1II8B

Crystal structure of the p. furiosus rad50 atpase domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
174
structure length
174
Chain Sequence
RERVKKEIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rad50 ABC-ATPase
publication title Structural biochemistry and interaction architecture of the DNA double-strand break repair Mre11 nuclease and Rad50-ATPase.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication
total genus 51
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2001-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ii8B01
2C77A 2F43B 1U90A 1HEIA 4NE2A 1W0KD 4WZ6A 4EPYA 1D2EA 2QAGA 1G8FA 1SVSA 4PFSA 3SJAA 2QPAA 5FUXA 3DPUA 2Q9CA 2EVWX 3ZYCA 3SQWA 4Q18A 1DG1G 2V3CC 2F3RA 3AVUA 1E0SA 4LWZA 4UXHA 5IK2D 5CM8B 1KJYA 2A78A 2CE2X 2CVFA 3TBKA 3WHLA 3TW8B 4ZCIA 2AFIE 2QPOA 5CITA 4D26A 3WRXC 1KAGA 3OIYA 3Q5DA 2EW1A 4ZDIA 2QQEA 1S2MA 2DR3A 1IOZA 4MYCA 4BFUA 1Z22A 4KXFB 3HR7A 4CGZA 1XEFA 3N2IA 5L3QA 4OQFA 3EIEA 2ZSEA 4PR0A 5AUQA 1XD8A 2CLSA 3QF4A 2GHIA 4KFTA 4BFYA 821PA 3OFNA 4JL5A 4XD7D 3GLHB 1E4YA 3H4MA 5HCIA 1TAGA 1XMJA 5CLLA 4PSVA 2KJQA 2PCJA 4DDWA 3KQNA 4Q4LA 5D3QA 1XNJA 2PZFA 1M6NA 5J5CA 2WWYA 1W46A 3CH4B 2V1UA 1G3UA 3AVOA 4DZZA 1US8B 1RE0A 3AF2A 3NDPA 1I2MA 5CIQA 1SVLA 2WICA 4HSEA 4PHFA 4MRRA 2IWRA 3C8UA 2EYUA 2AXNA 4NZYA 2F55A 1KSHA 1S96A 1JEEA 3OIUA 3QIAA 4KVGA 3HU1A 1OYWA 2FV8A 1Z08A 3SS8A 2ZRCA 4EPXA 2IA5A 4Z8XA 4ASUD 4LPKA 5K8LA 3EIQA 1NMZA 3IHWA 2CLDX 2J7PD 2ZRIA 4PQYA 4DLSA 2AKYA 4LI0A 1XPOA 1F2UA 1N3BA 1WQ1R 2SHKA 2QENA 5EXSA 3FHTA 2OBLA 4A6PA 5B2ZA 3VFDA 3AV0B 4JLOA 5IHPA 3W6PA 4B43A 3HU3A 4BFSA 3CB4A 1P2SA 2ZRKA 4OQMA 3CRMA 2O8BB 3OZXA 1UAAA 1GNRA 1T6NA 4KSCA 5B58C 1YZTA 2IYRA 3LQQA 3RWMB 1ESMA 1AN0A 1MABB 4PQRA 4RCZA 4C0BA 2GJ8A 2CXXA 2XAUA 2HT6A 2G0TA 4WIAA 4P4SA 4BFVA 1NVXQ 2RHDA 5IT5A 4NP6A 2BM1A 4DJTA 4DEYA 4TZ6A 4Q01A 1Z2AA 2QE7D 1KYIA 1E69A 4JLJA 1XP8A 1II8B 1GL9B 2ZRAA 3ZVMA 4G5QA 4Q4HB 4YMSA 2HLDD 3EAQA 3EW9A 1QRAA 4M1KA 1NSFA 1ZYUA 3ONWA 3PV0A 4TMKA 3U3RA 1U9IC 4BFXA 4OHVA 4BFTA 2QTHA 1LF5A 3EASA 1OXXK 1X1RA 1NRJB 3QKRB 3U2QA 2NO7A 1E9FA 3BK7A 3CRVA 3O8RA 4DCUA 4TQAA 3A36A 4YLGA 1R5OA 3QI2A 4YMUA 4JSTA 1RRFA 4NYMR 4P31A 1E2PA 3I32A 2FZLA 2Z6VA 2XJ4A 2G0NA 1E2EA 4M53A 4F4IA 4NBSA 2PX3A 3H84A 5IDVA 1H8ED 3CF2A 1JBKA 4X8HA 2X2FA 2AWOA 2HJVA 1NSTA 3RDPA 2ASEA 1YHNA 4HLQB 1GKYA 1ZNYA 4POAA 2JLZA 5BYJA 3RSOA 1YZLA 4BUJA 4FMDF 4D4LA 4OKSA 4D25A 1ZM2A 1G5TA 2ZJZA 3QUSA 5FBQB 2OO7A 1OPXA 3PENA 2YWFA 2DY1A 3PXGA 3LAWA 4DEXA 1FZQA 2FX3A 1D6JA 1E94E 3LFUA 3ZJYA 4URXR 1C4OA 1EK0A 2OG2A 1L8QA 2RMKA 1XEXA 3CPJB 2JIZA 1P73A 2EWWA 1ZM3A 1T91A 1CBUA 1X8LA 2WJHA 3U4QA 4AYWA 4F4CA 1Z0IA 3UMFA 3BE4A 4B2IA 4ZDKA 3LW8A 4MKHA 1AK2A 2AL7A 2HJGA 4GOKA 3CKLA 4IEEA 4DIEA 2IYQA 5JHGB 2BMDA 3EA0A 1S3SA 5HZHA 1ZUNB 4NCKA 4V0MA 2OAP1 1GKUB 2RGGA 4IVPA 3R20A 1N6PA 1UKZA 1CJMA 2IYTA 1N0WA 1OXTA 1EFRA 1ZVQA 4GZLA 2IS4A 1G3RA 3B7GA 2WM9B 4JVLA 4W5WA 4ESVA 4H1VA 3K9LA 4BFZA 1TL7C 2F1IA 1IHUA 3L8YA 1COWA 4IEIA 2IEZA 4WXRA 1UEIA 3SBEA 3RS5A 3RWOA 3VX4A 3KQUA 2QBYB 1XX6A 5TV2A 4JBXA 3TIFA 4TYNA 4HLUA 4UQOA 4H1UA 4FMCB 2CK3A 2J9RA 2QMEA 4U00A 3RRYA 4IHQA 3VAAA 1GILA 4LX0A 2FN4A 3G5UA 1E2DA 4BLSA 2MMGA 2QROA 4KYIB 5EE1A 2ZE8A 2RKOA 2H92A 3KJGA 4JVMA 3W3AA 3WP0A 1PLLA 3LV8A 4FN5A 1YZQA 3FDIA 4TTRA 1CEEA 1P3JA 4II7A 4RZ2A 1NL3A 3DM9B 3EARA 5CK4A 3WNDA 2WJGA 4Q7JB 4ZKEA 2O8FA 2AR7A 2JATA 4TQUS 3GLHE 5JSZA 5DE3A 4CEHA 1J8YF 2GNOA 5JJKA 1W48A 2FFBA 5AWFC 1U94A 3K09C 4M8NE 3LVQE 4QBFA 5LBIA 1E1RA 3QEJA 4OHZA 1XJ0A 4LBVA 2OBMA 4NYMQ 3UWOA 4BZQA 3KZ1E 2C99A 1LVGA 5DI3B 2FEOA 4AKEA 2RAPA 2WBLC 1R0WA 3BFKA 3VTKA 4EIWA 4UNRA 5LDDC 1R2QA 3U7HB 4BLPA 1ZUHA 2IS6A 3TSOA 1QHXA 5AUNB 1EESA 1TNDA 3ADBA 2AWNA 3AF4A 2FMXA 4A0HA 5J4HA 4URVR 5F3WB 3QXCA 4L15A 2EWVA 3WYGA 2BMJA 2FZ4A 1X86B 3VR2A 2C5LA 2NZJA 4JSYA 3P20A 4DWJA 2CCGA 4M1WA 3C15C 4LHZA 2LCFA 5BQ5A 3B1XA 2QL6A 2A5JA 2ZRHA 4KCGA 1CULC 4QBGB 2QTVB 1WBDA 4ZCLA 4W5JA 2D06A 1MR3F 4UNNA 4TMWA 1U8AA 4OHWA 4RZ3A 1CR4A 1P75A 2R8RA 4DSTA 4XVRA 4FXPA 1E9EA 4TTQA 4P4TA 1ZM9A 5JFGA 2BKUA 5C4MA 4LY6A 3T06B 1G8PA 1M2OB 2R44A 4C0KA 5JJIA 4KYUA 4DDTA 2C2HA 3P4YA 1BH2A 2YWGA 3DKVA 4EFLA 2YNMA 3F8TA 2GAOA 1QHGA 4ITRC 1II0A 4LV5B 2XB4A 4CVNA 3LH5A 1ZC3A 3HU2A 5EP2A 1KDPA 1XFAA 3GLFB 1RKBA 1W5SA 3U44A 1R4AA 1DELA 1J7KA 4IXNA 1P62B 3CNNA 2EFDB 2PZGA 4DC9A 1Z6YA 4G5OA 2WMOB 5EZ6B 4V0NA 5FL7D 2PH1A 4WAUA 4V0KA 5KNCA 4HZUB 1JQJC 1W4AA 2JLSA 1E9CA 4TTPA 3GLIE 1DAHA 3DO6A 3B1ZA 3PUZA 3AKCA 4PXAA 2YOGA 4GI7A 4MRPA 2IUUA 5HKKA 3BC1A 5EXXA 1I4TD 4OQXA 1E6CA 2W83A 3ZVRA 4KLNA 1OHHA 3ZQJA 3FMOB 2BBOA 4M9QA 1T9HA 4B34A 1U2RA 1CJTC 3GLHA 3G0HA 2GJ9A 4NL4H 1H8HA 1WA5A 2PX0A 1KK0A 3D8BA 3UPUA 1N5KA 5EP3A 1IXZA 2KBFA 2F1HA 3Q5EA 5FPSA 3CWQA 3U3OA 2GTPA 2UZ3A 3MSXA 1P2UA 1LFDB 2P6UA 1YZNA 2D3WA 2GEVA 1GKIA 1IXRC 3ZZUA 1TADA 4XJXA 1US8A 5KDOA 4LHWA 2OLJA 1RRCA 3BBPA 4TLBA 1P4SA 2GESA 1MT0A 5SZKB 2PT5A 1XPRA 3NVAA 2B92A 2AK2A 2ORIA 3DEFA 3W8NA 4ACBA 2IYYA 3NEYA 1SVWA 3CH5A 3KQHA 2PEYA 1ZM7A 5J4LA 3TQFA 2Z83A 2WWGA 5CDFA 1KKLA 1XZQA 1W7AA 5L3RA 1FP6A 1TQDA 2ZYUX 3CPEA 4KLZA 2J0SA 1OFIA 1KZGB 1IM2A 1HY3A 2G83A 5LB2A 5JBQA 4PPFA 2R62A 2GCOB 2D7CA 1QZXA 4I99A 4PC6A 3BH7A 4B2LA 4YDSA 4P32A 3KKNA 2ODNA 3MJRA 3L2OB 1Q1BA 1E96A 2V7QD 3GEEA 3LQRA 1G3QA 4DUGD 5EE0A 4Q9HA 4B3BA 3ZD7A 4B74A 1GRNA 4HDOB 4F91B 2R65A 2ZJBA 5KSZA 2ERYA 4ABYA 1AZTA 5KYKA 3FKQA 4OL0A 1CF4A 4B3DA 5CYPA 5DSZA 3U3JA 3K0CA 5TY0A 3SBDA 3AKDA 1KSFX 4Q4AB 3UK6A 4JKIA 4D81A 4BLOA 4BEJA 2ZAMA 2BCGY 2OXCA 1ZNXA 3QKUA 5JWHA 4E22A 3LWNA 1KDTA 1SULA 1S9HA 3B9QA 1E0KA 4KAXA 5CM9C 4JLDA 3V4FA 3IO3A 3EA5A 5B57C 1AIPA 1SKYE 2A5FA 1E99A 3NBXX 2XJ9A 4O0MA 3MAAC 2DWPA 2J45A 4FMBB 4HI0E 4A82A 1CS4C 3IUYA 4A8JC 3NC1C 2JLRA 1Z06A 1W0JA 2R6DA 2X8AA 4AG6A 4FI3C 1G4UR 1M8PA 2Z4SA 3TQCA 421PA 3OF5A 3QKRA 1GAJA 1AGPA 4TL9A 5A5GA 1S3GA 4HDCA 4A4DA 3GLIA 1DEKA 3LLUA 3A1WA 2N42A 3FFAA 4HATA 1U8YA 2Z43A 4ZO4A 1YZUA 3VX3A 4OQLA 1KMHA 1G291 1R8SA 2H1LA 4KBGA 4B3GA 1G3MA 1EFTA 1Q1QA 2GILA 3K0AB 4TLAA 4C30A 1CR1A 4OJKA 4JLNA 5AJZA 3IBGA 2QA5A 2W6IA 4HB0A 2WV9A 3FKSA 4R2HA 4A2PA 2V6IA 1YR9A 2A7QA 4X8OA 3R7WB 1U98A 3THWA 4M1MA 5IRCD 4ON9A 2QN6A 3SU8A 5TARA 3BWDD 1VCNA 2CCJA 2ZJ8A 2X2EA 4M9ZA 4RZUA 3RANA 1SVOA 2GK7A 4FIDA 3AP2A 1HYQA 2XNDD 3ASZA 3ZZTA 5F2EA 1T0HB 3CW2A 3TVTA 3X1XA 4QKQA 3I62A 2JEOA 4Q1AA 4TL6A 1SZPA 2N46A 2VEDA 3AVQA 3KL4A 2CEAA 2ZS8A 4DB2A 1Z2CA 3GFTA 3TSWA 4RJLA 3RRZA 5DH9A 2QT1A 3QQ5A 1TTTA 2KE5A 4IFBA 1T5LA 4TT3A 3REFA 1B0UA 2ZI7A 3LBIA 4GNKA 3ND8A 3UIEA 1IN8A 5UKDA 1EX6A 2ZU6A 2YHSA 3ZGXA 3RRNA 2FFAA 4R9UC 2OFWA 1DE0A 1Z28A 3MCAA 1Z6TA 2I1VB 4I4LA 1Q22A 2X77A 4B6EA 2ATXA 3TUJC 3GLFE 4DLRA 4LC1A 4DB4A 1OKKA 1G7CA 3W34A 2BM0A 4EKDA 4LV6A 1NBMA 4Q4JA 1FOEB 4AK9A 3J81k 4QGHA 4YC7A 2QBYA 1XMVA 5FI0B 4E5UA 2VP4A 4AYXA 5KDDA 5J47A 1SXJA 1LF0A 4ESHA 5H68A 3ZS8A 2FPLA 2QT0A 3AP3A 1OT3A 2YC4C 4TYWA 1Z5ZA 2PMKA 1XTQA 2X19A 4KFUA 3RNLA 2FDCA 3LDAA 5FOUA 3A8TA 3KQKA 4Q00A 3OIVA 2NIPA 5EE5B 4DLVA 3VMFA 3SDZA 3EX7C 3BJIC 3R9WA 5AJXA 3OEHD 3TK1A 4LRWA 2EQBA 5HE9A 4CYMA 3U7GA 1N5JA 2OBNA 3UG7A 3BH0A 4Q1CA 2C98A 3NHBA 4QRHA 4Y0AA 2BJVA 1CP2A 2ZSBA 1G7RA 2ZXUA 4KHZA 1K6MA 1UDXA 2G77B 2BBWA 1R0ZA 1BOFA 1E79A 3B1WA 4BLRA 1ZBDA 1EFUA 4JLMA 3GPLA 2H7VA 2JASA 3MJHA 4NHOA 4QNRA 1DAGA 2PZEA 4A8JB 2IYSA 2RHMA 5DI3A 1U9IA 4MRNA 5JI3E 1S1MA 1CXZA 4AKGA 1R10A 1D8TA 1S9DA 1VDZA 4PO8A 2OCAA 4NPHA 3SEAA 3A58B 1JAIA 1P2TA 3HYRA 5K8IA 3VKGA 2ZROA 3K0FB 4L8GA 3F5FA 4B6FA 2BEKA 2NPIA 1A82A 1G5PA 3C5CA 5CIWA 3D7MA 2XZLA 1ZRHA 4BE7B 1FW6A 4Q7MB 2OE2A 1G17A 1CJUC 1G19A 2ZRBA 3RYTC 3WXMA 3THXB 2GCNA 1LS6A 1ZUIA 5DLQC 5FOWA 1LY1A 5BN5A 3S1AB 1W47A 3IIJA 5GJWC 2OXRA 1QBKC 4JLPA 4Q19A 5EUMA 2VRWA 4Q1BA 1P60A 3AVWA 4LYHA 3H1TA 1RW4A 3BOSA 3W3ZB 1I4LD 4BLQA 2P65A 4URWR 5FUYA 4AI6A 3QJYA 4R98A 1RRPA 4DCSA 1OH8A 4M1OA 4NCJA 2VF8A 3GJ8A 2PJRA 2XZPA 2C04A 5HE8A 4TMXA 2YC2C 4JYCA 1QDEA 4K46A 2WSMA 2ZI5A 3NBFA 1CU1A 1QF9A 2ZR7A 3VU9B 5KTYA 4C0SA 2B21A 4PC2A 4DCTA 1J99A 5CK5A 2WWHA 2YOFA 3BS4A 1TU4A 1UKYA 2FNAA 3PEUA 4NTZA 2ZPTX 2V9PA 1UBCA 2A2ZA 2WVJA 3D6TB 2G88A 3GLFA 1A4RA 1IY2A 4MGZR 2XTNA 6Q21A 3WMFA 3A1TA 1BIFA 4QXAA 2GVDC 4KI0A 1NVVR 1E9SA 2ZR0A 4MITA 4OK6A 4KFSA 4R7ZA 2O0KA 3O8BA 5EE9A 2AFHE 3IPYA 4NONA 4C7OA 1JAHA 2DFNA 2Q21A 5FH9A 2XOKA 3M0EA 4QC2A 2J0VA 1G8HA 2QGZA 2XSZD 4JMPA 3KFVA 4QGAA 4EQ6B 2VPPA 5GVRA 1JR3E 2WWIA 2EFEB 2VSOA 4TL7A 2F3TA 2IHBA 2YJTD 2GZHA 3TJZA 2FSIA 3IGFA 3RRMA 4WZAE 1VTKA 1OV4A 2ZETA 1JR3D 4WXPA 1LW7A 2WIBA 3QXSA 3WMEA 3THYA 4D4MA 1N0UA 5E3HA 2Q3FA 2IEYA 2CNWD 1XD2A 4PANA 1E9BA 4D4JA 2IYZA 3BORA 1R5BA 2OT3B 3BB1A 4LHXA 3MG9A 4GDFA 3PIRA 1YE8A 1T5IA 5TMPA 1XTRA 2FU5C 1MRNA 2BHRA 3X2SA 1KDOA 1OB2A 1ZC4A 1AZSC 4XWAA 3PQCA 1KO4A 4NH0A 3GCGA 4TYPA 4BEBA 2WIAA 4ARZB 4G0NA 2VYFA 2I4IA 2PL3A 3QF7A 4Q7LA 4D2IA 1AS0A 4US2R 3NHAA 4H9GA 3W6NA 1ODFA 2RGXA 2GCOA 1B23P 5KPDA 2RH5A 5FOVA 1RPZA 3VNVA 1FNNA 3I8XA 2IYUA 1Y63A 3VKHA 3TLXA 4QHSA 4JL6A 4RFSB 1Z63A 5JS7A 2J1LA 4MRVA 4B3CA 2GXSA 4ZIRA 1MO3A 4IOKA 3OIWA 3F3YA 3K53A 5KHOC 3U6KA 3IIKA 3B1VA 1DAKA 3SYKA 1YRBA 1FPMA 4HAVA 5C1BA 3SN6A 4QM6A 2DCUA 1QHHB 2WPDA 5M04A 5BW8A 1KNQA 4N0EA 2ZU0C 1JQLB 5BN4A 3BAFA 2ERXA 5FUWA 3JZMA 2CL0X 3GJ5A 1A2KC 1KJZA 3GLGE 1ZNWA 1G6OA 5H1YA 3QPUA 4RD3A 1Q20A 2H57A 1ZAKA 1GNQA 3K8YA 4FINA 4X8MA 3CX8A 4FD2A 2F1JA 1W0KA 4PPQA 1OFTA 2GCPA 4GP7A 2ONKA 4B3FX 1PV4A 4IKEA 4Z8YA 2JJ1D 1G18A 5KO2A 1NVVQ 3DM5A 5IK2A 4LPSA 4B76A 2QP4A 3WY9A 5FBVB 2GKSA 3JVUA 4HB3A 2E87A 1BKDR 4FCWA 2P67A 5CJPA 3SC3A 5JJLA 2C95A 3VKWA 5EE3A 4KV9A 2VBCA 1N25A 4B2PA 2QSYA 3K70B 3CPHA 3GJXC 5E7IA 5JRJA 1F3OA 4FMDB 4D4KA 1KSJA 3HJNA 3MMPA 1KIMA 3SJCA 4XD7A 2P3SA 3SYLA 1CR0A 3NBYC 1CKEA 4D0NA 1W44A 5TDHA 3EZ6A 5JWOA 2WOOA 1KZ7B 5KSPA 1FTNA 4UNPA 1IY1A 3A4NA 1SHKA 1OLOA 2FSFA 2OSBA 3EZFA 3SJBA 4GMDA 2JLQA 2NTYC 3UANA 1VCMA 3THOA 1NIPA 1OIWA 4TQ9A 2OHFA 2ZJAA 3L8ZA 2QG6A 1E0AA 4MGIR 5J4YA 4Q5IA 3T5GA 2W6JD 5E4FA 3AVTA 4TMZA 4OI2A 5HR5A 3HDTA 2O8CA 2FA9A 2KB0A 3KXKA 1WP9A 3DKPA 1ZMXA 3HR8A 2RGNC 4US1R 2LWIA 3A6PC 4LV8B 1JI0A 1E2NA 1UFQA 5HCNA 4AKHA 4QGGA 4ZV4A 4LC0A 2IWHA 4ASUA 1IN4A 2J7PA 3L0PA 1SQ5A 3DOEA 4ZI2A 1Z3IX 1EFHA 2H17A 3KJEA 4DVGA 1E2JA 4EAQA 1HT2E 2WZQA 1AS2A 4A0GA 1E4VA 1T3LA 2G3YA 1X8JA 1NNEA 2NO6A 1PLKA 5FPKA 2JA1A 5H70A 1TEVA 2EU8A 2GBLA 1NLYA 1FX0B 2HXSA 3SQXA 3GFOA 5AJWA 3SOPA 2NGRA 1VG8A 4JKYA 2IX3A 4WOPA 3SFVA 4OHXA 4GRAA 3ZVLA 5GJCA 3ZQ6A 1P2VA 2QE7A 3ZIAD 2IS1A 3L0IB 4B32A 1E2MA 3RHFA 3GLGA 2ZRNA 4IDHA 5EQTA 2B8WA 2MMCA 1DG3A 1N5IA 2HLDA 1FUKA 3GMTA 2XITA 3LRPA 5DN6D 1XWIA 1BMFD 3I61A 4DRZA 3R8FA 1EGAA 2GF9A 3DHWC 4I1UA 4DSNA 3B85A 3E70C 4B71A 5BWMA 3QSYA 4AC9A 4WW0A 2WAYA 3EC2A 2O8EB 4FWIB 3GQBA 5KSYA 3BFVA 4Q9JA 3GD7A 4TYQA 4LK2A 3CONA 2XXAA 4HAYA 4CT5A 4M0LA 1AM4D 1P9WA 4A92A 2IUTA 3OAAD 3FVQA 4MYUA 1E2GA 1H8EA 2KI5A 3T34A 3ICEA 1GZSA 1Z0JA 2MSCB 2W0SA 3UMSA 3EC1A 1R5NA 1F2TB 1UF9A 3JZAA 3U3KA 1K5DA 2ZE7A 3AQ4A 3B9PA 4MGKR 4KFRA 4E07A 1KO1A 2VP6A 4XWOA 1LV7A 2DWOA 1ZW6A 5C4GB 3CRW1 2W6JA 2ZQ5A 3I3SR 4ILEA 5FTJA 4FMCF 2A5YB 2MSDB 2YZ2A 3CRQA 4B35A 3THXA 4YONB 4DLWA 3RSLA 4A2QA 2VIIA 4B73A 1SVIA 4QG7A 2MSEB 2P2LA 4GSYA 2OUKA 4CF7A 5BN3A 1Q0UA 1XU4A 1Z47A 2OILA 1DAEA 4PZYA 2J0UB 2JLUA 3U7EB 3BB3A 1IJFA 2DHRA 2CJWA 3DOFA 3R9XA 4L16A 1E32A 1NVWQ 1VECA 2VHUA 4MDFA 2WSSD 2BC9A 2NZ8A 1E2IA 3RS3A 4LGMA 4QHTA 1OYYA 4LDJA 5KDLA 3SYNA 2GZAA 2EFHB 1OXUA 3BXZA 4C0HA 4LJ7A 3FWYA 1FNMA 1M7BA 2REBA 3IEUA 4F4JA 2ZRLA 1HH4A 3K1JA 2WKRA 1HUQA 1OXSC 2AKAB 5E7MA 2ZRJA 1A7JA 1DS6A 2QNRA 3KQLA 2RCNA 4G5SA 2R6AA 3IQXA 3PVSA 4QNMA 3X1YA 3NKVA 3KX2A 1ZD1A 5FL3A 1YZKA 2ATVA 2F6RA 3AH8A 2UKDA 5FTMA 5KOYA 3GEHA 5TVKA 2FGKA 3VR3A 4BASA 1D2MA 2F43A 4QJ5A 2JLXA 4F92B 1XJCA 1OH6A 2QMOA 1ONBA 2P6NA 5EJEA 1WB9A 2J3EA 3LA6A 2WJYA 2JJ2D 4Q03A 3ASYA 1GRQA 1XEWY 4A9AA 4XWKA 5HPYB 4PHGA 3A4MA 3CBQA 4EDHA 1P9RA 3KUDA 4P4UA 4K8OA 2G1JA 1HV8A 4DCNA 2GA8A 1NP6A 5DO9A 1KO8A 2O0JA 4C3ZA 3KXLA 3GJ6A 3OHMA 4LJ4A 5TXGA 5B30A 4GMXA 3BGWA 3P26A 4E09A 3FMPB 3TAHA 5EZ5A 1NN1A 3AVPA 2OFXA 2XX3A 1FUUA 3OAAA 2FEMA 3RS7A 1EG7A 3QKSB 1OH5A 2QM7A 1XXHB 1V43A 1XF9A 3X1WA 3REGA 3NH9A 2W58A 1KGDA 1ZIPA 1ZD9A 4GZMA 1OFUX 1WDTA 3B5JA 4S2EA 1VCOA 4PPNA 3VNUA 4PPGA 4IJMA 2BMEA 1N6HA 3IEVA 4GPTA 1ANKA 2NG1A 3KB1A 1VIAA 4IDNA 3EG5A 4UNQA 1XCGB 2NPFA 4Q7KA 2GJKA 2RGDA 5FBRB 3UWKA 2OZEA 1WXQA 2FPMA 1P61B 1TMKA 4ARZA 4YXWD 5KU1A 3CWZA 3W6OA 5C46F 2G1KA 1NKTA 3TH5A 3AUXA 3KKOA 3R9IA 5AUPB 5L3QB 1RZ3A 3U60B 3P27A 2F7SA 1ETUA 5FPYA 3QF4B 3SZRA 3FPAA 4XOIA 3SHWA 1R6BX 1LS1A 4AYTA 4A36A 3E2IA 3PR1A 5DI9A 2ZANA 2PCLA 1U81A 2YWHA 4A15A 2D2EA 4XTRA 5JEEA 4B47A 2DBYA 2B7CA 1W36C 3P1JA 1HQYE 2Q3HA 4C9BA 5JS8A 1O87A 3GJ3A 2O8BA 2ZI6A 1QHIA 4HUQB 2D2FA 4IVRA 2IF0A 4US0R 1KJWA 4IW3B 4LJYA 4PHHA 1KOFA 1MABA 2PLFA 5FOTA 4QBIA 2Q3MA 5DYGA 1U0JA 1GUAA 2CVHA 5FBLB 5FOSA 2H8KA 5F9HA 2QSZA 5AR1A 4DLXA 1UBFA 4I1SA 1EXMA 5F98A 3W5JA 2QQ0A 3CZQA 3DMDA 1OJLA 221PA 1NN5A 3EWSA 2FFHA 1GM5A 2P5SA 3TAUA 3MWYW 1F2UB 3Q72A 5C2JB 5KPJA 5HTKA 1II8A 4GFDA 1AKEA 4HLUC 4Q4HA 3V9PA 5FL7A 2WAXA 3FFBA 4I1VA 2CL7X 5KSOA 1P6XA 4UXIA 4PQFA 1EWRA 5SZIA 1M34E 1CTQA 1PUIA 3MGCA 4C2TA 2JLYA 2Q6TA 3ZVNA 1M7HA 1M7GA 4TZ0A 2QU8A 1L4YA 3HP1A 3ADKA 1K8RA 1J2JA 1MH1A 2HF9A 2QY9A 3N5CA 4QGFA 3K0EA 1DAIA 3T1QA 5D3MB 1NJGA 2V1XA 3AF0A 3NWJA 4P4SB 4Z1MD 2F9MA 1TX4B 4Y0VA 4A1FA 2VHQA 2A3RA 1D9XA 2Y8EA 2XTZA 3WBJA 1SGWA 1HQCA 1KI1A 1YR7A 3AEZA 2C78A 5SZJA 3RVBA 3E5HA 4Q1EA 2BMFA 4NCIA 2OCBA 1S0UA 5KUTA 4BLTA 2ZYVX 3UMRA 4DBLC 3EZ2A 4NMMA 4MKIA 5ANRB 1E3MA 3CNLA 1UPTA 2CLCX 3B6EA 3O47A 1RRGA 1XTJA 2VHJA 2FPKA 3MD0A 2ODBA 1SVMA 2A5GA 1Z6AA 1HTWA 4LJAA 1W49A 1M1YE 1R7RA 1A1VA 1CJVC 2VH5R 1IXSB 1DTSA 1TQ4A 2C8VA 1D5CA 2GEUA 1ESNA 1WCV1 4PHTA 2LKCA 1E0JA 5FR1A 4RKFA 5IF9A 1D2NA 2V7QA 4Q1DA 2ZRGA 2VO1A 3QPWA 4O25A 4DUGA 4JYBA 3L0OA 4O2RA 4TLEA 3MUFA 1QG2A 2ZITA 2JJ8A 3GJ7A 4FW9A 4KO8A 1UBEA 2XZOA 4MQBA 2IYXA 2WMNB 1ZCAA 4G01B 2AN9A 1IY0A 4BQSA 3MLEA 5FR2A 2YYZA 2JDID 2HXYA 2Z5FA 1LNZA 4LBZA 2V54A 2ZS7A 1TU3A 1XEXB 1KI9A 2P5TB 2ZE5A 2ZRMA 3T1VA 1VYVA 2FF7A 4PZZA 5SZHB 2ZTSA 3U4QB 4YMVA 4LJ5A 2PLRA 1W4BA 2RGBA 1JPNA 2AHOA 1VHLA 3K9NA 4JJKA 3HPQA 5JZVA 3CIOA 3BB4A 2IUSA 4JVNA 4YDHB 2CBZA 5E7JA 2D4HA 2ANBA 2GXQA 3AP1A 1WF3A 3RAPR 1W36B 2REXB 1U0LA 1ZU4A 4BPBA 4CEIB 4TSFD 1OE0A 1N6LA 3QE0A 1CIPA 2WJJA 1Z83A 2ZRDA 5JECA 1N6KA 3GJ4A 3WHKA 2QI9C 3RC8A 4TL8A 1XXHE 3UG6A 1JR6A 3TGPA 1SHZA 3OEED 4Q48A 3TE6A 4PC7A 3DL0A 3K9GA 3CLVA 4MKGA 3NEJA 1TF2A 4V02A 2VL7A 1RC8A 1G7SA 5KNDA 5FFMA 3LX8A 1PZNA 4OYHA 3AGQA 3GP8A 1TQ6A 1UM8A 1E2FA 2H16A 2IS2A 1SVKA 1MO4A 1UBGA 1W5TA 4JJZA 4PAQA 4JS0A 2W2XA 3IILA 2C96A 4GL2A 2C9YA 1Z0DA 1X1SA 2IF2A 2AK3A 1OIXA 4MH0R 2XNDA 2ZM5A 3D3QA 5JSZB 4JLBA 4CEHB 2BBSA 1RVDA 2ZS9A 2RGCA 2ZE6A 2I3BA 3I72A 4JLVA 4EJSC 2OCPA 3SHFA 5K8TA 2ZYWX 3OFND 3K0SA 1G8YA 4LYAA 4RD6A 2VHTA 2QP3A 4AG5A 4WVFA 1XMSA 1GNPA 2HDNB 1TEXA 5FPHA 4JT2A 4O3MA 2VTKA 5FBWB 2GXUA 4Q9IA 3R8CA 2W2VA 1ZIOA 1NI3A 3TRFA 1KI8A 1AQUA 3C14C 2BV3A 5LD2C 3A1UA 4JVSB 5H8WA 2ANCA 2RGNA 4F38A 1L4UA 5AUOB 2GDJA 3PITA 3W90A 4ZDJA 3IDQA 2CDNA 4U02A 2ORVA 2VSXA 4LZZA 3LO5A 3PEVA 4HAUA 4HYYA 4KVAA 4OK5A 5A0FA 1XCMA 3Q3JB 4JT4A 5CYOA 1W2GA 1E2KA 1RYHA 2PT7A 3AB3A 5DGXA 5G41A 4ZCMA 1AA9A 1QHNA 1KI4A 1YVDA 4M22A 1F5NA 1VG1A 4OK3A 3OEHA 2IXFA 4HZUA 1SKQA 3SR0A 1XEWX 3RLFA 2W0MA 4BWYA 1V5WA 2P0EA 2XB2A 4L5BA 3BH6A 3CF0A 4RVCA 5L3VA 1WRBA 4AWXA 4JLKA 1Z0AA 3MRSA 1N2CE 3V00A 4LUCA 3WRYC 1XDBA 4AIIA 3QKSA 1N6NA 3EPJA 4HEJA 2J7KA 3A1SA 3U44B 1TF5A 1KI3A 3MWLA 4AKIA 3BD9A 2PJZA 5G3YA 3TSZA 4DLZA 1RJ9B 1OB5A 3EXAA 1JJ7A 2F9LA 1GITA 2RGAA 2REOA 3UATA 3QPVA 2IK8A 1HT1E 3V4RA 3GEIA 5J40A 1EFCA 1KI6B 4QJ4A 1JECA 1FTSA 3I5XA 3A4LA 4CRWB 3O8DA 1OSNA 1PVOA 2J0QA 1KI2A 3SI7A 2GK6A 121PA 4C0LA 3I5YA 4ZKDA 3PEWA 3L43A 5AJYA 2ZSDA 2QORA 3KTAB 3NIBA 2GJAA 3QVUA 3B82A 3K09A 2CHQA 4UXJA 2ZVQX 2BVNA 3D31A 1QHSA 2AD1A 3PG5A 3UKDA 2YKGA 2YOHA 1XPUA 1VYTA 1J8MF 3CNOA 1ELOA 4BFWA 1GRRA 2RGEA 3AVYA 3DZ8A 2GVZC 4RZXA 1KTVA 4WA7A 1C1YA 4R71A 2ZJOA 1G7TA 1KY2A 2VP0A 1E98A 1KDRA 3WYFA 4HUQA 5CLQA 2ZSAA 2CHGA 1Y3AA 3VHXA 2BOVA 3WP1B 4Q4AA 2OFOA 4EJSB 3QVVA 4OHYA 3MFYA 1F48A 4M1SA 2ZJ2A 2OAQ1 1N5LA 4ZDWA 2IYLD 1DOAA 4RCYA 1TPZA 2JIZD 2FSHA 3CM0A 4HZIA 4CZ2A 1P5ZB 2WJIA 1JNYA 4HLDA 1XB2A 1II9A 2ORWA 4MDEA 4V0ME 1SXJC 4EPTA 1W4CA 2VP9A 3C4JA 4GOJA 5LD2B 1W36D 3AKEA 1AS3A 1Q57A 2XSZA 2FG5A 1HE1C 4MUAA 1FQJA 4WZBE 2WOJA 1R8QA 3TR5A 4EPVA 2WTUA 1P72A 1NN0A 3ZD6A 1EFRD 2CL6X 1VG0B 2VLIA 1DBSA 3C5HA 4DLUA 4PAMA 2FWRA 1NLFA 2E9SA 2Z0MA 3LY5A 3CX7A 4URUR 1S4QA 5D3MA 1JR3A 1Z8FA 3VR4A 1G21E 4DLTA 1COWD 2FSGA 2QP9X 3SFZA 5J4KA 4P33A 2ECKA 1RIFA 4HAZA 1NG9A 3Q8XB 1XTKA 1O3YA 3K0AA 1DAFA 4GBMA 4YMWA 5JEDA 2FFQA 3QENA 2CK3D 1KSGA 2BEJA 2CNWA 1Q21A 3NH6A 3R7WA 1XD9A 3T5DA 2C03A 4MRSA 4A2WA 1JXOA 1XTSA 5FUVA 2XTMA 3TUIC 721PA 1DAMA 4JIMA 3CZPA 4TMVA 5JCZA 4EFNA 4D0LB 1T8UA 2HUPA 1W4RA 4URZR 1YZGA 3I4LA 3E1SA 1JXMA 2VSFA 1UJ2A 3H2YA 3GLIB 2P6RA 1VHTA 3WNCA 3AUYA 1W2HA 2NMVA 2GETA 4BZXA 1T3SA 4JLAA 3PUVA 2DB3A 1CLUA 3GJ0A 4PC1A 4L9SA 1A5TA 4CEJB 1KMHB 1UKEA 2JGNA 2NO1A 3B2EA 3Q85A 2HT1A 1VIYA 1E1RD 1TUEA 3LLMA 4C0JA 4KITB 1IJEA 2IXGA 4TLCA 3VHLB 2VP2A 3THWB 3EWAA 2FE4A 4OI4A 1MO5A 2BKEA 2DFTA 1WE2A 1ZNZA 4BRUA 1G8GA 2KBEA 1VYUA 3B13B 2VP5A 4EPWA 4DSOA 1NG1A 1GG2A 3KB2A 3T1TA 1E9AA 3LW7A 4XVUA 1XMIA 5FTKA 1R0YA 4C0QC 1GFIA 2C9CA 4KBFA 3QG5A 3L0SA 4P3YA 1GIAA 3B60A 4M9XA 1Q3TA 3WYAA 4JBWA 2EFGA 2D62A 1Z0FA 2OEPA 2BBTA 5FTNA 4D82A 1S1CA 4A0RA 2ZI3A 3VR5A 2PEZA 2BIFA 1KHTA 1L2TA 2EFCB 2HEIA 2ZREA 3AKYA 2JJ1A 3B8HA 4ZPXA 4CEIA 3PEYA 1FFHA 3NXSA 4PSKA 1F6BA 1CR2A 3OE7D 4E03A 8OHMA 2QAGC 3A37A 4QBHA 2BWJA 3SJZA 1N6IA 4TYYA 3VR6A 4BECA 2FJUA 4IDQA 1MKYA 1NJFA 3QOFA 1GOTA 3ZLJA 4Q9KA 4QJ3A 1QHYA 4LYFA 4YQFA 4NYIR 4O2LA 3KJHA 4Q4JB 4DT1B 4MA4A 3PUXA 3I92A 2Q9BA 3IKJA 1SXJB 4LSGA 2Q0HA 3M6AA 3MWKA 1G4AE 5DHFA 2C9OA 2NOAA 4A8JA 2UZIR 2A9KA 1NKSA 1Q3HA 3LX5A 4GOXA 5CB6A 1T4GA 4NU0A 3U3MA 5JLJA 2J41A 3X1ZA 3ADDA 1LB1B 3U61B 2DWQA 1SKYB 1KO7A 1TF7A 4BGDA 4B44A 2NO9A 1NF3A 2IXEA 3TMKA 3K0FA 3IQWA 3QBVA 3KXIA 3EPKA 1FMLA 1Z6GA 3DDCA 2FOLA 2HCJB 2R2AA 1OH7A 4A0FA 4RSGA 5HKKD 2W2TA 2L0XA 1X8KA 2YWEA 2CHVA 3LD9A 2TMKA 1OHHD 2DYKA 3AM1A 5F9FA 4F93B 3T61A 1YKSA 1G6HA 1OXVA 2XNSA 3KKPA 4M9SA 1YRAA 1G64A 3S1AA 1E2HA 1I4DD 2ONJA 3X1DA 1BYIA 5GJVC 1H8HD 5B64A 4V03A 3TUZC 1NIJA 5JRZA 3W5IA 1HA3A 4N1AA 1K5GA 4LHVA 1ZP6A 3LBNA 4HAWA 2WKPA 2OESA 5L3SB 4U7DA 2O8DB 4DLYA 5JCPA 2QEQA 4RD0A 1N6RA 4PAOA 1VG9B 5CDFE 4UKDA 3HPRA 5BYKA 1R0XA 3VU9A 2R6FA 3OESA 4PSAA 5JI2E 3W9YA 4M1YA 1NVUQ 2QRNA 4F7WA 2ZRFA 3FHCB 1QVRA 4C2UA 4Q1FA 3IIMA 3PUYA 1VPLA 3AF1A 4HDQB 4TN1A 2EYQA 4B3XA 3KKQA 3ZIAA 4DDUA 1OW3B 1XCPA 2QAJA 2VHCA 5AJVB 1MO6A 4HLCA 3KDSE 4DDVA 1G1MA 5DN6A 3ZS9A 3OE7A 1BMFA 4MUBA 4QL3A 2CCKA 3QBTA 3TVDA 621PA 2IHYA 2V6JA 4LYJA 3FB4A 2A30A 5EP1A 2F1RA 5DISB 4LHYA 4EQ6A 4YMTA 2ZSFA 2ZJ5A 3U7FB 4FWTA 1DVRA 1TQ2A 4IRUB 1KK2A 3PCRB 2JAQA 3Q7PA 5L8VA 2AX4A 3QY0A 4XSGA 3FOZA 1ZINA 3H0KA 2CMKA 2O5VA 4HAXA 5DIFA 3T1OA 5ELXA 4NCNA 2J46A 5A4JA 5JMTA 3NDBB 1NY6A 4DIDA 2HYIC 1Q12A 3FGNA 4U5XA 4MGYR 5AK0A 5FTLA 1Q1EA 1RJ9A 1T0JB 1GL7A 2WWWA 3IHLA 4NYIQ 4KODA 5DNYB 3EPLA 4C7OB 4PZLA 3K70D 4EUNA 1KI6A 2DFLA 4W9MC 2QAGB 4L4UA 4I81A 1W0JD 4IOJA 2W00A 5CJ2A 5G3ZA 1DADA 3RS4A 2CE7A 4OQNA 4BRWA 2BDTA 2XGJA 2ZAOA 3KTAA 3M4YA 2QMUA 3NTUA 4G5GA 3ADCA 2E1RA 4BZPA 4CIDA 4D6PA 5JWRA 1HURA 1MRSA 1EWQA 4DSUA 3PUWA 1E9DA 3AF3A 2ZRPA 3FYHA 1YQTA 2GXAA 1FL9A 1X3SA 2O0HA 2ZR9A 1U8ZA 2ODEA 2N1BA 3AGPA 4RKEA 3THYB 3UXMA 2LKDA 4B75A 2Q9AA 4IXMA 2WSSA 4GP6A 4IOLA 2W6ID 1XD2B 1QVAA 3FKSD 4KSBA 2QM8A 4S35A 4QM7A 1KK1A 1XZPA 3CR8A 4RFSA 3WNBA 4L9WA 3C7KA 1BYUA 5EXPA 3EZ9A 3WBKA 4IOMA 1F60A 1PLJA 5C18A 1YJ5A 1KKMA 3LXXA 1G5RA 2IW3A 3LVRE 2FGJA 4M1TA 4A6XA 4EJSA 1QHHA 4OJQA 1EX7A 4D0GA 3FMIA 4DCVA 4V0LA 521PA 3ZZ0A 1IN7A 2R6CA 3M1IA 5LPNA 1X6VA 1Z29A 1OF1A 1D9ZA 3CX6A 1G41A 4MYHA 4CW7A 5GJBA 2GBLC 2UVQA 3A1VA 1FMJA 1BS1A 1ZCBA 2PBRA 1IBRA 2QMHA 1A2BA 4JZKA 3CRRA 3NBZC 1UADA 1YR8A 3FTQA 3N70A 1NLZA 1GL6A 4NYJR 2VQSA 2JJ2A 5GVSA 3KKMA 2DPXA 3B1YA 4TT3D 1T3HA 1U0HC 4NDZA 3IBYA 4ZIRB 4G1UC 1RYFA 3O8CA 1GWNA 2J87A 2J59A 4LJ8A 1TUIA 2QRZA 1DO2A 2HYDA 1GTVA 4B48A 1NBME 2RB4A 3PFIA 1SXJE 3P32A 5LB4A 3C16C 1OKKD 4IDPA 1GSIA 2WJVA 1NBMD 4R2IA 1H65A 4AY2A 2ZUCA 1E2LA 1S8FA 1SXJD 5K8UA 1DO0A 2NQ2C 3W8RA 1KI7A 1MV5A 4LBYA 1AQYA 2GZDA 2AXPA 3RS2A 3T12A 4KU4A 4PC3A 3LXRA 1KY3A 2X1VA 1QG4A 2V55B 1PJRA 5EP4A 2IL1A 2ZUDA 1IAQA 1JJVA 2H18A 1NMYA 2VF7A 4Z54A 4XVQA 1KAOA 3QNUA 3BFXA 2XEXA 4Q47A 4XH9B 3FHOA 3PJRA 3BIFA 4ZI3A 2B7BA 1E1QD 4NCHA 5E95A 4YXWA 2K5UA 1FQKA 2IC5A 1UEJA 2ZJYA 3EZ7A 2PMDA 3QXXA 4JL8A 4X8LA 3SE0A 1WBBA 3VR1A 1E79D 3RABA 1C9KA 4CEJA 1BO6A 2OCYC 3Q7QA 2QUZA 1M74A 4JBYA 4C4PA 1P7CA 1XJQA 2GF0A 3VQTA 2IT1A 4DXAA 3ZH9B 3TKLA 4XTCS 1Q1ZA 1P9NA 3KFXA 3N2EA 3EIHA 4EPRA 1XRJA 4IFEA 1IN5A 3G82C 5HZKA 5EXTA 4Q21A 4Q66C 1G20E 3K9HA 4OI0A 3I73A 1DARA 4CT4B 3U5ZB 4HUTA 1ZU5A 4RY2A 1L7VC 3ZDQA 1KO5A 4WBSA 2GJSA 2ZI4A 2D7DA 3ICQB 4LCBA 1ZM4A 1FX0A 5FOXA 2O8CB 5G40A 2KWIA 3CUEF 4G5RA 4PO1A 2ZUBA 4C0AC 2B6HA 5J4VA 4IVQA 2KSQA 2OV2A 2ZEJA 1J70A 2V4ZA 4RD1A 2GWHA 4K81B 1Z6XA 1N0VC 4J0QA 2YINC 2Z4RA 2ZYTX 2HCBA 1VCIA 4Q9LA 2O52A 3NG1A 4FCTA 4TLDA 4CDGA 3ND9A 2D74A 1ZD8A 4QOSA 1XBTA 5DHAA 1LTQA 3TNFA 4Q02A 4NYJQ 1I2DA 1IONA 4N3NA 4TWZA 1NY5A 2QZ4A 3ECCA 4PX9A 1GVNB 4LOAA 1JB1A 2WWXA 2O8EA 3DMNA 5G53C 3QG1A 4XIGS 4DT1A 1WMSA 3FE2A 4FCVA 4RD2A 4Z1MA 4LBWA 1OFHA 1KK3A 1U99A 3CF6R 3LBHA 1JPJA 4GT1A 3AVVA 2GRJA 3T35A 1CRPA 5EUQB 1AGRA 2YV5A 1OIVA 4TMTA 3GLGB 3JVVA 1UDWA 4G3XA 4NKRA 1IQPA 4W5HA 4QHYA 4M2LA 5P21A 1FP7A 1F2TA 1JALA 1GP2A 2ZVPX 3F0TA 4V0OA 3U6BA 3I8SA 2XOKD 2G9NA 1N6OA 1NN3A 1YU9A 2QTFA 4ACAA 3WMGA 4PO9A 1E1QA 2ODWA 3I1FA 3HWSA 1IN6A 2R6GA 3DZDA 3P4XA 1AJEA 4PTLA 2OLKA 3EPHA 3B78A 2HV8A 1G3IA 1J90A 3Q9LA 2XXAB 2O8FB 1ZJ6A 3L82B 3QXJA 4D80A 2J0UA 3QEOA 5DYIA 5JHHB 2QGNA 2BCJQ 4W7SA 4DKXA 3BRWD 3NC0C 4B33A 4LJ6A 3TW4A 1Q44A 2WKQA 2IBMA 4RD4A 4OI1A 2JLWA 4RFVA 5L3SA 2GAAA 2J5XA 3IPXA 2O8DA 2ZIAA 2VA8A 2G6BA 4LJ9A 3FMFA 2R9VA 2H5EA 2WHXA 4UNSA 1CJKC 3BERA 3DVLA 4Z51A 4KJZA 4UJ5A 5GADl 3H86A 1CRQA 1E2QA 2JDIA 3ETLA 2I1QA 2GEDA 1G9XA 1Z07A 3CR7A 1YR6A 1E9RA 1JEDA 3K0CC 4QFMA 2FH5B 3RC3A 2JLVA 4URYR 2WWFA 3QKTA 3MWJA 2YVUA 1KNXA 4HB4A 4HB2A 1T8TA 4OBEA 2CJWB 1G16A 4EFMA 4IDOA 5FPTA 2ZI9A 3T15A 3KJIA 2QPTA 3IO5A 4DHEA 1MOZA 1NMXA 3GFPA 2V8OA 3KUCA 2DFKB 2BJWA 2A5DA 2JCSA 5BXQC 4MYTA 2B8TA 5TB5A 4M4SA 4TSFA 1VMAA 3C41J 1HE8B 5FI1B 1AKYA 1RFLA 3K70C 1VKJA 4UJ3A 2NO0A 1KMQA 5CB8A 2WPDD 4AURA 3RS0A 2IYWA 1PUJA 2HF8A 1DPFA 4P0TA 3LNCA 3QXHA 4MKFA 1W1WA 3OEEA 3SNHA 3TR0A 4XSHA 4ERNA 1XTIA 4AD8A 2IYVA 2AD5A 1Z0KA 1GDDA 2OM2A 4I1OA 3CO5A 3AVXA 1UKVY 3HYTA 1XXHA 4M21A 4N0DA 5KNBA
chains in the Genus database with same CATH superfamily
1XEAA 2GM3A 4R1OA 1RAFA 4TRMA 4DQLA 4UTNA 1HEIA 1RADA 4NE2A 4TXJA 3CUYA 1P45A 3A4VA 5KVQA 2J5RA 2QX6A 1B3RA 5BQXA 1MVNA 1SVSA 2P7HA 4AS2A 3CJRA 5LA6B 1SCNE 1GPKA 1QRRA 1ADFA 4DA4A 4EDFA 2PXHA 1MB4A 2XGGA 3IERA 3NYRA 1E0SA 4G1VA 4ND2A 4UXHA 1DJOA 3HABA 3RGGA 2HRCA 1KJYA 4I9UA 5CM8B 4WFJA 2H5LA 5DT2A 1QGDA 2PMBA 1AGYA 3AFHA 3I83A 3TKAA 3BVPA 5K2MA 5AT1A 3JQAA 2Y6VA 1KAGA 2EW1A 4JEUA 5DFAA 2QQEA 1EB8A 3WAGA 4BFUA 1Z22A 3QEMA 1ZGBA 3DTYA 3HR7A 2QTGA 4CGZA 3ETCA 3L6DA 4PM4A 3ZJTA 4AS1A 2O5EA 3OPVA 3RO7A 1QGYA 2GHIA 4KTVE 3OFNA 2Q62A 3GLHB 4S0XA 1Q7GA 2W70A 1V8BA 2REQA 3AHGA 1EXWA 1WTAA 2DULA 1QWOA 2OBXA 2F62A 4DIBA 3P2YA 4PVDA 2PCJA 13PKA 5ALPA 4B45A 3S2YA 1CJBA 2XB8A 3KQNA 1VKZA 1XNJA 2PZFA 2WWYA 1W5BA 1UFVA 3GAFA 4N3BA 3CH4B 2V1UA 1T3TA 1I2MA 5CIQA 3G2JA 4ZYZA 9ATCA 4B8ZA 4IIVA 1JDZA 4C7KA 2ETXA 2WICA 5KX5B 3KZCA 2F48A 3IPLA 3SX2A 1Q77A 3HS3A 4DMFA 3C8UA 4TXNA 3HNOA 1FRQA 4JYMA 1P8JA 1S96A 3OIUA 2AB0A 3KWLA 4OM7A 3IUQA 1YNOA 4MWEA 4R8VA 2F4VB 1OYWA 1YU6A 2FV8A 1OBFO 3ACDA 4HH0A 4RF5A 2ZRCA 2F2TA 4NC9A 5BO5A 3W9UA 3D2LA 5C8YB 4KQMA 4Z8XA 2R11A 4RAOA 1NMZA 1GTRA 1ZWKA 1BX3A 3W5DA 2F1OA 1T9KA 1F2UA 1JU4A 2XKAA 1XRLA 3JRWA 3NFRA 2D4AA 1K6EA 3FHTA 2F8LA 4BTLA 1GQRA 1N8KA 2RJNA 1ICEA 4I5IA 1CHDA 5B2ZA 4XJVA 5DP2A 4BRZA 5IHPA 1FPQA 2FZVA 3ZHZA 1ORVA 3HU3A 3CB4A 1P2SA 2G82A 2G63A 2ZRKA 4J29A 3FZQA 2IGTA 1GNRA 5DNUA 4HS4A 5KMGA 2HQBA 1EEXB 1SHJA 5B58C 3AXSA 2HPAA 3LQQA 4H77A 5G4KB 4NICA 1IH8A 1PJTA 2P8JA 1JH8A 1R4NB 4NOLA 4CF3A 4FEAA 3PQ2A 2D1TA 1V1RA 3IEXA 3GLQA 4NP6A 1CUXA 2DC1A 2X13A 3CVOA 1I3NA 3FNBA 2YXNA 3BMNB 4MQEA 3H8VA 4S0ZA 5F33A 3T5MA 4PFKA 3USES 1ML4A 4MRMB 1PFQA 4DEYA 3L7IA 1KVUA 3W05A 3MNFA 3ZHUA 2QZJA 1XP8A 2CJFA 2EKBA 1GL9B 4IDBA 4MS3B 2ZRAA 3UKJA 3M33A 3NW9A 3AHJA 5D1HA 3SKXA 5J4VA 1ZYUA 1MIHA 1IUPA 4UBLA 4OHVA 1Y5MA 4ERXA 1PW7A 2IU3A 2QTHA 3JWHA 4M6WA 3T4EA 1YF3A 1ZMBA 4KXVA 3D4OA 5DM0A 4Z4HA 1NRJB 3ZY2A 3UJAA 4LOKA 4N8SA 1DL5A 1BFUA 1X70A 3RH0A 2ACKA 3O9VA 4CI9A 4DYDA 3TLCA 4JJGA 4KE7A 4TQAA 4U6SA 1C3VA 1R5OA 1SC9A 4M49A 4JLWA 4NYMR 2M1XA 3TLZA 2W2QA 1FJGB 1E2PA 1KFCB 4G1EB 1JA9A 2FZLA 3RM3A 2Z6VA 2AZMA 3N8DA 5B1EA 2FEAA 5I4KA 4DA6A 4M53A 2HO5A 2G09A 5IDVA 4F4IA 1H8ED 1JBKA 1E1KA 5EIWA 4HT3B 4E30A 2FETA 4UFOA 3I42A 3KWMA 2VAPA 3G9UA 4X93A 2YDYA 2YVAA 5DBGA 1IC6A 1T2EA 3RSOA 4Z0HO 2QRVB 1Y4ZA 2WYWA 4G1CA 4FMDF 2I3ZA 2BGUA 4CM7A 1PJZA 2Y1CA 3F3SA 3KR2A 5JW6A 2WG0A 2X40A 3HFRA 4LYGA 1F6DA 2ZJZA 1Z2DA 1U2TA 4KIGA 4RE5A 4ZREA 3SMQA 2OO7A 3PENA 3RC7A 4CMBA 4CLHA 3ESXA 2FX3A 4URXR 3ZJYA 1CX9B 1C4OA 1Z4LA 5K0EA 5JD4A 1N78A 2HWUA 2RMKA 1XEXA 4N3CA 4PYNA 1P73A 1E4OA 2EWWA 3JV7A 3RROA 3SGLA 3QIVA 4BU1A 4D8VA 2WJHA 3JQBA 1IEWA 2X0JA 5E3IA 4HXYA 5C7LO 1SY7A 5E6SB 3SLRA 4KAFA 2WYHA 4UEKA 1DX6A 4MKHA 1AG9A 2VSYA 3DE6X 1R9GA 3GRYA 3ISVA 4I5GA 4BQIA 5B6JA 1INLA 3OZIA 5I9TA 1D4FA 3WK6A 3S28A 2YJNA 4GUAA 1H2AS 3CKLA 4EECA 5AQ1A 4IEEA 4DIEA 5JHGB 3FCAA 1EVQA 3EA0A 3RJ9A 4PYOA 1S3SA 4HNVA 1WSBA 4QODA 2HK8A 4LZJA 3KT6A 1ZK2A 2B1RA 2FN7A 1QB7A 3VYVA 5DW3A 1G5HA 4YYEA 3WMRA 4RW0A 1EUCB 2IYTA 1ISFA 1N0WA 1OXTA 1EFRA 2FW0A 2ID9A 4GBJA 4GZLA 1G3RA 4JXJA 4BWGA 4EG4A 2WM3A 4JU9A 4W5WA 2ZBUA 4H1VA 2XVXA 1J39A 4TLLB 1COWA 2QNBA 4RVDA 3SBEA 3PD1A 4DEVA 2QBYB 3GN1A 5EESA 3NX4A 4C6RA 3WYNA 4HLUA 3AM3A 1NX6A 1KVQA 2CK3A 4K9OA 4L0CA 1QIKA 2QMEA 4IHQA 2VPQA 1GILA 3RKUA 3TAXA 4BRSA 4P82A 1E2DA 1SBYA 5BMVF 3K71B 2HA6A 2IHZA 4J0GA 1DLIA 4ND1A 4FM9A 1U8FO 2O57A 2QROA 4QOGA 2X0DA 5JAPA 1TRHA 2RKOA 4CN8A 2H92A 1YMVA 4JVMA 3WP0A 3STTA 1ZVMA 1WLSA 1EI9A 3TZEA 4XUCA 3QWAA 1Q0PA 1U4OA 1CEEA 1P3JA 3E05A 4II7A 4XGIA 5B1IA 3WWYA 2WJGA 4FW8A 3BMXA 4ZKEA 3PX3A 3PXDA 3T1HB 2O8FA 5KQLA 3ABRB 5JSZA 5DE3A 3HCFA 1J9GA 1W48A 2I4LA 5EPUA 1H6BA 2G5TA 2O3SA 4P3KA 3EPPA 3HBNA 1T25A 2AUMA 4JEIA 5F1YA 3FPEA 5AWFC 5SYNA 1RAGA 2GYWA 4JUAA 3K09C 2BLNA 4M8NE 4BO5A 1IZYA 1LJLA 1NZFA 2VDMB 3QEJA 5I9SA 4LBVA 2OBMA 3PYLA 5D1NA 5DI3B 4BMXA 2FEOA 3ETHA 2B4RO 3S8MA 2ZIWB 1T4BA 3BFKA 3BN3A 3TNYA 4RY8A 1IU9A 4EIWA 5LDDC 3U7HB 4BLPA 1ZUHA 3TSOA 1PL8A 1QHXA 3DTVD 5AUNB 3GRPA 3N3BC 1TM1E 3PDHA 3M9LA 1IUNA 3AF4A 5EMJA 1MZVA 1ULZA 3D1VA 1F6WA 1V8OA 4URVR 2ZIUB 3H2HA 2ZSKA 4IX1A 3QXCA 5TLSA 3ZHYA 2XNHA 4RVNA 1QNLA 3UJ8A 3WYGA 3HU5A 5SV2A 3O4JA 3P20A 3FLBA 2PZLA 2X7JA 1ABFA 1Y6GA 3C15C 3RC9A 3VNQA 4COKA 4JC0A 3ORSA 3QYJA 5LDGA 3P9IA 1M76A 4QBGB 2H2WA 3OLVA 2RAUA 3HXTA 1LX7A 4GWGA 4W5JA 3LYLA 4F6CA 2XDAA 2C29D 2D06A 4UNNA 4PLTA 4TMWA 4IICA 5CP8A 4RZ3A 3THSA 2ZWOA 5EWMA 2WLSA 1RR6A 3W78A 1V3QE 3LO8A 4FXPA 4XVRA 4TTQA 1ZM9A 1L5WA 4OB7A 1T4CB 4PGAA 5HA5A 5KYYB 4OB8A 3IEIA 5C4MA 1L7PA 2E4ZA 3T06B 5I8PA 4MQ5A 2DFPA 2R44A 4XQ9A 5AOCA 4QWMA 1W73A 2H6EA 3V8NA 4CTOA 1GFZA 2YMLA 4MWGA 1W30A 1PWEA 2C2YA 2IDMA 2PDAA 2AYYA 4DARA 2HRQA 1II0A 4FFDA 3LCJA 3R3ZA 4D8XA 2XB4A 4RQAA 3IYLW 1QAMA 1JTFA 4KYTA 3RK0A 4DR1B 1ISRA 4J8PA 5A62A 1KDPA 1DCTA 1UXGA 3HWRA 2TRSB 3ZGOA 3U16A 1JR4A 1I2AA 1DELA 1JSZA 1YHYA 3HCRA 4IHJB 2Q41A 1Y8QA 2RKWA 4M7RA 4FOSA 1XZCA 3CEJA 3PNSA 4Q24A 1SRRA 2PZGA 4M8IA 4UCQA 4DC9A 2C00A 3L9WA 1QU2A 1OZAA 3ZOKA 1KEVA 1ZK3A 3VPSA 2PX8A 5EZ6B 2DJIA 3V8VA 2DTXA 3FYUB 5F64A 1RBMA 5KYUB 1ADGA 4TVKA 5KNCA 2JGLA 3DLBA 1FMFA 3CGGA 4GX5A 4DFDA 4TTPA 3VC1A 2B35A 5IEBA 4EY6A 1G2QA 2YOGA 5TEVA 4RULA 4MRPA 2IUUA 3H5OA 5HKKA 3BC1A 3FR7A 3M6LA 3I9LA 4HEQA 2Q2NA 3UQZA 3DMTC 1JQKA 1EZZA 3ZWWA 3PT5A 4BTVA 4FB4A 4NBTA 5AXDA 3MTAA 3IAAA 3IMCA 2W8ZA 2K7ZA 3Q40A 4Z86A 1HNNA 2H2DA 3EQ7A 3H2GA 5ESWA 1L5NA 2DPGA 5K51A 1KK0A 1C9EA 5ECYA 1M6VA 4FFLA 4LE0A 4EEXA 4YUXA 5KQGA 2UZ3A 4MCIA 2P6UA 5AXBA 4J7XA 2GEVA 1ECGA 1M8GA 4HDNB 2O07A 1OXMA 3MIZA 4G0QA 4K6OA 3ZZUA 4GX2A 4IGKA 3GF4A 1VL6A 1KS9A 2J3JA 3QLVA 3T5AA 1MT0A 1SPXA 5A6VA 2PS3A 1E9VA 2X8WA 3NVAA 2B92A 2ORIA 3EMVA 3FD8A 3IUJA 4Y0NA 1BVHA 2ZIFA 3RVMA 4RACA 4HGNA 2VPTA 4DPKA 1SVWA 1SBIA 5EKSA 3RYHA 3G9TA 4I4TB 1NUAA 1LBSA 4ZC8A 3IQZA 4IIJF 1KKLA 5JCJA 5CDFA 2QVXX 3STXA 1TQDA 2J0SA 4PFJA 1NQAO 4OGFA 2FB9A 1OFIA 2PGAA 1KZGB 1HY3A 3O03A 4NZNA 3S5JA 1U1DA 2OYCA 2FWJA 4I99A 4JZYA 5ICGA 1ZAYA 1TYEB 3PZRA 3U39A 3AG5A 3L2OB 4R84A 3K2IA 4KQFA 3RYCB 1Y6FA 1WZIA 2ZSJA 5EE0A 4Q9HA 5IDYA 5IH7A 2UYYA 5T4EA 1GRNA 4IUYA 3A9TA 1TJ3A 5KSZA 2ERYA 1ONPA 4V3BA 4AJEA 1NR1A 2HHLA 2DQ4A 5TY0A 1M73E 2HQRA 3MJFA 4M76B 1KSFX 4H4EA 3UENA 3ENZA 3GGCA 1P1HA 4X7PA 4HEA6 4DRXA 4ZAXA 4WK0B 1QTIA 5B3AA 2ZAMA 5AOBA 3NJ8A 1OWLA 1ZNXA 2NWQA 5JWHA 1YDHA 3B9QA 3UUWA 4YECA 5F2NA 3TZQA 4OMUA 1BHQ1 3RUPA 4Q12A 4F4HA 4G09A 4P9NA 1AIPA 3AW8A 3C3WA 4DR6B 2HM7A 4ZO6A 1GAXA 2BKLA 1QGOA 3B2QA 3KJZA 4YB8A 5BWOA 3MTJA 2FZCA 3MAAC 4A82A 2QRLA 3IUYA 4A8JC 4B4KA 1LQUA 1BXKA 1W76A 4RMIA 4E4TA 4EG7A 1Z5NA 3FOWA 1Z06A 1UOEA 1GYRA 4RHTA 1N1MA 1SUBA 4D9HA 2LGJA 1G0OA 2AFHB 4B80A 4NCAA 3HH8A 4DMRA 3OURA 4R8LA 3DKIA 5DCUA 2A35A 5A0VA 4TL9A 4ZVPA 2CBGA 3ANLA 3WLKX 1L4NA 1XDGA 3BYZA 2ZPAA 4HDCA 4W8GA 3RYIB 4A4DA 5ALLA 3LLUA 3NWOA 5JMPA 2OD2A 5IJ9B 2QKYA 2O7VA 5E2AA 2QN1A 2XODA 1FEZA 5J23A 4Z4QA 2ZGVA 3GIWA 1YAJA 1YZUA 4XDYA 2FG6C 5CAEB 1AGXA 5LJIA 1I3CA 3CNEA 1AXGA 1G291 5DN9A 1RI4A 2VOEA 2H1LA 3G59A 3Q2OA 4C4XA 1G3MA 1EFTA 4TLAA 4JNKA 3OC6A 4IXWA 4XW2A 4BNNA 2C7VA 5AJZA 2WVGA 5COAA 4RLFA 3HSKA 3FKSA 3KVVA 4C0WA 4BMDA 4X8OA 3LLSA 5IBCA 2FRDC 3KE9A 3KOZA 3I6ZA 4CQLB 1U98A 2CMFA 4NENB 4Z1OA 3THWA 1DP4A 1FDRA 2G67A 3BQMB 2QN6A 1CQIB 2IU6A 1KKUA 2OCXA 4R9NA 2ORED 4MQ4A 3RV4A 1ODKA 2YBDA 4NJMB 4UBJA 3DO8A 1JQAA 2I2FA 4EMBA 4J4HA 2X2EA 3PVCA 3R6DA 4ZHQF 3UV7A 2GK7A 1P39A 3QU2A 1MLDA 2XNDD 1JHAA 4N0PA 3X1XA 5L9AA 4L9RA 1OB2A 3I62A 1FSZA 3QU7A 2LCIA 3A14A 2CEAA 2ZS8A 2QZSA 1Z2CA 4JC8A 1O4VA 3NPAA 1EJ2A 3RRZA 4PZAA 5LBUA 5DH9A 2NZYA 3I6IA 3KUKA 1BKSB 3BFJA 2CKDA 4TT3A 2QV7A 1GJRA 3REFA 4AMUA 3OFSA 4RSHA 3PLNA 4LXIA 1IN8A 1H22A 4O4JB 5D84A 2O2YA 2H7CA 3LQ2A 4KWEA 3K1YA 3RRNA 2EAUA 2J3DA 2OFWA 3DEIA 1YB7A 2VBGA 3ITNA 4MS1A 1Z6TA 2RC5A 3PQ7A 2VZEA 2DRIA 4MDHA 4WY8A 3ZHRA 1YVRA 1Q22A 3EAFA 4G2NA 2X77A 4B6EA 3GLFE 3C87A 2EF0A 3K8QA 1G7CA 3W34A 1BHSA 1QIMA 3QWHA 3J81k 4YC7A 1XMVA 3GRZA 3RVQA 5GZ6A 3BGSA 1Y4DE 4BX8A 3AOGA 1F8XA 1LF0A 1RABA 4N48A 3EGVA 1TW3A 3PWKA 1OBVA 1J7JA 2C7GA 4B79A 2AN5A 4LRSB 1XTQA 3RNLA 1O0CA 4RUKA 2W2NA 3KOUA 2NIPA 1K3UB 4DLVA 4MSUA 5GONB 3IKLA 3VMFA 1PNRA 3BJIC 3OEHD 3TK1A 4LRWA 1RSZA 3KLPX 2YHBA 4Y2SA 4AJHA 2QGFA 2XBLA 3QYPA 1OTXA 2O2ZA 3BH0A 4RFLA 3QUBA 2FMTA 4UTOA 1HDXA 2A5LA 1LWNA 1WZNA 1B74A 1IDN1 3O4FA 2PY6A 2ZSBA 1G7RA 3O4RA 5IKOA 1ZJ5A 3TPZA 4ZCTA 4WNIA 4B82A 2MT9A 2G77B 3NJRA 5GOZA 2Y1XA 3TQSA 3ZLUA 2PMWB 3C5VA 5FAKA 3QU4A 1DXYA 2D13A 1B76A 1WY5A 2UYQA 3L1UA 5EZSA 1ZBDA 1D0SA 1E8DA 5IUKC 5DGHA 2I2WA 1P4HA 4PSUA 4U2DA 5LC1A 4DV3B 1X14A 3RC2A 2V8BA 1G21B 1DUIA 3GL9A 5CA1B 5CR9A 1YRQA 3G68A 2G25A 1U9IA 2ZJFA 4MRNA 4RNCA 1CIVA 3R0JA 3N0WA 1YQDA 2ISQA 4I55F 4OATA 5FA6A 4AKGA 5K8JB 1S9DA 4JB0A 4PO8A 4A0SA 2GUWA 5AI8A 1PUXA 3QXGA 3IV6A 1EGMB 4L28A 3SEAA 4FGWA 3ZGVA 2ZROA 4L8GA 1T34A 2EV9A 1YJ8A 2BEKA 5CFMA 1FXUA 3BL6A 2ZUWA 5CIWA 4NV0A 3EDOA 4IF6A 5DW0A 2XZLA 4UMFA 3R6GA 4NPAA 2UUPA 5EOVA 5DHTA 3Q7TA 5HUQA 1P1CA 1IB6A 1QYVA 3E5MA 1LS6A 2R1TA 5DLQC 4H3KB 2JF0A 3HSSA 3WKEA 3LGAA 1D0IA 1W47A 3IIJA 1IRXA 1CIJA 3L0YA 1KEWA 2M6RA 1QFZA 1JDBC 1BEUB 1ORIA 2PKRA 4IYJA 1HYGA 3G8CA 3BIXA 3TCXB 4EL5A 3ZW9A 3AVWA 1WZEA 1ISIA 3NV7A 4OQ4A 5EPOA 1E3JA 3BOSA 3HKBA 3JWGA 3W3ZB 3JQGA 4N8EA 2IEGA 2CZQA 1IM8A 4R98A 4RZHA 4CV3A 4DCSA 1OH8A 1RXYA 4QXRA 4ARCA 4W6ZA 2VF8A 2GA9A 2QJWA 2XZPA 2C04A 1UPCA 4J9UE 2QMZA 3DZGA 5F73A 2ZI5A 1F14A 3NBFA 1CU1A 4HLNA 1X7WB 5KTYA 2QE6A 5F76A 1L7MA 3PDWA 5CK5A 2WWHA 2DH6A 2P4HX 5KKAA 1RM4A 4YGXB 1PAUA 4W1PA 3I9V6 3BL8A 4NTZA 5A7FA 5A0TA 2A2ZA 1DBVO 1A2OA 2SKCA 4MGZR 2DY0A 2WUEA 2YMQA 2QHXA 3WMFA 3IAHA 5BOSA 3NHSA 4F5YA 1PJ2A 2GVDC 2HMSA 5IC4A 2ZR0A 2QG9A 4UUOA 1E3EA 4E5DA 4YPOA 2X1LA 4R7ZA 1QQTA 2O0KA 3O8BA 1H9BA 5BYAA 1E7RA 4LZNA 4NONA 4S1TA 4AXBA 4DLAA 3NBUA 4TRNA 4C7OA 1G98A 3PPIA 1IHXA 1TCVA 4JFAA 1R4ZA 1ES9A 4TROA 1YFZA 2YQ5A 1ZDMA 1G8HA 2XSZD 1BDJA 2I62A 4JMPA 4QGAA 2Z8XA 4HPJB 4Z3KA 2VPPA 1TI7A 3H2BA 4UW9A 1NV8A 4EX6A 1JPUA 2ACVA 1NM5C 1QIDA 2A1UB 4GDMA 4G9GA 5EYPB 3D3JA 2EARA 1VTKA 3DE1X 4FFBA 3B2NA 1T9ZA 5KIAA 2IOHA 2GSDA 1HL7A 1T5BA 2C20A 2WIBA 3QXSA 1LDNA 2XIQA 3CY6A 1NF8A 2R7MA 3IUBA 3QHAA 4GECA 1TZBA 4GLLA 3L7MA 3OZWA 5KNLA 3DS8A 5L45A 4BO0A 1B8VA 4HVLA 1OLUB 1F4LA 3A1FA 1U3VA 1VIMA 1XZNA 3F4KA 3Q41A 4DIMA 3MCZA 2P2SA 1UR5A 4M7OA 4B3JA 5HJ5A 3BB1A 5ALKA 5KVCA 2QF7A 1EE2A 2VYVA 4RGVA 5HDBB 3AY0A 2QTAA 2AGVA 4HD8A 4L5AA 4RK0A 5EMMA 2BHRA 1SFRA 1Y9AA 2ET6A 2UUBB 3FYDA 1JDSA 2D0IA 1KO4A 2C4MA 4I9NA 1K7YA 3ZOZA 4Z99A 1MV8A 4R01A 1OX6A 1EFAA 1YJCA 3EXIB 1S5PA 1JG7A 3EW7A 4ARZB 3CR3C 3H9CA 2MJLA 4UQPA 2EP8A 5K3AA 3I01M 2C4WA 1N9GB 2E4WA 3DVSX 4Q05A 1N5DA 1QC5B 3HB0A 3N2GB 1AKVA 3NHAA 1ODFA 2ALJA 2RGXA 2Q5LA 5FI5A 1B23P 4KQKA 2OXIA 2PN1A 1H1TA 3OCXA 4KX5A 4OQYA 3AKZA 1LDBA 2FPGB 2IYUA 1Y63A 3H8JA 4EF4A 4EB6B 1PZEA 4MRVA 1BXGA 5J63A 2JFWA 1HDYA 1TE2A 2J9FB 3DBVO 3U6KA 2JFHA 1DAKA 1GPJA 1MJHA 1YRBA 3BWBA 4HAVA 4HDMB 2X0NA 4QM6A 3L4SO 1QHHB 2WPDA 5I7SA 5M04A 4P0PB 1WUTA 2GKOA 3LC7O 5HKAA 4U7HA 1C8KA 3V4OA 2O23A 3G0GA 4DWWA 2BCEA 4KO1S 2CV0A 3BAFA 2ERXA 3CT4A 2CL0X 2VT6A 1VL0A 2QSUA 3ZDXB 3KALA 4IIGA 3T7TA 4RD3A 3ZWVA 1TU0A 2H57A 1ZAKA 1KRXA 3K8YA 4X8MA 3TM5A 1W0KA 1I36A 1OFTA 4FYXA 5BQPA 3WICA 3SSMA 4B3FX 4G1BA 4LDRA 3G8BA 4IKEA 5E9AA 3N28A 4Z8YA 2MTBA 4RPGA 1G18A 3N2ZB 2G72A 1NVVQ 3DM5A 1ODJA 3WGKA 1M2EA 4LPSA 2Z9BA 3JVUA 3ZVKA 1J00A 1EDOA 1Y3IA 4FCWA 1C3XA 2VT2A 2XWPA 2C95A 2J9YB 3H4VA 2OO5C 5TJHA 3ZWXA 2PUCA 5C8DA 3W8FA 2QX4A 1JZTA 1FBNA 1J24A 4C6SA 1R64A 1RYDA 3NALA 3OH8A 5E7IA 5JRJA 3OPQA 4FMDB 5IJXA 3AZPA 3BTSA 4OFWA 3NHZA 1HI9A 1THZA 1TKBA 2ZQZA 1V5EA 3CVJA 1RHKA 1XO1A 1GA4A 3URMA 3FTDA 3HNRA 2CLHB 4UOZA 1P1FA 2HOQA 4LSZA 3UBTA 2ZZKA 3ONFA 3EZ6A 3CNBA 3P2MA 2O2HA 3W5HA 5KSPA 4DBZA 4P7BA 5LIPA 1IY1A 3KVOA 1ORHA 2OPBA 4EARA 2XZTA 4GMDA 4ZN6A 2D8MA 1Z7WA 1OIWA 3OLXA 2I2BA 2WKSA 3MT9A 4R2LA 4ZV9A 1TMYA 1A9PA 1A4XA 4NEGA 2VUSA 4XIYA 5FBZA 1ZG3A 3BRSA 4LOHA 1K7SN 2CNOA 4ZHSA 3T5GA 2ZT6A 4UPEA 2O4CA 4DV5B 1NOJA 1XYGA 1Z5WA 1OZGA 2J3HA 1GGHA 5ALRA 2N47A 4HNQA 2NQTA 1UJ4A 1RXCA 3DMGA 1W88B 1UFRA 2VH2A 3KXKA 3RJTA 3UWPA 2PYIA 1XQXA 1WP9A 5CJJA 3DKPA 2EKDA 2LWIA 3A6PC 2R66A 3MMZA 3B5EA 3GFFA 4ASUA 3HGQA 2C8LA 3O38A 2I6SA 1Z4PX 2NSLA 3TLEA 4DXHA 4ENQA 2ID4A 1CEQA 3KZMA 4UARA 3MBOA 5F7ZA 3O74A 4ARAA 2XA9A 3UGKA 1SQ5A 3H5WA 4ZI2A 3DTNA 3IP8A 3FCOA 4L74A 5LXTF 1EFHA 2IQIA 4DANA 1N9ZA 3KJEA 2B0JA 2W4MA 1U7TA 1Q7EA 4X1IA 1I2ZA 3TZCA 4A0GA 1T8SA 1T3LA 4WBNB 3IVGA 1X8JA 2ZYSA 1KE1A 1ZH0A 4MTCA 4P3NA 1PLKA 3ZTWA 3LUHA 2PXCA 1Q74A 5ED4A 2D7JA 1HPLA 1TEVA 2GBLA 1NLYA 3ZQ4A 3HXQA 1A98A 3WB0A 3LT0A 4ZYWA 4K6HA 5B6PA 5AJWA 4R2JA 1JWLA 3DONA 3PQEA 4P7JA 3MXOA 5TQ2A 1L4LA 4JKYA 3RQSA 2OV6A 3T7AA 2IHUA 2HJWA 3GO4A 4OHXA 5AYVA 5FQOA 1VE3A 3ZX4A 1ZBQA 5GJCA 4ZEMA 1PR9A 2O2IA 2IZ0A 4O4IB 2GN1A 2O7QA 3BD7A 3A25A 3PNKA 3HKDA 2X3UA 1EA5A 4AO6A 1O5IA 1YCDA 3VHRA 1DG3A 1N5IA 1M2WA 2PK3A 4CNBA 2XMPA 4DV7B 1WMFA 3TD2A 1PWZA 1EVZA 2XITA 2WINI 4RC9A 1BMFD 1KQ3A 3R8FA 1IHDA 1KZYC 1EUDA 2VH1A 2XWSA 2A7XA 2Q1SA 3BKWA 3EG9A 4YJ3A 3HHEA 5CPFA 5D00A 3AFOA 4XJTA 2I6UA 4BNXA 1VMDA 1X1AA 3EC2A 4KQ1A 3KPWA 2NP6A 5AJHA 1M34B 3GQBA 4Q9JA 4TYQA 4WN3A 4LK2A 4C7BA 4W9NC 2XXAA 4QT4A 2NP7A 1HYEA 1YMQA 3BMQB 2P0YA 5BNIA 3MXTA 1Z75A 3WA6A 3IHKA 1E2GA 1X9HA 2XE4A 3PF9A 4DOMA 1F06A 1GQSA 4HNUA 1Z0JA 3MBIA 1ZGGA 1GQFA 2PMFA 2W0SA 4DA8A 3V42A 1N2GA 4HDAA 3HDGA 3MWFA 1YRLA 4KRYA 4I6JA 3UMSA 1EX9A 1UF9A 3JZAA 1EHIA 1YC5A 4U4AA 3HKEB 1DDIA 1QHFA 2XUKA 4MYRA 2E18A 3LF1A 1E3DA 2DHQA 3G1UA 3VKFA 1H1DA 4KQ9A 2W6JA 1E60A 3D59A 1KYQA 1ADJA 2HZ7A 3CINA 4ILEA 4LE1A 1Z4QA 5TPWB 3NHKA 1TVEA 2YZ2A 4KK4A 4NWIA 5DX1A 3AY6A 5DEOA 1GQYA 4XE5A 1IHPA 4YONB 3R74A 3NRCA 1JMVA 3I9JA 2BSXA 4LQDA 4A2QA 1L4EA 3UJCA 4QG7A 4C3UA 1UPFA 3PVZA 2OUKA 1E2BA 4L8VA 4BY9E 5BN3A 2IPXA 3GX1A 2Y2UA 3C3XA 1IZZA 3PX2A 1M0TA 3EXEA 2J4DA 3A05A 4XYLA 3PDUA 4B5LA 3A6DA 3DOFA 3NKLA 2CJWA 4TTVA 2C88A 1E32A 1VECA 2DWCA 1LZKA 3HVIA 2ZJ6A 4GYJA 2XLBA 1UXIA 4FYIA 4RL6A 3JAWB 2Y2VA 2O2DA 4ITUA 4AFNA 3F5SA 2XE8A 1OXUA 1BCRB 3BXZA 2ID8A 1VJ0A 2OV1A 3FWYA 4PNHA 4Q3KA 5DNVA 4D74A 4F1WA 2JH3A 2QX9A 2FJ0A 1D2HA 3B53X 3BJZA 4LNUA 2WKRA 4GEGA 2AKAB 4JY7A 2OB1A 1A7JA 2BR5A 2QTLA 5JROA 3M2TA 2RCNA 4G5SA 3IQXA 2NUTB 3PVSA 3L77A 1DC4A 3F46A 3R5HA 2YYAA 3K1AA 2ZAIA 3IEMA 1RQPA 4M8KA 1UZUA 2GYYA 3VSBA 4DNXA 4YHHB 2OCKA 2R6HA 4KRFA 2RBGA 4BASA 1D2MA 3PRKE 1NYLA 1SZJG 4QJ5A 5B7PA 1XJCA 3N2KA 5AW6A 1OH6A 2P6NA 4H7JA 1FDWA 2JJ2D 1QQBA 3G2KA 3ASYA 4CKBB 4KIUA 1TDJA 4MQ6A 1R9MA 3A4MA 4PHGA 1KQNA 4NRDA 4DUGD 1YRWA 4UMEA 3KDAA 4K8OA 5ARCA 2G1JA 4WOKA 1HV8A 5CLHA 3ZI7A 2G9VA 4XSVA 2IX9A 2YYYA 4JUFA 1KO8A 4C3ZA 4X1YA 5JZ9A 3V7YA 3KXLA 3CLTD 3GJ6A 2COEA 1LBTA 3M1AA 1YO6A 2OA0A 3WJAA 3NFYA 3BGWA 1SH7A 5IDXA 1DQZA 3R44A 4U2EA 2YJGA 2ZIZA 1IK4A 3FMPB 4MR9A 4L95C 1C0EA 3KJXA 4X60A 4RJKA 3WIEA 4KGVA 4P6VF 3RYFB 1P81A 3ZE7A 2PWYA 1OH5A 1E3IA 3L01A 3ZE0B 4Y6RA 2JI7A 4XGKA 2I6FA 2QSJA 3CVVA 3FUXA 2W58A 2VJLA 5H9WA 2WD7B 1ZIPA 3MBKA 1ZD9A 4GZMA 1WDTA 1CY4A 3ONVA 3E48A 3TL3A 4S2EA 3ZG6A 4B2YA 4A8HA 1VCOA 4PRLA 4R3NA 3ZCSA 3PJEA 1N6HA 4IIJB 4LDNA 5D6OA 4GPTA 1ANKA 4UNQA 3D5TA 4WGGA 2I54A 3H0EA 2NPFA 3TRDA 2DEUA 2WHYA 1UXKA 3DBHB 3JQ9A 3BWEA 5JXWA 4NK4A 1RYBA 5FX2A 3UWKA 3FHJA 1QVWA 2OZEA 4LZWA 1N5OX 5A7GA 3TI7A 3QV2A 1TMKA 3IXMA 4LTNA 4PLHA 1Z88A 3P94A 2OXEA 3B6MA 4B3TB 3ESCA 3ZPXA 3TH5A 1N5RA 3TTTA 3QVWA 5G0TA 1RZ3A 3EMKA 3P27A 5FRDA 2F7SA 2ZWPA 5B3KA 1K1EA 1JEQA 3FPAA 1LRKA 3FUUA 2RCYA 1AD2A 2JFVA 2QL5A 4FCCA 3L1IA 5MGBA 4G37A 2C2ZA 2B6NA 1U0GA 3E2IA 3JQBC 3PR1A 4MEJA 5DI9A 1VSTA 2PCLA 2FTKE 3A4IA 1AB6A 2AOWA 3ZDRA 3GLUA 3ZWPA 2YWHA 5CCXA 3LHSA 2IZ7A 4WK2B 4A15A 3A32A 5KYVA 1DEAA 4B47A 2MSKA 4G0VA 3N75A 1MC4A 3TS1A 3GNTA 1BEEA 4REQA 5L7TA 2WIJA 3P1JA 5JS8A 3OMXA 1O87A 3GJ3A 4JIGA 4AMYA 2ZI6A 4N5HX 4IUCS 4ZYXA 1QHIA 1I4OA 2O8BA 3O3CA 1FJHA 5J5AA 5C51B 4BDSA 4YRBA 3DCIA 5KWJA 1IM5A 1R37A 1JSXA 2OPHA 4KXQA 1MABA 2HK7A 1AKUA 5FOTA 2R8OA 2Q3MA 2WAMA 3LK7A 3FHLA 1U0JA 4TTIA 5DYGA 3V1UA 4M9RA 3HO6A 4DLXA 1UBFA 2GCIA 1EXMA 3IP1A 3WE7A 4QICA 3W5JA 1WUKS 4LXQA 2QQ0A 4FB5A 1V35A 2FQXA 4Y1RA 3IKTA 4ZEXA 3CZQA 4GSKA 3EWSA 5G0SA 4D3DA 1WLYA 2ZT8A 2HTEA 3TAUA 3BCSA 3VZSA 1G5FA 2XDYA 3MOGA 3SM3A 1II8A 2BHSA 2FP4A 2JIDA 3KOWA 4HLUC 2QXUA 4FONA 4PBSA 1GCOA 3V9PA 1KZ1A 4BVLA 4GLOA 2L19A 1K92A 3FFBA 5LNK6 4YMGA 5JPDA 5KSOA 1P6XA 3N59A 2D6FA 4PQFA 5SZIA 1C9MA 3MGCA 4LF8B 1SRQA 3D4PA 1GUFA 3L0ZA 1LA2A 2Q6TA 3WJ2A 1EWYA 3H7IA 1RXVA 3F2IA 2ZXUA 1MVOA 1H2BA 1BE8A 2X2OA 2XMCA 3DH0A 2YICA 4WKBA 5FLXA 1N8SA 3AUJB 3HP1A 3ACBA 1P5FA 3CCBA 1J2JA 4UZFA 4TWIA 3D54D 4PHCA 5J2UA 4OJMX 3TMAA 4WCFB 2PXAA 2FUEA 4UAVA 5DHQA 4YAUA 1I0IA 1XAIA 2F9MA 4N40A 4Y0VA 2GRAA 4A1FA 1MB3A 1D9XA 5HDQA 2A9OA 2YQZA 2XTZA 4C0XA 2GEFA 3WBJA 4ZHQB 5K8CA 1NUQA 1SURA 3B3QA 3GARA 1XDSA 5TC4A 4Q3LA 3WWOA 4ZK2A 4Z4CA 4CV2A 2CHEA 3GEMA 3O31A 1QP8A 3OM0A 3ZZ1A 1AV6A 3VR6H 3CLRC 4L22A 4F4DA 4E5PA 2R96A 3UMRA 3L4KA 2PZKA 4NMMA 4MKIA 2QRQA 2ISCA 3CNLA 1LK0A 5F1KA 1E3MA 1WXIA 3B6EA 3DDZX 3O47A 1Q91A 2P3OA 1J2EA 3PEFA 1U7PA 2FPKA 5FWAA 3UH0A 4LF9B 4WUTA 2ODBA 2ECOA 2LRHA 4MK4A 4Q3DA 4QDOA 2A5GA 1A1VA 1M1YE 1R7RA 1UBRS 2XUPA 3N8NA 2O9JA 2RHWA 3WYCA 5BPHA 1T9CA 1Q2UA 1S01A 5KJFA 5LVAA 2HMUA 5ICFA 3S2IA 1GFWA 1TQ4A 1D5CA 1G6KA 1QRTA 1D2NA 3ECSA 3L41A 4Q1DA 4XWWA 3QPWA 4O25A 3ZR4B 3KZXA 4JYBA 4WNCA 4Z9AA 2VDOB 3MUFA 4FW9A 2JJ8A 3AUTA 3KBBA 4KO8A 1KOLA 3HNPA 2AI1A 3MEQA 1IBMB 1XRPA 4I2NA 3R76A 5HVNA 3K7EA 4EBBA 5KYXA 3EGDA 1ZCAA 4CQMB 1NQWA 1O0SA 2AN9A 1IY0A 4H0FA 3VM6A 5DMHA 3AM4A 1Y48E 4Q3CA 4BQSA 1QO7A 1R6UA 1EXDA 3EIWA 1ZFNA 2BFPA 2FSPA 2RIPA 4KPUB 4FDLA 3ZEIA 3ZWNA 1H4QA 4GMGA 1M8FA 2FK7A 1N7HA 3PT9A 2V54A 1L5RA 2PUTA 2ZAGA 2ZS7A 2P5TB 3ROQA 2ZBDA 4EYKA 5J2TB 3PHHA 4JJ8A 2JCVA 1C9DB 2ZRMA 2FF7A 4KBYA 3PPWA 1M66A 1NW3A 3A70A 1JL3A 1RLTA