 A;  1PC8 B;  3AH2 A;  4H9W A;  3FFZ A;  4OEF A;  2Q9X A;  1WBC A;  4AN6 A;  3CRI A;  2Z49 A;  3N0K A;  3N7J A;  3R4S A;  4END A;  3BRD A;  4KC3 A;  4ZFU B;  1DLL A;  4USO A;  1XYF A;  3CA0 A;  5EC5 A;  1WBA A;  3A21 A;  3H6S E;  4ZFY B;  4ZGR B;  3RTI B;  2ET2 A;  1F31 A;  4JP0 A;  1NUN A;  1FMM S;  1RG8 A;  4A7K A;  1A8D A;  3PG0 A;  4I96 A;  1M16 A;  4I37 A;  5BXT A;  1L2H A;  2NZ9 A;  3QR5 A;  1EPW A;  4JAW A;  5DZU A;  4AN7 B;  3VSF A;  4FGF A;  1JT5 A;  1JLY A;  1FQ9 A;  1S0F A;  4JRA A;  1YXW A;  4X37 A;  3HBW A;  2P39 A;  5FZY A;  2VUA A;  4GOV A;  1PUU B;  1BFC A;  4QKR A;  2DRY A;  4GAF A;  1FN0 A;  4JKX B;  5BXR A;  2HWA A;  1ILR 1;  3AZV A;  3P53 A;  3OJ2 A;  3A23 A;  4G6J A;  1MD6 A;  1XZZ A;  2XOA A;  3H6R A;  5G00 A;  2MIB A;  9ILB A;  1PZZ A;  1IOB A;  1T4Q A;  5I1B A;  1BA7 A;  2L5X A;  4Q9P A;  4WBC A;  2BEB A;  3V0B B;  4ION A;  5BOW A;  2LIE A;  3D7W B;  3CQA A;  3ZC8 A;  3V0B A;  2F8X C;  1YYN A;  3LLP A;  5JMC A;  5BQU A;  3Q7Y A;  3E8L C;  1CE7 B;  4ISR A;  4MZF B;  4I4R A;  1WD4 A;  3UD9 A;  3ZXD A;  3V0A B;  1S0L A;  3N7K A;  1EV2 A;  1BFB A;  1TOO A;  2HWM A;  2LIQ A;  3FJH A;  1V6X A;  3RTJ B;  4D0T A;  3Q7X A;  4LO0 C;  4XFS A;  4IQP A;  1Q03 A;  2RST A;  3P6I A;  3ZX7 A;  3C9Z A;  2UUS A;  2RG9 B;  4OW4 A;  5DVH A;  2F2F C;  2VLC A;  2ZQO A;  1BFF A;  1HWM B;  3CA1 A;  4KEJ A;  1AF9 A;  3F1R A;  2AXM A;  3ZC9 A;  2BFH A;  3NBC A;  3P6J A;  3UD7 A;  1AFC A;  1TP0 A;  4JQ0 A;  4LO3 A;  2D24 A;  4G1R A;  1YBI A;  3FJJ A;  2K43 A;  3BB2 A;  5F8Y A;  1WD3 A;  1DFQ A;  2E4M C;  4OWK A;  4LO2 A;  8I1B A;  1AVA C;  4GOY A;  4MZG B;  1FV3 A;  3ZXG A;  1HWN B;  4KEI A;  4J2Y A;  3RSJ A;  1II4 A;  4L4H A;  2I1B A;  4QBC A;  1FWU A;  1MC9 A;  1EYL A;  2NTD A;  4GP0 A;  1BLD A;  1PWA A;  1P63 A;  1W3G A;  2FFU A;  3AKH A;  1HCD A;  3BAQ A;  1JT4 A;  4USP A;  3FJD A;  5FNX A;  1Q1U A;  2AFG A;  2Z48 A;  3NBN A;  1IRP A;  31BI A;  1K5V A;  1S0B A;  3PUB A;  2D44 A;  3O4A A;  4G9M A;  1R8N A;  1RML A;  4DEN A;  3RMY A;  1IHK A;  2VSA A;  3BAG A;  3POK A;  3B9U A;  3O3Q A;  4LO7 B;  3CA6 A;  1G82 A;  3OJM A;  1D0H A;  2KLL A;  5F8W A;  1G9D A;  3PHZ A;  4LO8 B;  1FV2 A;  5B2H A;  2RQ9 A;  1XG6 A;  1I1B A;  1NZK A;  1M2T B;  4J2S A;  3HMY A;  5FZZ A;  2D7R A;  3CAH A;  3FUQ A;  5JLV A;  2Q3N B;  3O49 A;  4P0L A;  3AJ5 A;  3VUO A;  1QQL A;  4II0 A;  2IHO A;  1IJT A;  4ISQ A;  1HWO B;  4Z8S B;  3BX1 C;  5GAQ A;  3BTA A;  3O4C A;  1Z2V A;  3O44 A;  2GZB A;  3QYD A;  1ISY A;  4IZE A;  1V6U A;  4IY9 A;  1R8O A;  3VWC A;  3AKG A;  4KBB A;  4PC4 A;  4YOL A;  2MLL B;  7I1B A;  3A22 A;  5F8S A;  1DQG A;  4I2S A;  1OQL B;  5FZU A;  4F83 A;  3H6R B;  3UJ4 A;  4MZH A;  4P0J A;  4LO0 A;  4EB2 B;  2D23 A;  4H75 A;  1KNM A;  2KI6 B;  4H04 A;  1BAS A;  3LTQ A;  2F2F A;  3OBR A;  2P23 A;  4QD2 B;  2NM1 A;  2DRZ A;  3WO3 A;  1JTC A;  1W3F A;  3H6Q A;  3EF2 A;  3WO2 A;  3I29 B;  1DJS B;  1DQO A;  5HPZ A;  2Y9X E;  4I4Q A;  1TTU A;  4GP3 A;  1ISZ A;  1RY7 A;  3KMV A;  3WIN C;  4F34 A;  1G9A A;  2VU9 A;  2E4M A;  4OEG A;  4J2K A;  1QXM A;  2YUG A;  2Y9W C;  4HR6 C;  1ISX A;  2IWT B;  1BLA A;  3CA4 A;  3SNV A;  4I4O A;  4LO1 C;  3OJV A;  2M49 A;  2ESU A;  3BAV A;  2NYY A;  1T9F A;  3WMV A;  1Z4S A;  2J3P A;  3PME A;  4I4V A;  4P0K A;  2D43 A;  3ILA A;  3F62 B;  2D1Z A;  3TC2 A;  4I4U A;  3UD8 A;  1DFC A;  3FJK A;  4EFQ A;  4ZBV B;  3IIR A;  2KKI A;  3CRH A;  3AKI A;  5F90 A;  4XFT A;  1DZC A;  2AQZ A;  3VT1 A;  3A07 A;  1YF8 B;  4ZKT B;  1BFG A;  2FGF A;  4G9N A;  1YTO A;  4IHZ A;  1EVT A;  3FJA A;  1E0O A;  5DSS B;  3CU1 B;  3UJ0 A;  4J2X A;  1HIB A;  4EFP A;  1S0E A;  4OEE A;  2QYI B;  4I3N A;  5BP5 C;  3W9T A;  3WA1 A;  4I0Y A;  3RMX A;  3UDA A;  3CA3 A;  4OWL A;  4DEP A;  1HKN A;  4CJM A;  3BA4 A;  2NP0 A;  3NBE A;  1V6V A;  3VSZ A;  3R4U A;  1ISV A;  1IIL A;  3K1X A;  1AVW B;  3NBD A;  1FWV A;  2K8R A;  2D22 A;  1W3A A;  3FJB A;  4I8M A;  4XKI A;  4X38 A;  4QKS A;  1G9B A;  3O4D A;  4Z9W B;  1S0G A;  4I1B A;  3IM6 A;  4I4P A;  3VEQ A;  3JUT A;  3VT2 A;  3BA7 A;  5E24 E;  2KI4 A;  5BXS A;  3NJ5 A;  3HAL A;  2KH2 A;  3BAH A;  4X3A A;  4ZA3 B;  4Q9G A;  4EKX B;  1S0D A;  2D7I A;  4KEK A;  3Q7W A;  2VXR A;  2WRY A;  2AAI B;  1ONK B;  4QAL A;  3HN1 A;  2HZ9 A;  1I1E A;  1N4K A;  1AXM A;  3FJF A;  4ZFW B;  1SR4 C;  3OBT A;  5EG6 C;  3MAL A;  1G9C A;  4GAI A;  3FGM A;  3FJE A;  1TWE A;  3FJI A;  1J0S A;  1IRA X;  1HCE A;  3WIN A;  4HA2 A;  3MPP G;  2WBC A;  5D62 A;  4A7Y A;  1Z0H A;  2D20 A;  1TFM B;  2X2T A;  3S8K A;  4IYB A;  2Y9G A;  1Q04 A;  3FJC A;  2BEA A; 
#chains in the Genus database with same CATH homology
 4QO3 A;  4LO1 A;  1DIW A;  4OUJ A;  1UPS A;  4LO7 C;  1JLX A;  4UY4 A;  1BAR A;  3BRF A;  3AH4 A;  4OWJ A;  1CVS A;  21BI A;  2VSE A;  4J23 B;  1JT3 A;  2HW9 A;  1AVU A;  1ISW A;  4I6I A;  4A7Z A;  5BXP A;  1FGA A;  3V79 C;  1JQZ A;  1V6W A;  1HWP B;  4I4X A;  4EFR A;  3O4B A;  41BI A;  4HJJ A;  4I4S A;  2X2S A;  1GGP B;  3FUO A;  1JY0 A;  3T8S A;  1TWM A;  4D0Z A;  4P6A A;  3BA5 A;  2VXT I;  4JPZ A;  3N7M A;  1K5U A;  2DRE A;  1DZD A;  3BAD A;  4EEE B;  3N7L A;  3AZW A;  2FDB M;  3CA5 A;  3FJ8 A;  3JRR A;  5BP5 A;  2ZQN A;  3V0A A;  3BAO A;  5EHA A;  2ZR1 B;  3BAU A;  3FJ9 A;  1S0C A;  4XFU A;  1SZ6 B;  4I4Y A;  1PUM B;  2FFV A;  4I1E A;  2K4A B;  4QD2 C;  5FNW A;  1VCL A;  2QN4 A;  5BQU C;  3BRG C;  3I2X A;  4L4I A;  2GO2 A;  2R9K B;  3IM7 A;  5D63 A;  1ABR B;  3OGF A;  3O5W B;  3WO4 A;  1JT7 A;  4ZLB B;  3HOM A;  6I1B A;  5BVP I;  3HSM A;  4QC4 A;  3IAG C;  3S8J A;  1XHB A;  1RZO B;  1FMZ A;  4QBV A;  2DS0 A;  4D8H A;  2MC2 A;  4G6M A;  5DUY A;  1ITB A;  3O4O A;  4DCK C;  2FO1 A;  2Y9F A;  4R6U B;  4FVV A;  4LO3 C;  1TIE A;  4IZX A;  1SR4 A;  4IY8 A;  3WMU A;  3IM5 A;  5D61 A;  1QQK A;  3AKF A;  3AH1 A;  1AVX B;  3I2A A;  4ZOT A;  1IT0 A;  3AJ6 A;  2ERM A;  2NS2 A;  4LO2 C;  4TLP A;  3OGG A;  2NVH A;  4I7I A;  4JKQ A;  4X39 A;  4Q91 A;  3CRG A;  3VT0 A;  1PC8 B;  3AH2 A;  4H9W A;  3FFZ A;  4OEF A;  2Q9X A;  1WBC A;  4AN6 A;  3CRI A;  2Z49 A;  3N0K A;  3N7J A;  3R4S A;  4END A;  3BRD A;  4KC3 A;  4ZFU B;  1DLL A;  4USO A;  1XYF A;  3CA0 A;  5EC5 A;  1WBA A;  3A21 A;  3H6S E;  4ZFY B;  4ZGR B;  3RTI B;  2ET2 A;  1F31 A;  4JP0 A;  1NUN A;  1FMM S;  1RG8 A;  4A7K A;  1A8D A;  3PG0 A;  4I96 A;  1M16 A;  4I37 A;  5BXT A;  1L2H A;  2NZ9 A;  3QR5 A;  1EPW A;  4JAW A;  5DZU A;  4AN7 B;  3VSF A;  4FGF A;  1JT5 A;  1JLY A;  1FQ9 A;  1S0F A;  4JRA A;  1YXW A;  4X37 A;  3HBW A;  2P39 A;  5FZY A;  2VUA A;  4GOV A;  1PUU B;  1BFC A;  4QKR A;  2DRY A;  4GAF A;  1FN0 A;  4JKX B;  5BXR A;  2HWA A;  1ILR 1;  3AZV A;  3P53 A;  3OJ2 A;  3A23 A;  4G6J A;  1MD6 A;  1XZZ A;  2XOA A;  3H6R A;  5G00 A;  2MIB A;  9ILB A;  1PZZ A;  1IOB A;  1T4Q A;  5I1B A;  1BA7 A;  2L5X A;  4Q9P A;  4WBC A;  2BEB A;  3V0B B;  4ION A;  5BOW A;  2LIE A;  3D7W B;  3CQA A;  3ZC8 A;  3V0B A;  2F8X C;  1YYN A;  3LLP A;  5JMC A;  5BQU A;  3Q7Y A;  3E8L C;  1CE7 B;  4ISR A;  4MZF B;  4I4R A;  1WD4 A;  3UD9 A;  3ZXD A;  3V0A B;  1S0L A;  3N7K A;  1EV2 A;  1BFB A;  1TOO A;  2HWM A;  2LIQ A;  3FJH A;  1V6X A;  3RTJ B;  4D0T A;  3Q7X A;  4LO0 C;  4XFS A;  4IQP A;  1Q03 A;  2RST A;  3P6I A;  3ZX7 A;  3C9Z A;  2UUS A;  2RG9 B;  4OW4 A;  5DVH A;  2F2F C;  2VLC A;  2ZQO A;  1BFF A;  1HWM B;  3CA1 A;  4KEJ A;  1AF9 A;  3F1R A;  2AXM A;  3ZC9 A;  2BFH A;  3NBC A;  3P6J A;  3UD7 A;  1AFC A;  1TP0 A;  4JQ0 A;  4LO3 A;  2D24 A;  4G1R A;  1YBI A;  3FJJ A;  2K43 A;  3BB2 A;  5F8Y A;  1WD3 A;  1DFQ A;  2E4M C;  4OWK A;  4LO2 A;  8I1B A;  1AVA C;  4GOY A;  4MZG B;  1FV3 A;  3ZXG A;  1HWN B;  4KEI A;  4J2Y A;  3RSJ A;  1II4 A;  4L4H A;  2I1B A;  4QBC A;  1FWU A;  1MC9 A;  1EYL A;  2NTD A;  4GP0 A;  1BLD A;  1PWA A;  1P63 A;  1W3G A;  2FFU A;  3AKH A;  1HCD A;  3BAQ A;  1JT4 A;  4USP A;  3FJD A;  5FNX A;  1Q1U A;  2AFG A;  2Z48 A;  3NBN A;  1IRP A;  31BI A;  1K5V A;  1S0B A;  3PUB A;  2D44 A;  3O4A A;  4G9M A;  1R8N A;  1RML A;  4DEN A;  3RMY A;  1IHK A;  2VSA A;  3BAG A;  3POK A;  3B9U A;  3O3Q A;  4LO7 B;  3CA6 A;  1G82 A;  3OJM A;  1D0H A;  2KLL A;  5F8W A;  1G9D A;  3PHZ A;  4LO8 B;  1FV2 A;  5B2H A;  2RQ9 A;  1XG6 A;  1I1B A;  1NZK A;  1M2T B;  4J2S A;  3HMY A;  5FZZ A;  2D7R A;  3CAH A;  3FUQ A;  5JLV A;  2Q3N B;  3O49 A;  4P0L A;  3AJ5 A;  3VUO A;  1QQL A;  4II0 A;  2IHO A;  1IJT A;  4ISQ A;  1HWO B;  4Z8S B;  3BX1 C;  5GAQ A;  3BTA A;  3O4C A;  1Z2V A;  3O44 A;  2GZB A;  3QYD A;  1ISY A;  4IZE A;  1V6U A;  4IY9 A;  1R8O A;  3VWC A;  3AKG A;  4KBB A;  4PC4 A;  4YOL A;  2MLL B;  7I1B A;  3A22 A;  5F8S A;  1DQG A;  4I2S A;  1OQL B;  5FZU A;  4F83 A;  3H6R B;  3UJ4 A;  4MZH A;  4P0J A;  4LO0 A;  4EB2 B;  2D23 A;  4H75 A;  1KNM A;  2KI6 B;  4H04 A;  1BAS A;  3LTQ A;  2F2F A;  3OBR A;  2P23 A;  4QD2 B;  2NM1 A;  2DRZ A;  3WO3 A;  1JTC A;  1W3F A;  3H6Q A;  3EF2 A;  3WO2 A;  3I29 B;  1DJS B;  1DQO A;  5HPZ A;  2Y9X E;  4I4Q A;  1TTU A;  4GP3 A;  1ISZ A;  1RY7 A;  3KMV A;  3WIN C;  4F34 A;  1G9A A;  2VU9 A;  2E4M A;  4OEG A;  4J2K A;  1QXM A;  2YUG A;  2Y9W C;  4HR6 C;  1ISX A;  2IWT B;  1BLA A;  3CA4 A;  3SNV A;  4I4O A;  4LO1 C;  3OJV A;  2M49 A;  2ESU A;  3BAV A;  2NYY A;  1T9F A;  3WMV A;  1Z4S A;  2J3P A;  3PME A;  4I4V A;  4P0K A;  2D43 A;  3ILA A;  3F62 B;  2D1Z A;  3TC2 A;  4I4U A;  3UD8 A;  1DFC A;  3FJK A;  4EFQ A;  4ZBV B;  3IIR A;  2KKI A;  3CRH A;  3AKI A;  5F90 A;  4XFT A;  1DZC A;  2AQZ A;  3VT1 A;  3A07 A;  1YF8 B;  4ZKT B;  1BFG A;  2FGF A;  4G9N A;  1YTO A;  4IHZ A;  1EVT A;  3FJA A;  1E0O A;  5DSS B;  3CU1 B;  3UJ0 A;  4J2X A;  1HIB A;  4EFP A;  1S0E A;  4OEE A;  2QYI B;  4I3N A;  5BP5 C;  3W9T A;  3WA1 A;  4I0Y A;  3RMX A;  3UDA A;  3CA3 A;  4OWL A;  4DEP A;  1HKN A;  4CJM A;  3BA4 A;  2NP0 A;  3NBE A;  1V6V A;  3VSZ A;  3R4U A;  1ISV A;  1IIL A;  3K1X A;  1AVW B;  3NBD A;  1FWV A;  2K8R A;  2D22 A;  1W3A A;  3FJB A;  4I8M A;  4XKI A;  4X38 A;  4QKS A;  1G9B A;  3O4D A;  4Z9W B;  1S0G A;  4I1B A;  3IM6 A;  4I4P A;  3VEQ A;  3JUT A;  3VT2 A;  3BA7 A;  5E24 E;  2KI4 A;  5BXS A;  3NJ5 A;  3HAL A;  2KH2 A;  3BAH A;  4X3A A;  4ZA3 B;  4Q9G A;  4EKX B;  1S0D A;  2D7I A;  4KEK A;  3Q7W A;  2VXR A;  2WRY A;  2AAI B;  1ONK B;  4QAL A;  3HN1 A;  2HZ9 A;  1I1E A;  1N4K A;  1AXM A;  3FJF A;  4ZFW B;  1SR4 C;  3OBT A;  5EG6 C;  3MAL A;  1G9C A;  4GAI A;  3FGM A;  3FJE A;  1TWE A;  3FJI A;  1J0S A;  1IRA X;  1HCE A;  3WIN A;  4HA2 A;  3MPP G;  2WBC A;  5D62 A;  4A7Y A;  1Z0H A;  2D20 A;  1TFM B;  2X2T A;  3S8K A;  4IYB A;  2Y9G A;  1Q04 A;  3FJC A;  2BEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...