1II8B

Crystal structure of the p. furiosus rad50 atpase domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
174
structure length
174
Chain Sequence
RERVKKEIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural biochemistry and interaction architecture of the DNA double-strand break repair Mre11 nuclease and Rad50-ATPase.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication
molecule keywords Rad50 ABC-ATPase
total genus 51
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2001-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ii8B01
1GZSA 2IYLD 3U6KA 2AXPA 4LRWA 1MABA 1G8HA 3THWA 4WOPA 1IQPA 1GKUB 2PMDA 3CR7A 2LKDA 4ILEA 1XTRA 4DZZA 1OKKD 2D2FA 4MRRA 3CWZA 4JBWA 3REFA 3WBKA 3RRZA 2OLKA 3R9WA 2L0XA 2OCBA 2WOJA 2YNMA 3GLIA 1TADA 1IXZA 4OL0A 1Z47A 3K9HA 1W49A 4XWAA 2VYFA 3GD7A 4NE2A 2V9PA 2H92A 2EVWX 4YXWD 2IXFA 2BIFA 4TMWA 4IOMA 1S1MA 2ZANA 3ETLA 1Z0KA 3L8ZA 3X1YA 1II8A 2WKRA 3A37A 4I1UA 1UKYA 1DELA 1R0WA 4KXFB 2ZSFA 3AKCA 4L5BA 4BLSA 1E2MA 5L3SA 1I4LD 2IC5A 3MAAC 2J5XA 1CRQA 4GRAA 5CM8B 3DM5A 5DYIA 5CDFA 3RVBA 4ZDJA 1HQYE 3FTQA 1NLZA 1ZYUA 3TUJC 1T5IA 1AN0A 4GI7A 3EIEA 3QPWA 1W36C 3O8BA 2BVNA 3B2EA 3T1OA 1E2EA 1GOTA 4MRVA 4KSBA 3KKOA 4S2EA 2QAGA 4KFRA 4RD4A 1AZSC 5EP3A 3PCRB 1R10A 3Q5DA 4AG5A 4DLTA 2VA8A 3Q72A 5E7JA 1NBME 4XOIA 5FOWA 5FTLA 5DGXA 1OYWA 1OIXA 2JLSA 1G7SA 3A58B 2J0UA 3BC1A 1E9CA 3SJAA 5J4YA 4CGZA 1H8HD 2A30A 4A0RA 4F4CA 3FB4A 2FEOA 2A5DA 2A5FA 3QNUA 3ZGXA 3ADDA 1RJ9B 2IWRA 2G0TA 4PZLA 3K0FA 1O3YA 1AS3A 2C03A 3VFDA 4LJ6A 3H2YA 1D5CA 2BMFA 3W6NA 2X1VA 1GL9B 3V9PA 2GEUA 5DI9A 4Q4AA 3I5XA 1ZJ6A 3VR1A 3WNBA 2JLVA 1II9A 1P9RA 4HUQB 1QHIA 4YDHB 4B34A 2GAOA 3NHAA 1WQ1R 3VR2A 1DPFA 3GFOA 4A82A 5LD2B 5B58C 2RGDA 4K8OA 4AD8A 5FPKA 1OFIA 2JJ2D 3CRVA 3THXB 4NCIA 4A0FA 1GVNB 3H1TA 1Z63A 1QVRA 2RGXA 3AVUA 1BMFD 5JECA 5H68A 4HUTA 2AX4A 4TT3D 2BWJA 2XOKD 3BORA 1W5TA 4DT1A 1FW6A 1PLKA 3EZ7A 4IDHA 2FGKA 1MOZA 2AK3A 2JDIA 5DN6A 1IN8A 1R5OA 5LDDC 4ARZA 1SGWA 1HUQA 3SFVA 4C0QC 5KSOA 4Q7MB 2QU8A 2O8CB 3SQXA 1NLYA 1J99A 1RFLA 1U2RA 3BB1A 4F91B 1GRNA 1Y3AA 1Z6YA 2CNWA 1IN4A 5CIWA 1JEEA 3EPKA 2CHVA 1ZM4A 1Q22A 4TMTA 4NMMA 2ODBA 4O25A 5P21A 1NY5A 2NOAA 1ZBDA 3GLIB 4PFSA 1KO5A 1RZ3A 1RYFA 1CEEA 2W58A 3NC0C 3WHLA 4TZ6A 1OFTA 1Z2AA 4BUJA 4IXNA 4JJKA 1SVOA 2OFWA 2VQSA 1L7VC 3B1WA 2MSDB 1G7CA 2B21A 3BWDD 4LBWA 4V0LA 521PA 5SZJA 5A5GA 5JJLA 1OHHA 1KNQA 1Z6AA 1JR3D 3PFIA 1CR1A 2ZS9A 5A4JA 5EXTA 1W4RA 2FSHA 3B7GA 4HYYA 4X8HA 5FUYA 4AI6A 1YR8A 2DHRA 2CHQA 1YKSA 3F3YA 4LYHA 4Q18A 1RRFA 1EESA 4BFXA 2C78A 2GXQA 3PEUA 3GMTA 3QEJA 2ZRFA 3THYB 4PXAA 4GOJA 2GVDC 5FH9A 3U2QA 1UEJA 2IW3A 1OIWA 4XWKA 1FQJA 1W4CA 1GNPA 2G77B 3LVQE 3EPJA 1G9XA 4TYYA 4JLPA 4NYMR 2V54A 2ZS7A 4EJSA 2WKQA 3IEVA 3IIMA 2D06A 1NL3A 2I3BA 3CZQA 4M2LA 4B3FX 2QBYB 4PO8A 5AUOB 2YC4C 1EWRA 2YWEA 3UG7A 3KUDA 3BOSA 2R8RA 1NG9A 4JVNA 4Q4JA 2HT6A 2OT3B 2OSBA 2FH5B 4HAYA 1E2DA 1X86B 1QBKC 1SKYE 4XTRA 3L43A 3WYFA 5M04A 4QM6A 1YHNA 4RKEA 2J46A 5J4KA 2ONKA 2EFEB 2EFHB 2ZJ2A 3NBZC 2C95A 2FZ4A 3U3JA 2RB4A 4YQFA 3ZVNA 2WJGA 4MDFA 2QAGB 3W9YA 2J9RA 4DB2A 2F1JA 2QROA 5G40A 5JRJA 2O0JA 3SFZA 1P5ZB 2JAQA 4M4SA 4POAA 3SI7A 5B64A 5BXQC 3OE7D 2NMVA 2FX3A 1QVAA 1RRCA 1T6NA 2O8DA 3TQCA 1XEXA 3C7KA 3UMFA 1U99A 1ZCBA 2CK3D 3AGPA 5EUQB 1ZD1A 1Z0DA 2P6NA 2N42A 2O0KA 2NO6A 4IDPA 1XF9A 1COWD 1NLFA 2QMEA 2CMKA 1VYUA 2VBCA 3B13B 3T5DA 4FWTA 1Q1BA 2Q3HA 1XJQA 2WPDA 4H1UA 4LBZA 3RRMA 1E94E 1FP6A 1YZLA 2J41A 4C0SA 2YWFA 5JEEA 1ZD9A 5JMTA 4MYHA 5KSZA 3SYLA 2VL7A 4AIIA 4A2WA 2YWGA 3EG5A 4AC9A 1AM4D 2WOOA 1T5LA 4KV9A 2HV8A 1FUUA 2X19A 3K09A 4LBVA 4BZXA 4URXR 2XSZD 1NP6A 5CITA 3VKHA 4A92A 4Q7KA 1ZP6A 3IPXA 4E5UA 3TSOA 1HA3A 4DBLC 2R6FA 4Q66C 4MITA 5BWMA 3FGNA 2QTHA 4KLZA 2XNDA 3FMOB 5BYKA 3UG6A 4A15A 2OCYC 3TGPA 4JVSB 1CLUA 1GG2A 3MD0A 2QMHA 1U0LA 2W83A 1ELOA 2WV9A 1R0XA 3ADBA 3LBHA 3P27A 4CF7A 4MYTA 2C9YA 2PJRA 3MWKA 2ZSBA 1CRPA 2XNDD 4B73A 1UEIA 2ZSDA 4PO9A 4DLSA 5JI2E 1EFRD 5FBQB 3BFXA 1P4SA 3L0PA 3KJGA 2V55B 2ZTSA 1HYQA 1QRAA 3SJCA 1TTTA 3WHKA 2XGJA 2VP9A 2F1RA 3SJZA 4QJ4A 1ZM2A 2CL0X 1IY2A 2ZEJA 2OLJA 4PANA 2LKCA 3OAAD 4TSFA 4DLRA 4NCKA 3W90A 3RNLA 5CLLA 1XZQA 3I72A 1OW3B 2F43A 4QBFA 2WSSA 2QMOA 2BMJA 1S0UA 4DEXA 2BJWA 1KNXA 3QXSA 4DSUA 2ATVA 4GOKA 1CR0A 1JPNA 5K8IA 2D7CA 1VHTA 5BN4A 2VH5R 2G1KA 3JVVA 4C0LA 1SXJB 2AD5A 2ERYA 4FCVA 1N3BA 4JL6A 2H1LA 3EWSA 4D26A 2GTPA 3FWYA 5KNCA 2VHTA 1D2EA 2Q0HA 2RKOA 3KTAB 4LHZA 4NONA 4LOAA 3W5IA 3LLMA 3EIQA 1NN5A 3OFNA 3I8XA 1ZRHA 3PUZA 4JLKA 5GJVC 1J70A 2H57A 4BGDA 1XMVA 2G1JA 4A6XA 2ZJBA 1ZVQA 3T12A 5EUMA 4JT2A 2CCGA 4XVRA 3FFBA 3IQXA 2Z5FA 3DM9B 3PQCA 1JR3A 2MSEB 2B7CA 2BKUA 4UXHA 4US0R 3WY9A 1U8ZA 4RFSB 3HJNA 2A3RA 4YMSA 4BECA 4JBXA 1X1RA 3M1IA 3AUYA 1N6NA 2PBRA 4YMTA 5HE8A 1RJ9A 1RKBA 3TK1A 2JLYA 1E0SA 2W0MA 2RGGA 1FTSA 3U7HB 4LGMA 2J7KA 2OAP1 1KSFX 1DAEA 4WXPA 4UNRA 3CO5A 2X2EA 4B2IA 3CX7A 1G7TA 5CK5A 1YZTA 1TMKA 1MV5A 2VTKA 3FE2A 1AKYA 1XD9A 2GJ9A 3OEHA 2AHOA 3PUWA 4WW0A 4PHGA 1TAGA 3EA0A 2W2VA 4A2PA 3SHWA 4WZAE 1UAAA 2NO0A 4O3MA 2FWRA 3OZXA 2IL1A 3QXCA 2TMKA 3AVYA 3UWKA 1VMAA 3ZZ0A 2Z83A 2NQ2C 4Q48A 5DI3B 4ZDKA 5G3YA 2P67A 4FI3C 2G6BA 4KHZA 3Q9LA 4EPXA 3RAPR 3H4MA 5FTKA 3MUFA 2OE2A 3B82A 3I3SR 2ZYUX 1H65A 2YOHA 2BKEA 1CR4A 2VP2A 1E69A 3DVLA 3CWQA 5FI0B 3NDPA 5L8VA 1SHKA 4M8NE 1IONA 1Z29A 3K09C 3ZVRA 4BEJA 4BEBA 4JL5A 3DZ8A 8OHMA 4KYIB 1G18A 1T0HB 3BGWA 3TW4A 3GLGA 4W5JA 3A1UA 5JWRA 2RHMA 4ZDIA 3K0AA 1LNZA 2EQBA 3BFVA 3SNHA 4KFUA 1D8TA 1N0VC 1C9KA 1TL7C 4LC1A 4OJQA 4OBEA 3A1SA 3T1QA 3VHXA 1XPRA 2WM9B 2D7DA 2J0QA 4CEJA 5FBWB 3U60B 1XBTA 1GKYA 2P5TB 1VDZA 3I8SA 2IXGA 1TUIA 1E2LA 1KK2A 1ZD8A 2PX0A 3Q3JB 3ONWA 3IPYA 4N3NA 1K6MA 3WRXC 2HUPA 3CUEF 4NYIQ 3QBVA 2PZGA 2GXUA 3K70C 1SXJE 4LJ7A 5FUXA 4XVUA 4PHTA 1RRGA 3I4LA 2ORVA 2A5YB 2JA1A 2V1XA 3B1VA 3CRMA 4GPTA 3NBXX 4MH0R 3UKDA 3GLGB 1MO5A 1JPJA 2OM2A 1XP8A 1N6KA 4Y0AA 2WIBA 3CR8A 4MGKR 1W36B 4PSVA 3U4QA 4U7DA 2JJ2A 5FTNA 3TSWA 2QNRA 1VECA 4QHYA 1QHGA 2C04A 2FN4A 2RGAA 4HDOB 5EZ5A 3R7WB 4CIDA 1G1MA 4HLQB 1E0JA 3HR8A 4KODA 1WF3A 4MKIA 3LW7A 3AF4A 4BLPA 4BRWA 2ZR0A 2F55A 3B8HA 4OK5A 2IS1A 4ESHA 1CP2A 2F7SA 1A2BA 3NIBA 5E3HA 4MKFA 3OEHD 2RGNA 1TU3A 5JI3E 1WP9A 2ZREA 2KBFA 3CPEA 4DJTA 1VG8A 2JLZA 2O8FB 3BB3A 1F2UA 2ORWA 4DVGA 4DIDA 1QG2A 1P9WA 2FE4A 1KJWA 4UJ5A 4YLGA 3AF0A 2XXAB 1W47A 2AK2A 1DAFA 3LRPA 3P1JA 1KI6B 2ZR7A 3L0IB 4PHFA 5KDOA 1MT0A 2V4ZA 2V6JA 3IHLA 1SKQA 3C5HA 4HB3A 5TXGA 1T8TA 3C4JA 3QENA 4AY2A 1G19A 1IJEA 4NTZA 4TMKA 4A8JC 3LDAA 3ZDQA 1T9HA 1VKJA 3AV0B 1UBEA 3LXXA 5AR1A 2BMDA 2QAGC 4Q1EA 1MKYA 4DHEA 1OJLA 1YZGA 2IYXA 4GP7A 1OB5A 1FX0A 2D62A 5EE3A 3X1WA 3PEWA 3CF6R 1S3GA 4US2R 4OQNA 3RS5A 2ZSEA 3EXAA 3W6OA 821PA 3TBKA 2WAXA 2ZRKA 3CX8A 2JDID 1KTVA 2ATXA 2GK7A 3EA5A 1OIVA 4B47A 5FOVA 1SVLA 4URVR 4JMPA 2ZRHA 1Z0IA 4BFVA 1UPTA 2OUKA 2P0EA 2R2AA 3K9GA 2FFBA 4NDZA 4PSAA 2QT0A 1BKDR 2IYWA 4X8MA 5LB4A 1FX0B 4B35A 1A82A 4LJ9A 2ZRGA 3AP1A 1E2QA 2P5SA 3MJHA 4C0KA 2Z4RA 3M4YA 3QJYA 1J7KA 3ICEA 3KTAA 3PENA 4V03A 2R6DA 1FFHA 2IYYA 1IJFA 221PA 2QMUA 4DDUA 5B30A 1SVWA 4LHYA 3NWJA 3CZPA 2OO7A 1CIPA 5GADl 3BAFA 4V0ME 5FPSA 1WRBA 2LWIA 4ZI2A 2J7PD 1KZGB 1YU9A 1EGAA 3SOPA 4C0BA 1AGPA 1FNMA 3A36A 1W0KA 3K0AB 3KXKA 5KSPA 1GM5A 3B1XA 1QHXA 1P3JA 4B3XA 4W5WA 2QUZA 4URUR 3LH5A 3W5JA 3LQQA 3KZ1E 2FU5C 2VF8A 4GZMA 4N0EA 4O2LA 2HDNB 1WBDA 4UNQA 3QG5A 4HDQB 4TSFD 4D25A 3ECCA 5AK0A 1Z22A 3VR4A 4B43A 5AJZA 1A7JA 1CJKC 1XNJA 2IWHA 2QTFA 4NYJR 1A4RA 4UKDA 3EASA 2F43B 3CF2A 4QJ3A 4L16A 4XTCS 2OV2A 2G88A 2FDCA 4HB4A 4I4LA 2HJGA 3A1TA 2G9NA 5KNDA 4LHVA 1G41A 4LUCA 3W8RA 3L82B 1MRSA 1DBSA 1GIAA 2DFNA 2YYZA 2HXYA 3NBFA 4RFSA 5DE3A 1ESNA 2PLRA 3X1ZA 4EPTA 1FUKA 1CR2A 4MYUA 3KQLA 2J1LA 4DCUA 4GDFA 3QVVA 4QHTA 2ZRAA 4X8LA 1P2UA 3QKUA 4EFNA 5C2JB 2VPPA 3DO6A 1AQUA 3ZD7A 2GILA 2ONJA 2YZ2A 4BLQA 2F1HA 2CLDX 1R0ZA 4IEEA 1Q21A 4TYQA 6Q21A 3FHCB 2DWQA 1UADA 5L3SB 2IYUA 2GJKA 4DLUA 1FZQA 4M9ZA 5DIFA 1KY3A 2ZUDA 4C7OA 2QPOA 4NH0A 2UKDA 3MCAA 1UKVY 3TUZC 5BN5A 4ZO4A 3ZYCA 5EP4A 3VKWA 2PT5A 1NBMA 3B78A 4M1KA 4HAVA 1NN1A 2QORA 4HLDA 3RS3A 1P61B 3RLFA 1E4VA 5E7IA 1GL7A 4IFBA 1DEKA 2PCLA 2DWPA 4NL4H 4PZZA 3EARA 5KYKA 1R0YA 3AKEA 2ZVPX 3K9NA 5DHAA 2DFKB 4OQLA 1G5RA 3NG1A 4D2IA 3AVQA 4Q1FA 4AYXA 3IHWA 3SJBA 1ZAKA 4JLBA 4D80A 1XU4A 1XTQA 2CJWB 4JLDA 4Z54A 4ESVA 3A4LA 1HT2E 3K1JA 4L8GA 4TYNA 3R7WA 3I92A 1GFIA 1QG4A 2VLIA 2ZRIA 5DI3A 3OIUA 5AJVB 3NH9A 2ZJYA 5TARA 4CEJB 3PUVA 1MO6A 2AL7A 2IYSA 4ZI3A 3EC1A 4YONB 3DDCA 1BS1A 4WVFA 1G3RA 4AK9A 1U0HC 2H5EA 3UIEA 1J90A 5A0FA 3R8CA 5J5CA 4IVPA 3FKQA 2JJ8A 2WSSD 1US8B 1ZW6A 5CYOA 1OPXA 1Z07A 4RVCA 2H17A 1NKSA 3WYGA 4S35A 1G8GA 1NMZA 1PLJA 4KCGA 4MUBA 4MRSA 4FXPA 4GMXA 2F3RA 4P33A 4I1SA 4FD2A 4Q4HA 1VYVA 4EUNA 5JSZA 2RAPA 1R5NA 4WIAA 2QE7D 1PVOA 3AVXA 1KJZA 4JSYA 1ZM9A 3TW8B 4O0MA 1WA5A 4Q7JB 5SZKB 2FGJA 1AK2A 3SQWA 4XVQA 2QM7A 2WWIA 1Q0UA 1IM2A 1FQKA 3P26A 1B23P 3IIJA 5AUPB 3FPAA 1KMHA 3I73A 5EP2A 2NO9A 3C15C 4V0NA 5AUNB 3S1AB 2PT7A 4KSCA 5LB2A 3K70B 2ZE7A 2PX3A 3U3KA 4AKEA 2RHDA 2XTNA 4URYR 3QEOA 4Q9JA 1M6NA 4NBSA 1E79A 2KWIA 1Q3TA 1TF7A 3HDTA 5C46F 5CYPA 3IIKA 1BMFA 4LPSA 1GKIA 3C14C 2ZVQX 4HLUA 1ZIOA 1A2KC 1XD8A 4A2QA 2PLFA 2OESA 4LC0A 4B33A 5CB8A 2QT1A 4TN1A 1DAHA 4C0AC 4B2LA 1IN5A 5FPYA 4HLCA 4BASA 2DFTA 5HR5A 1F2TB 2OAQ1 1E2IA 3V4FA 5H1YA 1BH2A 1H8ED 3P20A 2XTMA 3X1XA 3FKSA 1GAJA 2CJWA 2FPLA 3BRWD 4KVAA 4OK3A 2G83A 4MRPA 2JASA 1QZXA 2CL7X 1T91A 3Q5EA 4GSYA 3ZZUA 2DBYA 3FVQA 1H8HA 5H70A 2XNSA 2V7QA 3CBQA 3CONA 3SYKA 2Q9CA 3U3RA 4HI0E 2ZU6A 4IOJA 4JYCA 3C41J 1HE1C 2ZSAA 2DY1A 4NYJQ 1OXVA 1S9DA 4ZV4A 1P2SA 2PL3A 3HU3A 3SZRA 4C4PA 2MSCB 4CT5A 4PC1A 1DO2A 2ASEA 3QOFA 3K0CC 2WICA 2GCOB 1S8FA 4WZ6A 5FR2A 4L9SA 4LI0A 1JJ7A 3C5CA 4UNNA 2A78A 1SVKA 2BBWA 1KK1A 4RJLA 4EJSC 4ZKDA 1V5WA 2IEZA 3PITA 2PJZA 2FSIA 1KGDA 4L9WA 3UMSA 4D82A 1A1VA 4EQ6A 1KI8A 1NG1A 3AKDA 2GRJA 4UQOA 3W8NA 3LW8A 3TRFA 2HLDD 1DAGA 2FG5A 2IK8A 4JJZA 4Q1CA 2WTUA 5F9HA 1N5KA 4BFYA 3UPUA 2CHGA 3CRRA 3GLHB 4MGIR 4US1R 3IQWA 1XEFA 1SULA 2BDTA 4LHWA 2GKSA 1D6JA 4PPFA 3TJZA 4BLOA 2RGBA 3QXJA 2AN9A 4TL9A 5JHHB 3OHMA 1GL6A 3SHFA 3IUYA 3K0CA 3PVSA 5FUWA 4EPVA 4XD7A 1JNYA 1B0UA 3NH6A 1T3SA 2FV8A 5E7MA 3U44B 1DG3A 1RIFA 2W2XA 2OILA 4KITB 1EFHA 1FNNA 1R8SA 1UKZA 1JQJC 4IOLA 1F60A 3LBNA 2WIAA 1TQ6A 1VCOA 2GJ8A 5UKDA 2A5JA 1VHLA 3RRYA 1Q44A 1LB1B 2R6CA 4E03A 1RRPA 1OKKA 4LJAA 3OF5A 4R71A 1XMIA 2EFDB 1AA9A 2FPMA 1E0AA 1NKTA 1XFAA 1W4BA 2GCNA 3EPLA 3AB3A 4R9UC 4XWOA 1Q1EA 5FR1A 1D2NA 2RGNC 2GCOA 1BYIA 1KSJA 4YXWA 1E99A 4QFMA 3BH7A 4DT1B 1FTNA 1TNDA 3SS8A 2WHXA 4IDOA 4KAXA 1KSGA 3KQUA 4C2TA 1XEWX 2GXSA 5EE5B 4AKIA 1IOZA 1KMHB 3A1VA 4D4JA 1VG0B 3GJ3A 2QBYA 1E2PA 5GJWC 3K9LA 1C4OA 2VHUA 4TLDA 2EFCB 1DS6A 1EG7A 2C96A 2WBLC 3ZIAD 1NI3A 3ZVMA 3ZQ6A 2ODWA 1W46A 3VNUA 4FINA 4B3BA 4C30A 3BK7A 3TLXA 2CCKA 1QHNA 4DSNA 3EZFA 2QPAA 2XOKA 1N0UA 2R44A 4ZIRA 4D0LB 4TT3A 4Q21A 2OZEA 4B76A 2WSMA 1EFTA 3LA6A 3QI2A 1P9NA 4Q4AB 1UDXA 2C2HA 4Q19A 5AJXA 1N6OA 2XZOA 1WE2A 4KLNA 3TIFA 4BLTA 4QKQA 1NRJB 4L15A 4GP6A 1ZM7A 2V7QD 4HZIA 4DDWA 1NIPA 2VHQA 2WKPA 3KKMA 1HQCA 4G1UC 4UNSA 1DTSA 3CPJB 2GEVA 3QKSA 4AKGA 5DH9A 4LJ4A 5KPDA 2F3TA 5B57C 5JEDA 4V0OA 1Z5ZA 3UK6A 5F2EA 5DO9A 2GHIA 1P6XA 1KKLA 2C77A 2VRWA 4B75A 1G21E 1ZUNB 1M74A 3FYHA 4HAUA 4URWR 5CDFE 5TV2A 3ZD6A 2NTYC 4B48A 4LPKA 1E9EA 3NEYA 4UXIA 2FEMA 4ZDWA 4YMVA 3HR7A 1PV4A 2JLQA 4PHHA 2ZS8A 2IX3A 1NMXA 2ZI6A 3K53A 3LX8A 4JVMA 3ZH9B 3QKSB 4DB4A 1EK0A 4D81A 1X3SA 4QGHA 2ZI4A 1I2MA 1FMJA 2ZM5A 4A6PA 1U8YA 4Q5IA 1KYIA 3R9IA 1BOFA 1XWIA 3IGFA 5FTJA 3IDQA 2GJAA 4Q00A 4XSHA 4I99A 1E0KA 3O8DA 4LJYA 3V00A 3VMFA 4OHVA 2KE5A 2QZ4A 2NIPA 2OBLA 5IT5A 4IFEA 1T3HA 3HU2A 2IA5A 5EXSA 3U3OA 1E9SA 3AEZA 1NVUQ 2O8BA 4R7ZA 5TMPA 2EYQA 5LD2C 2Z0MA 2NPIA 1T4GA 3GLHA 4JBYA 1DG1G 1E2NA 1YR6A 3PIRA 5EXPA 1JXOA 5FI1B 4C9BA 2HXSA 5KDDA 2OFXA 3UWOA 2WAYA 4LZZA 2ECKA 2QA5A 2W2TA 2XSZA 2REBA 2IHBA 2UZ3A 2VHCA 4D0GA 1R4AA 2WWWA 4ABYA 2J45A 1AJEA 1YRAA 3QG1A 2GCPA 4KBGA 1U90A 1U98A 1WCV1 1M34E 3LV8A 1CU1A 4PX9A 1E2HA 4DLZA 1NJFA 2XAUA 3LY5A 3VQTA 3DKPA 4FMCB 3EZ2A 4P0TA 1QHSA 3I32A 4PQYA 1SKYB 5D3QA 2R6AA 5G41A 1AQYA 4B6EA 1PLLA 3UXMA 3GLFE 3RS7A 3W3ZB 3QF4B 3DKVA 1TU4A 1OFHA 2WWXA 3DPUA 4WZBE 5FOUA 3T5GA 4NP6A 4U5XA 1NJGA 3E70C 4LYFA 4RD2A 1BYUA 3AKYA 1I4DD 1P7CA 3ZZTA 2CLCX 2IUUA 1OXUA 1T0JB 3RS0A 3UANA 2ZR9A 3ZS9A 4PC7A 3RC8A 3LX5A 1SVMA 2D3WA 2ZRMA 1G8YA 4ACBA 5JS7A 4GZLA 4HB2A 1IAQA 1US8A 2IBMA 1Q57A 3GJXC 2AWNA 1DADA 1GP2A 1LF0A 2Q9AA 2O5VA 2HCBA 3X1DA 2ZU0C 3ZQJA 4CZ2A 5BW8A 3GJ4A 1P2TA 1N2CE 3SDZA 2ZRDA 3AP3A 3U5ZB 2YV5A 2ODNA 1Z0JA 2X8AA 2C99A 1FMLA 1NY6A 1MABB 4AWXA 1X6VA 1DARA 1ZUIA 2UZIR 1CJUC 3NVAA 4TLEA 4TYPA 3TVDA 3O8CA 2XB2A 1LW7A 5K8UA 1N5LA 3K0SA 3W6PA 5KNBA 1NIJA 5KU1A 1IN7A 1XJCA 3VU9B 2GZDA 2PCJA 3RYTC 4CT4B 2N46A 4YMWA 1K8RA 2HEIA 3CKLA 4F38A 3OAAA 2ZRLA 3D31A 4EIWA 2W6JD 3RANA 1EWQA 1AS2A 4M1MA 4PPGA 1M7GA 3E1SA 3AVVA 1OB2A 1D9XA 3FHOA 5SZIA 2WVJA 4A8JB 3F8TA 2JCSA 5KUTA 3ADCA 1TUEA 1EFRA 3A4NA 4PZYA 2K5UA 1NMYA 4JIMA 421PA 4ERNA 1HURA 1U0JA 1DO0A 4P4SA 1HT1E 1OXTA 1N25A 1OXXK 3I62A 2GJSA 4Z1MD 1VPLA 2ERXA 2ZRPA 4BE7B 2J0VA 5LBIA 2JGNA 2F9MA 1NSTA 1VCMA 2JLXA 1KI7A 1SVIA 1TF5A 1CF4A 2B6HA 3ASZA 2R65A 3LAWA 4TTPA 3VX4A 4LV5B 3R9XA 2FFQA 2BM1A 4G5RA 5C18A 2IYVA 1G5TA 4RD0A 4RZUA 1MRNA 5IF9A 1FOEB 1WXQA 3VNVA 5HPYB 1Z28A 4GMDA 1M7HA 4H9GA 4OHZA 4AG6A 1U81A 2ANCA 3BH6A 2O8BB 3J81k 3QY0A 1WDTA 4EFLA 2QP4A 1P72A 2IT1A 5E4FA 1R6BX 4NPHA 4IEIA 4HUQA 4XD7D 1YRBA 4ZPXA 2XXAA 2ZETA 3VHLB 1NSFA 3HP1A 4TMVA 1UKEA 1PZNA 1T3LA 2GBLA 4RZ3A 2NZ8A 2CCJA 1TQ2A 4ZCLA 5B2ZA 4LYJA 3ND8A 1TQ4A 3NXSA 4RD3A 1RPZA 2VP6A 1KAGA 4DIEA 4TQAA 2RGEA 2Y8EA 4V02A 1E9RA 1LY1A 3PXGA 2XZPA 2P3SA 3LBIA 1N0WA 1XPUA 3DOEA 4OK6A 4D4KA 4MKHA 1G8PA 2KB0A 4QHSA 3FMPB 3VU9A 4IW3B 3FDIA 1UBCA 1F2UB 2C8VA 5FPTA 5FOXA 3GLIE 1OFUX 1HEIA 3TVTA 4FIDA 5CIQA 4AKHA 3LO5A 4RD1A 4C2UA 4K46A 1OXSC 3NDBB 3FOZA 4JL8A 4Q03A 5J4VA 3K0EA 4HLUC 1TEVA 4RCZA 4C0JA 3LFUA 2GVZC 2DB3A 1U9IA 2XJ4A 2HYDA 4QGFA 4JLJA 4RCYA 1YJ5A 1PUJA 2GWHA 5IHPA 4D6PA 1A5TA 5HKKD 1TQDA 2A2ZA 1X8JA 3L8YA 2PEYA 1G7RA 3E2IA 3MLEA 1XRJA 2XJ9A 1QHHB 4WXRA 4Q01A 3T15A 1AGRA 3AH8A 3EC2A 3S1AA 1KI2A 1Q1ZA 1VIAA 2EU8A 3ZS8A 2V3CC 2DPXA 4BLRA 3CIOA 4ZCMA 2G3YA 3KXIA 5FOSA 4A0GA 5JBQA 1R7RA 3WNDA 3D3QA 3T35A 4O2RA 4RSGA 4Q9HA 2AXNA 4Z8YA 4RFVA 3PR1A 3WMFA 5G53C 5L3VA 4B71A 2IHYA 2YC2C 4QGGA 1BO6A 2ORIA 1WBBA 1OLOA 1S1CA 3TR0A 3AVTA 1G3QA 1RW4A 3Q8XB 5JHGB 3FFAA 2VSOA 1W36D 4C7OB 4ITRC 3RRNA 4F7WA 3AF1A 1G4UR 3ND9A 4Q1BA 2P6UA 5EP1A 1II8B 1OF1A 4A1FA 2QTVB 2OXRA 4QNRA 2W6ID 4GFDA 3ADKA 2OCPA 4LV8B 4P4SB 1KJYA 4XH9B 4M1WA 3ICQB 4KU4A 4MGYR 2Z6VA 3BE4A 3EWAA 1ZMXA 3KL4A 3R20A 3KQNA 4OHXA 1XD2A 2J87A 3B5JA 4CYMA 1KZ7B 1E2KA 2W6IA 2WWFA 1Z6TA 2I4IA 1YZUA 4A9AA 1I2DA 5JCZA 2XX3A 3AVPA 1AKEA 1GWNA 4MUAA 4CEIB 2ZI3A 2N1BA 2ZJOA 3DOFA 4FWIB 3L2OB 4X8OA 2QI9C 4XJXA 2ZXUA 3RC3A 5CK4A 4PAOA 4TLBA 1VG1A 2FFHA 2ZE8A 1E9BA 5TDHA 3RSOA 2LCFA 2CBZA 2VP0A 3KXLA 4JLVA 1JECA 4QBGB 4DDVA 1OH6A 1OH8A 4JLOA 4J0QA 4FCTA 1MO4A 4PTLA 4BFTA 1ZNWA 1EFUA 3BFKA 2O8EB 2VHJA 3VX3A 4DCVA 2Q21A 2J3EA 4HAZA 3NC1C 2JJ1A 4OI2A 1KK3A 1XCPA 4TMXA 2WWYA 1E1QD 3ZJYA 4PC2A 3WMGA 4HEJA 3UMRA 1S9HA 1DAMA 1ZC3A 4LSGA 1E2GA 2OFOA 3CF0A 1QHYA 1Z06A 5EXXA 3D8BA 4ACAA 1KDPA 4EPRA 5GJBA 2FFAA 1YZNA 2E87A 1CS4C 3WNCA 4BFUA 4P3YA 4JS0A 4GT1A 4A8JA 1PJRA 2REXB 3TKLA 3KKNA 2HLDA 1G291 5ELXA 3G82C 3KDSE 4IVQA 4Z8XA 4LJ8A 4M1TA 3GP8A 1KIMA 2QEQA 3GLHE 3N2EA 5TVKA 1E9FA 4W7SA 2BMEA 4DXAA 3H0KA 3DHWC 4KVGA 3T1TA 4BZPA 1KK0A 3OEEA 1KY2A 3GJ0A 4MRNA 3MJRA 2B7BA 1I4TD 1KKMA 3Q7PA 1EX7A 4F93B 1KDTA 4PO1A 4FCWA 4LY6A 4F4JA 2PZEA 2YINC 5J4HA 5J47A 3SBEA 2YJTD 4ZKEA 3T1VA 3OESA 1FL9A 2GF9A 1ODFA 3QKRA 1TEXA 3TNFA 1Z08A 3CH5A 2GEDA 4BZQA 1JQLB 4QG7A 3VTKA 4LCBA 2IUTA 2ZYVX 4Z1MA 4CEHA 4MDEA 4RD6A 3L0OA 1VCNA 5EE0A 4CRWB 2GDJA 2QENA 2BM0A 4TQUS 3TAHA 4KBFA 1C1YA 2RH5A 2WWGA 2PZFA 4ARZB 2QE7A 3PUXA 1GUAA 2D4HA 4TLCA 1SZPA 4M1SA 4V0KA 3BXZA 3FMFA 4PC3A 4OI1A 2XEXA 3KFVA 4DUGD 1E98A 3BBPA 1YVDA 5FL7D 2OCAA 4MKGA 4YMUA 2BBTA 1H8EA 4I81A 5KTYA 4PPQA 1F48A 4P4UA 1BIFA 1D2MA 4JVLA 2QGZA 2C9CA 4EPWA 2BCJQ 4W5HA 2P2LA 4M9SA 5JRZA 1P2VA 5H8WA 2FSFA 2GXAA 2W0SA 4GOXA 2JIZA 5C1BA 2QPTA 2YWHA 1UDWA 3VKGA 2E9SA 3B1ZA 4UNPA 1W4AA 2ZJ8A 3Q85A 1MH1A 3AGQA 5DYGA 1RE0A 2WPDD 4LWZA 2OG2A 1R5BA 1W0JD 2BJVA 1EFCA 2CE7A 3GFTA 1RVDA 2QY9A 4TLAA 5SZHB 3U6BA 5IK2A 1X1SA 2V1UA 3JZMA 3OIVA 3FHTA 2D2EA 3D7MA 1R8QA 4R98A 4TTQA 2ZIAA 4H1VA 3PUYA 4JSTA 1YZKA 4E22A 4DDTA 4ASUD 1XTSA 2FMXA 2P65A 1W48A 1KI3A 2ZPTX 4OJKA 1G8FA 1ZM3A 5FBVB 4IJMA 3DEFA 3T61A 2EFGA 3RS2A 1G6HA 4AYTA 3LWNA 1RC8A 4TMZA 2ZI9A 1IBRA 1N5JA 5EZ6B 1GRRA 2QL6A 2KJQA 3KX2A 4ASUA 2IS6A 2O8DB 2J7PA 3QPVA 2EWWA 1M7BA 1AS0A 4QRHA 1UBFA 3MRSA 3KJEA 2BBSA 3IEUA 2XTZA 3CH4B 1GNQA 1VYTA 1XXHA 3DMNA 4B44A 3GLGE 3EX7C 4FMBB 2GZAA 2A7QA 2W6JA 3E5HA 3N2IA 3N70A 1LV7A 4M1YA 1ZNXA 3GCGA 4UXJA 5DSZA 2QGNA 1ETUA 2KI5A 1AZTA 3ASYA 4JKIA 1UM8A 2OEPA 3WXMA 4LYAA 1LTQA 1W2HA 3CRW1 4B74A 1YZQA 1Z83A 3CNNA 3HWSA 4BFWA 1XCGB 3OFND 2FNAA 2NZJA 5GJCA 2O0HA 4NKRA 2FSGA 2NG1A 3BS4A 3UATA 3U7GA 4CEHB 1SXJA 5F3WB 1XB2A 3TAUA 3SC3A 2ZRNA 1E3MA 1KI6A 2BHRA 5J40A 4ZCIA 3EPHA 4CVNA 5FL7A 2R62A 3CNOA 3PG5A 1PUIA 4OQXA 1OSNA 3EAQA 1W7AA 2G0NA 3MG9A 3KKPA 5AJYA 4ON9A 1SQ5A 2GF0A 4P32A 4E07A 2B8TA 3A8TA 1ZU4A 4NYMQ 4TL7A 2OXCA 2V6IA 1KO4A 3GJ5A 5KSYA 4G5QA 4KJZA 2QM8A 4A4DA 4B2PA 1M8PA 3B1YA 3THYA 5F98A 1SXJC 1CBUA 1OHHD 3GFPA 1JAIA 1DE0A 5FPHA 5IK2D 1O87A 1UBGA 3MMPA 4DUGA 3TSZA 3RHFA 3DL0A 4TL6A 5CLQA 1W0JA 4B6FA 3MWLA 3MFYA 3U61B 4D4LA 3ZLJA 2VP5A 1U9IC 4KI0A 2ZROA 4G5OA 1HH4A 3SE0A 1UF9A 4GBMA 4XSGA 2MMGA 2QP3A 2CNWD 5IDVA 1Z0AA 3AF3A 2JIZD 2KBEA 5JWHA 4Z51A 3G0HA 1OE0A 3AVOA 1L8QA 5FBRB 1Q1QA 4Q4JB 4G0NA 2PH1A 2BC9A 5BQ5A 3A6PC 3KUCA 5KDLA 4PPNA 4HB0A 3PV0A 5TB5A 4OQMA 5CM9C 4PR0A 5CJ2A 3QXXA 1CKEA 2NGRA 2H8KA 3TMKA 3B6EA 4I1OA 3B60A 3GEHA 3IBGA 3HYRA 1E1QA 2AKYA 5JZVA 4KYUA 2JJ1D 2YVUA 1KO1A 4DEYA 3K70D 2WJVA 2NO1A 4EFMA 3EZ9A 5FTMA 2IYQA 621PA 1VTKA 4GNKA 1ESMA 1JR3E 3BB4A 2CVHA 1G5PA 4D4MA 1XPOA 1KAOA 2B92A 2DFLA 4U00A 1E9DA 2AFIE 3WBJA 3QSYA 1HY3A 1W44A 2DWOA 1E96A 1JI0A 5ANRB 1M1YE 3X2SA 3THOA 2ZUBA 3IO5A 2GETA 2H7VA 3QKRB 2ZYWX 3CNLA 3QF7A 4JLAA 4LJ5A 2ZUCA 4EKDA 1KI9A 1LF5A 3H86A 3OE7A 2VP4A 4RZ2A 2BEKA 1VIYA 1S96A 2GZHA 4Q47A 4P31A 4QL3A 2DR3A 5EE1A 4DSOA 4B3DA 4IDQA 2DYKA 1W0KD 2VSFA 4C0HA 4DCNA 4IHQA 4DWJA 4EPYA 2O8FA 2IEYA 3NKVA 1JBKA 4PQRA 4R2HA 3F0TA 4HAWA 4HATA 5JJIA 1DOAA 1W1WA 1KDRA 4QJ5A 3RSLA 2WZQA 5BN3A 2GAAA 3U7EB 4B3GA 3AF2A 1KSHA 4HAXA 4A0HA 1RYHA 2ZRBA 3EIHA 3T06B 2DCUA 1QHHA 1CJMA 3O47A 3AQ4A 1XTJA 721PA 2ZJZA 1JAHA 1OT3A 2QSYA 3EW9A 2HCJB 1G3MA 1NF3A 4OQFA 2ZQ5A 5KO2A 2ZJ5A 3AP2A 3H84A 2QRNA 1E32A 2H18A 4MYCA 4Q9IA 4IVRA 3KB1A 2FJUA 2W00A 1ANKA 1P73A 4Q4LA 4DLVA 2WMNB 3KFXA 1G4AE 3CLVA 4NCJA 4OHWA 1XX6A 2UVQA 5AWFC 1E6CA 3K0FB 3TH5A 1M2OB 2IYTA 1DAIA 3TR5A 1TX4B 1Z8FA 2XB4A 1FPMA 1YR7A 3NTUA 1GNRA 3GJ7A 2O8EA 3K8YA 2VEDA 5C4GB 5JWOA 4JLMA 5L3RA 2FOLA 1ZU5A 1GSIA 3SYNA 3KQKA 1XMSA 2VF7A 1K5DA 1OYYA 1NN0A 4JYBA 4QM7A 2ANBA 2YOGA 2QN6A 2QQ0A 4NHOA 4TWZA 1OH7A 1QDEA 4FMDF 5DN6D 2QG6A 4LV6A 2PMKA 5HCNA 1JXMA 1YR9A 1G17A 1UJ2A 1XD2B 1Q12A 4R2IA 5HKKA 4BPBA 3OEED 1CTQA 4C3ZA 4TZ0A 4M21A 2ZI5A 4MQBA 4DLWA 3I61A 4Q9LA 1ZUHA 1E9AA 2Z43A 3GLFA 4PQFA 3QIAA 4EQ6B 3QKTA 2O8CA 5G3ZA 1KI1A 5FBLB 2JLRA 2OBMA 2NPFA 3NHBA 2F6RA 4F92B 2QRZA 1JALA 5CJPA 4DSTA 2GNOA 3GEEA 4FW9A 3NBYC 2VIIA 2WJYA 4E09A 1AIPA 4RY2A 4ZIRB 2BOVA 3KQHA 2IYRA 3PJRA 2ZE5A 3CX6A 1F6BA 3IKJA 4FMDB 3JVUA 1WB9A 3CW2A 1N6LA 5CB6A 4MA4A 1S3SA 2XITA 4DCSA 2BCGY 4BFZA 1G16A 2A5GA 4BQSA 3RWOA 1XEWY 4IRUB 5D3MB 5DISB 4CEIA 2J0UB 2YOFA 3C16C 4M0LA 5HE9A 1R2QA 1XZPA 5C4MA 4B32A 5GVSA 2Q9BA 3OIWA 3CPHA 1Q20A 1XDBA 4Y0VA 1TF2A 1Z6XA 4JLNA 2IXEA 3I1FA 3DZDA 5JCPA 2ZE6A 5JJKA 2ZRJA 3QBTA 2FA9A 3HYTA 4Q1DA 1JJVA 2CDNA 4KFSA 2JLWA 1IHUA 3PEYA 5K8LA 2ZJAA 3V4RA 2CL6X 3QE0A 1MR3F 2GESA 3ZIAA 3BD9A 2CEAA 2C9OA 5FOTA 4LX0A 3G5UA 3LQRA 2WMOB 3M6AA 4JZKA 4DC9A 3M0EA 4QBIA 3P32A 2C98A 3LNCA 2SHKA 4Q1AA 4TQ9A 3WRYC 4EJSB 1L4YA 2I1VB 3REGA 1Z3IX 1SVSA 1KO8A 1XXHE 3B9PA 3IILA 2E1RA 5E95A 3T34A 4QBHA 4DLYA 1GITA 1J2JA 2NO7A 2GA8A 1N6HA 2WWHA 1N6IA 4NCNA 2I1QA 1G6OA 4LBYA 4TL8A 3AUXA 3QXHA 4LHXA 1IY1A 4DLXA 4CW7A 1J8MF 1GDDA 2RGCA 1N6RA 2V8OA 3RABA 1EX6A 1TPZA 4V0MA 4QOSA 1E4YA 3TQFA 2Q6TA 3MWJA 4OYHA 3THWB 1Y63A 4WA7A 2D74A 3LVRE 2QQEA 4BFSA 3GPLA 1MO3A 4CDGA 1NN3A 4Q9KA 4OHYA 1E79D 2AWOA 4A36A 1JEDA 1F5NA 1KO7A 1CJTC 1COWA 3ZVLA 3AM1A 1P60A 3BIFA 1NVXQ 3SEAA 121PA 3I5YA 3KJHA 4UJ3A 2C5LA 5LPNA 3CRQA 3MWYW 5FUVA 1QF9A 2IYZA 2HYIC 3P4XA 1NNEA 5KOYA 2JATA 3EZ6A 1E1RA 4PSKA 3C8UA 1NVWQ 3FMIA 4P4TA 1XTKA 1KDOA 1DAKA 2ODEA 4HSEA 4M22A 3QF4A 4NYIR 4W9MC 2YKGA 1EXMA 4HZUB 4OKSA 4KFTA 1U94A 2Q3MA 4GL2A 3LD9A 4N0DA 3Q7QA 5BYJA 1Z0FA 5KHOC 1V43A 3THXA 1Q3HA 1YQTA 5AJWA 2VSXA 4TYWA 2IF2A 5L3QB 4JT4A 1CXZA 4F4IA 4M9QA 3LLUA 2ZAMA 4B3CA 4YDSA 3WP1B 1Z6GA 4PC6A 4K81B 1T8UA 2X77A 2F1IA 3LXRA 4PAMA 2A9KA 3O8RA 3QUSA 1CULC 3F5FA 3SR0A 5EE9A 4BWYA 1ONBA 2P6RA 2AD1A 4Q02A 3WP0A 4IXMA 1ZINA 2BV3A 1HV8A 3U3MA 1XCMA 1NVVR 1XXHB 2R9VA 1G3IA 4DRZA 3HU1A 3VAAA 1X8LA 2F9LA 3L0SA 4OI0A 5HZHA 3A4MA 2WJJA 2J59A 4D0NA 2EYUA 3QQ5A 1ZIPA 3FKSD 3GQBA 2AFHE 4QXAA 1KOFA 2HF8A 4RZXA 4WAUA 4IOKA 2IS2A 4EAQA 3IBYA 2EWVA 1S4QA 3SU8A 1VCIA 1GRQA 2CXXA 1ZNYA 2EW1A 3MGCA 4QNMA 2ZI7A 4M9XA 4TTRA 4M53A 4JKYA 3WMEA 3N5CA 4EDHA 3NEJA 1OH5A 1E2JA 1IXSB 4G01B 1II0A 3HPRA 2XZLA 2KSQA 4AURA 3VR3A 3W34A 4L4UA 2B8WA 2IS4A 2IF0A 3HPQA 3TUIC 4AYWA 2O52A 1D9ZA 3A1WA 4NU0A 1XJ0A 4NZYA 3VR6A 5JS8A 4XIGS 1E2FA 3JZAA 3RWMB 5KPJA 4FN5A 5IRCD 2J0SA 5JSZB 2HF9A 2FF7A 2X2FA 1LVGA 1KMQA 5TY0A 1LS1A 1YE8A 4HDCA 1G20E 3D6TB 1F2TA 2AKAB 2CK3A 5DHFA 3SBDA 2Z4SA 1Z2CA 2BBOA 3TE6A 5EJEA 1N5IA 3RS4A 5L3QA 3R8FA 1JR6A 4IKEA 2BEJA 3SN6A 4DCTA 2CLSA 4M1OA 2YHSA 4N1AA 1JB1A 1IN6A 3BH0A 4II7A 2GBLC 4Q7LA 2Q3FA 1GTVA 2REOA 2OBNA 4KO8A 5F9FA 2QSZA 5DLQC 4I1VA 4MGZR 3KJIA 3VR5A 3CM0A 1L2TA 1ZNZA 3P4YA 1W2GA 1SXJD 1XEXB 4G5GA 5DNYB 2OHFA 2WJHA 1X8KA 1KI4A 1S2MA 2CVFA 4LDJA 2JEOA 1ZC4A 1N6PA 2AR7A 4URZR 4QGAA 1SHZA 2R6GA 3U4QB 5K8TA 4U02A 2IUSA 3BERA 4BRUA 1DVRA 5JFGA 1W5SA 4LK2A 3QVUA 5AUQA 2PEZA 3W3AA 3B9QA 4IDNA 2CE2X 1LFDB 4YC7A 3KKQA 1WMSA 5EQTA 1VG9B 2HJVA 5FL3A 3U44A 3B85A 1L4UA 1P62B 1XTIA 1KHTA 4QC2A 1XMJA 2FPKA 3WYAA 2QAJA 1FP7A 5J4LA 3OIYA 1CJVC 4WBSA 5HCIA 5HZKA 3U7FB 4Q4HB 1GILA 4DKXA 1IY0A 1IXRC 1UFQA 2ZYTX 3DMDA 3QPUA 5JLJA 3IO3A 5HTKA 3BJIC 2QP9X 4HZUA 4RKFA 4NCHA 2FZLA 2ZITA 1U8AA 5FFMA 5GVRA 1E1RD 1G3UA 2JLUA 3MSXA 1F3OA 3AVWA 4G5SA 1HE8B 4PAQA 1HTWA 2ZRCA 1NVVQ 2VO1A 3GLFB 5D3MA 2RCNA 2HT1A 2RMKA 1NBMD 2WJIA 1P75A 4G3XA 1G64A 1LS6A 3GJ6A 2ZAOA 1K5GA 3CB4A 3KB2A 3GEIA 3GJ8A 1ZCAA 2H16A 2GK6A 4FMCF 1OV4A 4OI4A 3RDPA 1J8YF 2MMCA 3PEVA
chains in the Genus database with same CATH superfamily
3RIYA 5EGSA 3LL7A 1LK7A 1UDRA 2A8YA 2VH1A 4LRWA 2AMVA 3UHOA 4XLZA 5A2QA 1J1UA 4MPTA 1GAEO 1MA3A 3CR7A 2Y1CA 2BHLA 4UAGA 4OD0A 1WVMA 1ECGA 4E2FA 1U3GA 2WJAA 3PGA1 1GTZA 1NYRA 1Q7CA 3CWZA 1ZITA 2COUA 4JBWA 3REFA 4LTNA 5IVPA 4KIWA 2H2DA 4P2GA 4C6TA 4TWAA 3VR4H 3VZDA 1C30B 4XRRA 5ILQA 3UFXA 3LFTA 5JRDS 1PZHA 5A3JA 2QVCA 4YALA 3JQAB 1KMMA 3Q7EA 2B99A 1W49A 4RV4A 1YQWA 4TKLA 3QLEA 4XWAA 4RK0A 5DN9A 2V9PA 1A97A 3GNLA 2H92A 3O8LA 3O0TA 4WT7A 3SY8A 4AP9A 2BIFA 2IEAA 3VBEA 3N76A 4IOMA 2QN2A 5BURA 5ICGA 4QVIA 1EB9A 4WPGA 3IIIA 2I91A 3I9KA 4C20A 4WZAA 4EO7A 2H1FA 4Q3BA 1CNEA 4KXFB 1U28C 2ZSFA 4BNNA 3QOXA 2GT1A 5L3SA 5AKXA 1AXEA 4ZDJA 3QFRA 3T4EA 3AJRA 2J8ZA 4XWGA 2B34A 1CUJA 3G2PA 4GI7A 4ISBA 4WESB 2BN4A 1HNZB 1RYEA 4BWFB 2K2WA 3B2EA 1PFWA 3RJZA 8AT1A 1TAHA 1GOTA 4MRVA 1C9JA 2ZCUA 3KKOA 2QX7A 3Q5DA 1R10A 2WB4A 2QPLA 2LDXA 1PU2A 3PNVA 3Q72A 1I6LA 2XQJA 3EFBA 1DKUA 4XOIA 3AR6A 4O1MA 5KB3A 1YU6A 1Z4OA 2JLSA 2J0UA 1E9CA 1K3TA 2WYOA 5KQGA 1Y37A 1Y7TA 4F4CA 5JFTA 2X86A 3FB4A 1EGHA 1SIOA 2A5FA 3QNUA 4G6ZA 4MK4A 1CY4A 4E12A 1KYTA 1RJ9B 4RULA 1YULA 2G0TA 4IJQA 2A58A 2PUVA 2WG2A 3GMSA 1KXJA 1D5CA 1T5TA 3I2GA 2X1VA 1GL9B 2NV2B 2PH5A 5DI9A 3V9PA 5L7WA 2CNKA 1IUOA 4EA6A 3DEAA 4HUQB 1QHIA 4X3OA 3IAS6 4J16A 1UXOA 3OHPA 1Y3CE 3QV2A 5EUBA 3TZBA 2NYUA 2VYND 3ESAA 1GZ5A 4HG2A 2RGDA 4YJHB 4NVRA 4AD8A 4C03A 5B58C 1D7AA 4U9IS 3U7IA 2BGMA 3MWDA 1NNLA 1GVNB 4QYIA 3UA4A 2RGXA 3AVUA 3F97A 1ZICA 1U1FA 5FO0A 4C1NA 5HKBA 5JECA 2CXTA 1N7HA 5B6PA 1IBLB 5JIBA 2BWJA 3H8JA 4BVGA 4DT1A 3IV7A 1FW6A 3EZ7A 3PRHA 3T3IA 2AK3A 2O0LA 3EXEB 1IN8A 4J0EA 5LDDC 4I9FA 2NZVG 2VUUA 2HN9A 4ARZA 3O1LA 4HAIA 3GXBA 3U17A 4Q7MB 4EHAA 4G86A 4PIPA 4HRVA 4BBZA 2P3QA 4L78A 4UD2A 2JGDA 3TS1A 5JISA 2I1LA 2VVTA 3BB1A 4TV9A 3U3ZA 4TVKA 4GICA 1Z6YA 3P97A 5CIWA 3W9SA 4JUCA 1Q22A 1QDUA 2B7LA 3LE8A 1SCNE 2ODBA 3K7EA 2NOAA 2OBBA 1UMBB 1N9GA 2BY4A 3AIIA 2EFJA 4I4TF 4X54A 1ORIA 2YFKA 4XB1A 1KO5A 1RYFA 4J29A 4LE0A 2W58A 3NC0C 1Y9EA 3H2IA 1EHIA 1SVOA 2RSLA 2VQSA 3GV0A 1L7VC 3PB3A 4BB6A 3A9CA 1QSGA 1M1NA 3B1WA 4JQZA 4ZZ1A 5A5GA 3CN7A 1Q91A 2R00A 1A9SA 3VTAA 3HY6A 2JGRA 2LE0A 4RA6A 2C4TA 5EXTA 1W4RA 4X8HA 3B7GA 5FUYA 5LZ9A 1U8UA 1PCXA 1UZAA 2GCEA 3FPHA 3FWPA 5DK6A 1XZFA 4BFXA 4B40A 1OOEA 4H7EA 3LQFA 5JOQA 3PEUA 5C52B 1U7WA 5FTWA 3QEJA 4QEZA 1UDCA 2BRUC 3S0JA 1J0BA 2W42A 1JG3A 3U0VA 2YJ4A 3K9CA 4GOJA 3TZHA 1RC0A 3V4VB 1UEJA 1KMCA 2IW3A 1QH9A 1OIWA 4FFWA 1FQJA 1QX3A 2CXHA 2G77B 3CE9A 4FUTA 1G9XA 3G3EA 5K8CA 1SK9A 2I5PO 5FULA 2WKQA 3FPLA 1PBTA 3OQIB 1Z6PA 2QL7A 4G8BA 3TLGA 5KKCA 3L7JA 4C7BA 1H2WA 5BOSB 1KQPA 3N59A 2FPXA 1EWTA 1V7PC 4N8EA 3N2YA 4IGKA 4HNVA 3CZQA 4WNCA 2RJ3A 1KQGA 4WXHA 3G8DA 4PO8A 2DLDA 1WQ3A 1EWRA 2W2NA 3UG7A 1L7OA 4BUZA 1LCIA 1RQ2A 4H6WA 4TWRA 1LZLA 3DAOA 4WA8A 3U4HA 4NWIA 1BWSA 4QO7A 5BN3B 4MIOA 2OT3B 1WM1A 2OSBA 4D4LA 3JVEA 4G24A 5BR4A 4MW1A 1A5AB 5EFOA 5EY5B 1B8UA 1SIBE 1VDMA 2J5BA 3WYFA 3KOMA 5BSMA 2WK1A 4FOSA 2J46A 3UC5A 4CQNA 2ONKA 4RXMA 1F20A 1FJGB 3RKUA 3NBZC 2C95A 2FZ4A 3H5RA 3U3JA 3ZVNA 1XZCA 4HKTA 1A2QA 1FDUA 3PYXA 1TCVA 3QX3A 1JHDA 5G40A 3RJ5A 5JRJA 2O0JA 2V7GA 3TOXA 4X5OA 4POAA 4JA2A 5BXQC 2JLCA 4GZ3A 2NMVA 1E6KA 2ZJ6A 2E21A 4M0DA 3BVPA 2FX3A 4LCEA 4RPHA 3R3UA 3TQCA 2AZTA 3C7KA 3UMFA 1GGKA 2CFIA 2CK3D 3LG2A 5DDIP 2RJNA 3RS9A 3DDHA 1XT6A 4HN2A 3C87A 1Z0DA 2UAGA 3B7WA 3IAFA 5IEBA 6GPBA 1A9QA 5GQSA 1R8JA 2N42A 2XRYA 4IDPA 1NLFA 2IDZA 4MVJF 2OO5A 2Q3HA 2WPDA 4X7RA 3WDLA 4DV2B 4Y2HA 3PR3A 1E94E 4II3A 4ZAFA 2J41A 1X9IA 2C54A 3UGQA 2ZYAA 4C0SA 2A4KA 5JMTA 4AUMA 5KSZA 3R75A 4BGIA 4WINA 4A2WA 4DJEC 4MTLA 4JUBA 2FETA 4KV9A 4CBVA 4RIFA 3SM9A 4LBVA 3PD1A 4BZXA 1QVZA 5JAHA 4Y9TA 2ZWMA 1PZEA 2AUTA 4Q7KA 3IPXA 3INGA 4R81A 2PVPA 2PX8A 1U7DA 4N0QA 2R6FA 1I7LA 2EDCA 4Q66C 3S55A 3ZZMA 5K4GA 4LZNA 1C4WA 4KLZA 2XNDA 2D4AA 2OCYC 3GLTA 3TGPA 1D04A 1CLUA 1GG2A 2Q62A 3BF8A 3BMXA 3MD0A 4IJWA 3NWEA 4OIFA 4XX1A 5DXAA 1JEYA 5FPQA 5D7NA 3QV1A 1N36B 3LUKA 3E1GA 3NUGA 4FJ2A 4O6VA 5KTSA 3M8KA 3ZHYA 4CF7A 5JR3A 2PJRA 5T4HA 5DGDA 5CXQA 2ZSBA 1O4WA 3GARA 1CRPA 4K87A 4B73A 4QUDA 4NBWA 3JATA 1QK5A 2PFGA 2R1ZA 3VYUB 4FZ3A 1UPAA 4EA7A 3G0GA 5LNK6 5MHTA 1NJ5A 2GM3A 3KJGA 1YCDA 3WJ1A 2ZTSA 1F12A 1QRAA 2RE8A 1WV1A 4Y1RA 2P75A 3F8WA 2WF7A 3FJ1A 3CRNA 5NLLA 2OLJA 4PANA 2LKCA 1LKZA 3OAAD 4TSFA 5JFOA 3WMXA 2CYAA 2DM6A 4EBBA 1HFJA 2JAUA 1J0XO 4FDUA 3I72A 3PC8A 4D45A 4RSHA 1RXWA 4MYSA 4ZK2A 2BGTA 2F43A 2IGBA 3UJPA 1KNXA 3QTTA 4E15A 3A3NA 5FEMA 4UEKA 4WUTA 1PYOA 5FCDA 1CUWA 1SY7A 4ZVLA 2HSWA 5KNCD 3ZZ1A 2VH5R 3QX8A 1EA7A 1FFGA 4B82A 2Y0DA 4C0LA 2J30A 4R2XA 2PQMA 4FCVA 4WGGA 2HB6A 4ZVKA 2FPPB 4JL6A 3IOCA 3M4XA 5FWAA 3TI7A 5KNCA 5L7YA 1OGIA 3KTAB 2B1IA 3W5IA 1NN5A 2A92A 2H4JA 2J09A 2QYHA 3P9ZA 3PNLA 4TGLA 1GA6A 4JLKA 1J70A 4ZVSA 2YRWA 2ZT8A 4DA0A 4NMXB 1IUNA 1JWLA 4PIVA 4A6XA 2ZJBA 4B7ZA 1ZVQA 3DFFA 2XMQA 4PV7A 2X9NA 1KYVA 5KQMA 3NOQA 3KD3A 1I9GA 2WTEA 2BISA 4WCVA 4C3VA 2P9BA 3FFBA 1WCYA 2P30A 4IQGA 2HREA 2IPOA 4Y30A 5K0LA 4KNYA 3NHUA 2BKUA 3DDUA 2HJRA 4J43A 2ZBRA 1JSRA 2J3KA 5BORA 5I7EA 1R8XA 4IHJA 1CUYA 4YMSA 5A9SB 5TJHA 2QRVB 1DCMA 4JBXA 3QEAZ 1Z4NA 1I6WA 2QJRA 2X8JB 3AUYA 4NLLA 2JFXA 1U3CA 3R7DA 2DBVO 3F1LA 3N2NA 4JMLA 5JZMA 5EZYF 1RMQA 2JFHA 1P0QA 3JYHA 5HE8A 1FU8A 4BY9E 4RF5A 3TK1A 1Z37A 4EX7A 3CU5A 2ADOA 3CPSA 3ZE9A 4LY0A 3UW1A 3K0HA 1U0OC 1SRQA 2QRGA 3CO5A 3HZHA 4E88A 2BJHA 5D6OA 3U4CA 4WZAB 4KDEA 4YRAA 1MV5A 1Z38A 2FZGA 5HVNA 1L7XA 4QPJC 2VTKA 2JVKA 2YUTA 3FE2A 4F5WA 1AKYA 3N8NA 3O8QB 1IG3A 2IJGX 4PHGA 4QQ8A 4A26A 1CZOA 4NENA 1VB5A 1SBCA 4YP7A 5LOVF 2O2IA 3OZXA 1P45A 1O97C 4ARBA 4O3MA 2H2FA 1CIJA 4ENVA 2IL1A 1C7IA 3D7RA 5ES4B 1HDEA 4E32A 1SOMA 4DZRA 5IFLA 3UWKA 1ZGZA 1I3CA 3N2KB 1EBFA 3ZV6A 4BV2A 3NATA 1P9OA 4AZ0B 1KH1A 1CR6A 1D4ZA 2PUFA 3RAPR 3H4MA 5ESXA 3H2GA 5EA2A 4KO3S 3FLEA 3UHPA 4I08A 1ZWLA 4A03A 1CERA 1H65A 2VPQA 2YOHA 3DLPX 3SD7A 5I6DA 3AG5A 4FGSA 3QHAA 4OM7A 1P77A 3VC3A 3JQAA 1JKIA 3HEAA 3QLJA 1XTTA 1KETA 4HQ6A 2XUIA 5FLKA 4O4LA 1G18A 4NECA 4ZT7A 1ZMRA 2ODQA 1N9KA 1ADGA 3K5WA 3TW4A 3O26A 4LDZA 2VPYA 3A1UA 3LQ2A 3RUAA 1EAYA 3BZWA 2M32A 5ESRA 4HVLA 1AMOA 3FSGA 5DM70 2EW8A 2RHMA 7MHTA 4ZRNA 1DKOA 3ZI0A 4RDXA 3SNHA 3EQ2A 3WK5A 3OE4A 1C9KA 2A4MA 2QX6A 3ISTA 5CCBA 3GDWA 4OBEA 3A1SA 1JEQA 5B3JA 1NJ2A 1SRRA 2D59A 1XPRA 2FJ0A 2D7DA 3ERCA 1GKYA 1GQQA 2YVLA 3IE2A 3I8SA 2F17A 1TUIA 4IPTA 1ZD8A 1H4QA 3IPYA 2G71A 3G2LA 3WRXC 2BLLA 3J7AC 3U1VA 2GXUA 4F3KA 3K70C 3IVAA 1M0SA 2A5YB 1YDFA 1B23P 2V1XA 2X0KA 3NBXX 5AK4A 4Z2YA 3IB3A 2HSZA 1QC5A 2DQYA 1T36B 1L1RA 1Q16A 5D87A 5FAXA 1H5QA 4N01A 4Y0AA 4DYVA 1LUAA 2HIGA 2H4XA 3NALA 3IDZA 2BYTA 3LXUX 2UYCA 3W4IA 1VA4A 1LQUA 3SKVA 1K6IA 3H5AA 2JJ2A 4U7DA 4LVOA 1FTGA 2D3TA 2J08A 3NBAA 1NUTA 3TSWA 4DJFC 1GN8A 4D02A 1OXKB 1Y6GA 4IGIA 4CIDA 3R7WB 1K86A 1JWBB 3HYSA 1JEJA 5FDFA 1T4MA 3HR8A 3LY7A 3TCKA 3ZHOA 1PR4A 5KOJA 5C31A 2TECE 1M34B 4HMQA 1YDMA 3O0DA 1WUKS 4KXYA 3WGZA 1PZMA 2QRHA 1KORA 2F7SA 3SC4A 1P80A 4GDMA 5J9FA 3I3OA 2IYNA 4MKFA 1OWPA 3OZ7A 2KQUA 3LO8A 3R5KA 1NW5A 1QYWA 1DKPA 3BG5A 2VTVA 1KS2A 1WP9A 3ZNNA 4H31A 1V5EA 2W2MA 5HK9A 1DP4A 3CPEA 1TIBA 2PUTA 4H6PA 3ZTYA 1J2YA 2QD4A 5LNK1 3G6KA 1F2UA 1P7VA 1V16A 4EA8A 4ZJZA 3VR5H 2G80A 3GEBA 4RWZA 4ETNA 2FUCA 1QG2A 5A6SB 3VU0A 4UJ5A 3BCRA 1P4GA 3AF0A 3ANNA 3LLVA 2XXAB 4A8PA 3UT0A 5T57A 4UQPA 1KI6B 2VJBA 4QARA 3FF1A 4DA4A 2H00A 4INAA 5KDOA 1MT0A 5DF1A 5TJ9A 3IHTA 5HMMA 5CPFA 1SKQA 4BVKA 2C5SA 4YUYA 1X1EA 3C4JA 4DG9A 4CKCA 1G19A 3HXMA 1ZJ5A 2VATA 5BV0A 3IAM6 4G0ZA 1A3CA 2Z2IA 1T9HA 3SXPA 3AV0B 2XA1A 3DSRA 5DYTA 1G2IA 1A9RA 1OJLA 1YZGA 2IHVA 2IYXA 4RANA 1RD4A 3GYBA 4GP7A 1J24A 3IP8A 1ARZA 1FVXA 2ATIA 4QSMA 5EE3A 3X1WA 5A2GA 4ZV9A 1UWVA 4U6SA 1L5OA 3VR6H 3PEWA 2OK7A 3JSAA 4P22A 4N48A 3A4IA 1IEXA 1S3GA 4NG5A 5I9MA 4N47A 3ZHBA 3C3CA 4CLEA 1OX4B 1QGZA 2CHFA 4OQNA 3VAZA 3H8WA 3G8YA 5KKAA 3UJDA 4K9OA 3TQTA 5EJ7A 1GKLA 2DTDA 3Q3VA 3GBSA 4P98A 1IBCA 4JYZA 1GZ6A 1G1AA 3DFUA 2O50A 3FPGA 3H1PA 1EXDA 3EMKA 2ZRHA 2J07A 3L18A 4NDZA 1U3UA 1IHYA 2QT0A 4PLPA 3PIIA 1WD7A 2WY2D 4FFRA 4ZVRA 1FX0B 4A10A 1YKGA 3KT3A 3GQBB 3M5WA 3THRA 4N5LA 2DQKA 2Z4RA 3QU2A 1CUXA 1NUUA 4BAZA 1WUYA 3KTAA 4ZT6A 2QS9A 3ICEA 3OD1A 4X90A 4ZO9A 4CMHA 1HDCA 4DDUA 5AQEA 3NDIA 3NWJA 4JHXA 2HWYA 1SUCA 4QOEA 4ARCA 1N57A 2BFFA 4A7PA 2DC1A 3BAFA 1MV8A 1BS9A 1H42A 3D02A 1DJNA 3E9NA 2XF8A 2PWAA 4LXIA 4LOJA 4YRDA 4R2KA 4S1WA 3SOPA 3RO7A 1X94A 1XMXA 5BNFA 5KSPA 1GM5A 4IL5A 3B1XA 1QDLB 1QHXA 3FOCA 2WKWA 1L5NA 2BGJA 2HMAA 3IEIA 4DA6A 5LLTA 1P5RA 5EL0A 4WOBA 2AI1A 5K45A 5JCJA 3W5JA 4GZMA 2VF8A 2DKNA 3D4OA 4N0EA 5FP0A 3QVJA 3PI6A 1MC4A 4UNQA 1YQDA 4TSFD 4OLAA 4D25A 2PZAA 4XM2A 1XQ1A 1Z22A 2PZJA 3H04A 2Q5HA 3L04A 4YACA 4E4YA 1PRYA 4OQYA 4R3UC 4CDNA 2ZUFA 5AJZA 2VJCA 3BJRA 1E64A 1XNJA 1NVDA 3EG9A 3O4GA 4Y2JA 4CI9A 2O6HA 2QTFA 4INJA 5CVDA 5HF8A 1FDOA 5T4EA 2WJZB 4R84A 3K2BA 3MD9A 4UDYX 1JIVA 4UVHA 1DC3A 4GLBA 5EXDA 5BY2A 4FB4A 3O4HA 1E77A 2OHHA 3HY4A 3Q7SA 2BM8A 3WBBA 2X6QA 3T8YA 2PA3A 3AHDA 1NA5A 4UTZA 2G9NA 2ZFUA 4ED9A 3DKRA 5L45A 1MEOA 4LOKA 2H07A 2VAXA 2UUCB 3UXEA 3MS2A 3G0BA 1I5RA 3SC2B 2WT4A 2Z5LA 2PLRA 1GAQA 1C7JA 1RWXA 2YTZA 2GLTA 4ND7A 4NFLA 3KQLA 4E30A 4DCUA 4YJDA 1H0SA 1L5QA 1BVHA 2ROQA 4FS8A 2XMGA 5COAA 2ZRAA 4X8LA 4OREX 1P2UA 2FKAA 5FBHA 4EFNA 4HDRA 5C2JB 3MBKA 1NQVA 2YRFA 4QX6A 1CV2A 4TUYB 1JJFA 4K05A 1UXIA 2GILA 5DGTA 3RJMA 4C08A 1WQ4A 2F1HA 3WL4A 1ZL2A 2YZNA 1CY6A 4FFNA 4ER5A 1U1GA 1CUEA 3FHCB 1ZJWA 4PSCA 1UADA 4KXMA 2JGDB 1UL1X 1ZIXA 1ZD2P 2GJKA 1TKCA 4M9ZA 3OCUA 5K51A 2NSYA 3GFBA 1A1SA 2H4FA 1KP9A 5A03A 5KU7A 2YUIA 2XZDA 2PPVA 3BRCA 4HH3C 4KDFA 5TQ2B 4Y9UA 2HQRA 4HQLA 1MX1A 3BGIA 4MAMA 2RG7A 5IVDA 2KPOA 3MCAA 2VT7A 1TD9A 5LM3A 3TUZC 1IK6A 1M6VB 3PA6A 3VKWA 3TB4A 1AG9A 4BX2A 2HM7A 1MU0A 4OG2A 4C2BA 1T5BA 4HDRB 4LRUA 1FFSA 1NN1A 2QORA 4HLDA 3G2NA 4OJTA 3RLFA 2OO3A 2RH4A 1J5PA 2XDAA 4K6FA 4GQAA 3ZY6A 6NULA 1JEYB 4WK6A 1TO2E 3TECE 3AFGA 3EARA 4BEWA 2O14A 4QOJA 3K9NA 1WDWB 2PIAA 1L3BA 1RAHA 3P9CA 5KREA 3NG1A 4D2IA 1XVVA 1R9JA 2PK3A 4B6GA 4JGGA 4R1LA 1ZA1A 2QWXA 1MZPA 1VKOA 1OWMA 1XTQA 3FZNA 3PFKA 3ZLTA 4UTNA 2OVFA 3ORQA 2HK6A 3A4LA 4PWYA 3STYA 5I4CA 2CDCA 3K1JA 5DHRA 5CLJA 3G7UA 4ND8A 4U2BA 1QFMA 4EF4A 4L8GA 4MQ6A 1NOJA 3RC9A 3Q2KA 3R7WA 3TLJA 5KTKA 3UHAA 3C5VA 1NW6A 3MILA 1DRUA 4HS9A 1QG4A 1T9CA 4RK7A 4Q0MA 5C5IA 1YRWA 2D5IA 1TZKA 2YQ4A 3PCXA 3ZE7A 4G63A 2FRDC 4IDFA 4IQFA 4Y1GA 5AM4A 2LD4A 4JC8A 5TARA 4V1CI 2IYSA 3LQ1A 3K9QO 4YONB 2Z9BA 2BFEB 1U0HC 1UXJA 4WOKA 3H5TA 3AB7A 4YCNA 2FUEA 2WSSD 3R4CA 1US8B 5CYOA 6CHYA 1OPXA 1JFTA 2P3LA 2H17A 5A7GA 4NXNB 4UQLA 2WYVA 5I7UA 4MA5A 5CLFA 1YS7A 4W9NC 4KCGA 1I94B 2HW8A 1NMQA 2GK3A 4O2AB 2EBFX 4GLOA 4UPVA 2IV2X 3D7NA 5JZSA 6REQA 1J97A 2E55A 2F3RA 4P33A 4QVKA 4RQTA 4FD2A 2C7BA 1NJ1A 4PNEA 3FSJX 1BNCA 2GI4A 3D8NA 2XYQA 1LZKA 5F5LA 2AZXA 1XSEA 1X1BA 4WIAA 5ALIA 4F96A 5AI0A 4N7RA 4D99A 2LBPA 3RU9A 5LIPA 3AVXA 2ZLBA 1ZM9A 4G1VA 5SZKB 3B9BA 2VQDA 3E23A 2N1MA 2YCLA 2H9YA 2HWKA 2WWIA 3DHEA 2AH5A 1OR8A 1ABFA 2HJWA 1YBVA 1T4CB 1Q1GA 4JB2A 5GV8A 3NYRA 4ICIA 5AUPB 3I73A 2NO9A 3C15C 3CUKA 4F4DA 1AHIA 4G36A 4REQA 1X19A 2H51A 2H9AA 4L5IA 2WHPB 5D01A 1DTWB 2BFWA 3OTHA 1LW6E 2RHDA 2XCTB 2XTNA 3KTOA 1Z4IA 3QEOA 3SBOA 3HS3A 1RLIA 2DKFA 2K87A 3G2MA 4ZOAA 1Q3TA 5C46F 2AXEA 1NC3A 2V59A 3QLVC 4BNGA 1Z34A 2AJDA 1BMFA 1V3VA 3HWX1 3MCWA 2G63A 4ZA2A 1EH5A 1A2KC 3EVTA 1I3LA 2X7JA 2FQYA 3T38A 3DUFA 2ZIWB 4IG9A 5T5QA 4NG4A 1SELA 1XAGA 4BDSA 3N6RA 1DMSA 3L1IA 2E6UX 3K0BA 4AZ3B 4F45A 4HSGA 4TN1A 3P4UA 1DAHA 4J0IA 4KWHA 3DLIA 2E4ZA 3K6RA 3AHFA 5BT8A 2HMVA 1RWBA 4DY4A 1BEUB 2HBYA 1H8ED 2IIQA 3MWEA 1AQIA 5H1YA 1IWPB 2ID7A 1FS4A 3IQIX 5LUAA 3FKSA 5FF9A 5LA6F 2FPLA 4O4HB 5IMBA 4UU0A 1J8VA 5F7XA 4ZAXA 1YJ8A 4CLHA 1OYOA 2CL7X 3EUAA 4CQMA 4GYJA 1GSHA 3LI2A 4DV3B 1QP7A 5LR6A 2P9TA 1JKMA 3K8OE 1UXKA 2XNSA 4D9BA 2V7QA 2WILA 3KG2A 1SA0A 1PNQA 3CBQA 3FLBA 4B4VA 2ZU6A 4IOJA 5BSFA 3OZEA 4MUHA 4AY4A 1M2NA 4G2NA 4JYCA 2HHCA 1PTKA 2DY1A 4A5OA 2XGGA 2XF2A 3DV0A 2PD4A 4PC1A 4CT5A 3TZLA 4ZJUA 3I12A 1FNSA 3C8HA 3TX2A 5C1OA 2WICA 3NYQA 2GCOB 2V74B 2R11A 1ZLYA 5FR2A 2NX2A 1JU3A 1XLWA 4XDYA 3C5CA 1ISMA 4LVCA 4DM3A 3R24A 1IULA 4EGQA 1NDQA 3E9CA 3OT5A 4ZKDA 1V5WA 3X3HA 3KYDA 4WKGA 4WQMA 3K5IA 2P11A 3QE2A 1Z5GA 2GB4A 3P9PA 3G1TA 1A1VA 3AKDA 3N07A 1LLFA 3D6NB 4R6XA 3EQ9A 1P4HA 3TIXB 1PAUA 3FGZA 5B4UA 1IZ8A 4B7AA 2WTUA 4JJZA 1RABA 2GYVA 3HA5A 1ND5A 1E1KA 4PGGA 3D8RA 1H66A 5JO9A 2XRMA 2CHGA 3VJKA 1FRQA 2Q5IA 1B15A 2WYIA 3GLHB 3MS7A 4MGIR 1XEFA 3UB4A 4IV0A 1SULA 2BDTA 2GHQA 4LZAA 1EVYA 1P6UA 2GKSA 4PPFA 1KPIA 3P9YA 3INTA 3HKEB 1LK0A 3OWOA 3QXJA 4OBBA 1DOHA 4A0SA 5JHHB 2VDQB 2W9XA 4W8OA 2HLNA 1GL6A 4BAUA 5IZCC 1PG0A 1KDYA 3IPLA 1IQ0A 2GYYA 3JQGB 1SJ9A 4MS3A 4EPVA 2OCGA 2OAGA 3QHPA 4W8GA 1NXQA 1FSSA 4GMGA 3M81A 3UZUA 4DJ5X 2FV8A 3CKYA 5CDUA 2C2KA 1QF7A 2G70A 2GPYA 2ZUSA 3ZCQA 2W2XA 4DMUB 4PYJA 1EK1A 2JFPA 4O29A 1R8SA 2P1RA 3DVRX 1OAAA 4F5EA 1JQJC 4JOBA 4YCMA 3RIGA 4B4KA 3WYBA 4B2YA 4MARA 5KYTA 2H2GA 2Y05A 3D6AA 5G0VA 1Q44A 1LB1B 1CQIA 4QGSA 4RLQA 3RVJA 2XVYA 1QIHA 4LJAA 3AL3A 3ZY2A 3IERA 4GM4A 4D97A 4DCCA 2CV2A 4H3VA 4WE3A 4RK1A 1JX6A 1AA9A 2B4KA 2FPMA 2P9EA 3AR2A 4KIUA 4BNXA 1FMFA 3TLAA 4F06A 4W99A 1XFAA 3H99A 3DXZA 4QBKA 2VJNA 2YS7A 5DNDA 4B6JA 2PT6A 5FR1A 1IEVA 3F6CA 3H16A 4XQGA 3LMKA 5KTNA 1E99A 2HTFA 4DNXA 5ARBA 1DRJA 5EKTA 1A8QA 4KAXA 3SS8A 3NIGB 1PJQA 2B20A 4J07A 1KYYA 5AM3A 2JD0A 3MT0A 5C35A 3A1VA 2Q6VA 4D4JA 5B3AA 5GJWC 2BFEA 3K9LA 2VHUA 2WAOA 4TLDA 2YX1A 3B6KA 1EG7A 2BONA 3VO8A 1NI3A 1PWHA 1FNBA 1K7XB 3U4GA 4R3NA 5C8YA 2Y9PB 4U7HA 4C30A 4B3BA 4EO4A 4ZEOA 1R3UA 2CCKA 3CZRA 3DAFA 3EZFA 2QPAA 4IHJF 4ZIRA 1E63A 2FMUA 3J81k 2GEKA 1Q7RA 2HI0A 2WSMA 3LA6A 3U9TA 2HHHB 2GYWA 1RJGA 5F9MA 2I2XB 2XZOA 4KLNA 1ZMBA 3L8EA 4PFKA 3WWOA 4E5PA 1OWOA 4BNWA 1YI0A 1V3QE 3DC2A 1KFEB 4HZIA 4XUGB 4OXYA 2VHQA 1DQSA 3K2EA 5AW0A 4DUYB 3A6KA 3FCCA 1DC6A 2BKAA 1E9VA 3M3HA 4AKGA 1EWKA 5KPDA 4JVOA 2F3TA 2CF5A 2PGNA 2Z9CA 1E1DA 2IP2A 4OLJA 1B16A 3UMCA 5TVGA 2XVZA 3GAFA 1QKKA 3W04A 1KKLA 1EFAA 4NV3A 4IM7A 2GZ3A 3ZGYA 1XFDA 3FYHA 4URWR 1QMPA 1EBBA 2I7VA 3HFRA 5TV2A 2WTNA 1Y8QA 1YFKA 4B48A 4LPKA 2B4AA 1O08A 1YO6A 2AQHA 1CS0A 4YJFB 5A9TA 2I4TA 2R66A 3P0JA 4YMVA 1AURA 1TLTA 3UM9A 2PR7A 3Q3GE 2IV7A 2ZS8A 3EFEA 1NMXA 2QQ5A 3I34X 2ZI6A 3K53A 5LZ7A 3N86A 3MQ2A 1XLTC 5D1HA 4W6QA 1EK0A 4D81A 4KQ2A 1ZCZA 2PS3A 1X3SA 3OFKA 1FMJA 2RK6A 4ND2A 3NP9A 1U8YA 2AJLI 4HMOA 3V7YA 3ER6A 1KYIA 3LPLA 2P2SA 3FHLA 2POQX 4BO7A 3IGFA 3CW8X 4I1PA 4C2TA 1M67A 4ZYUA 3IDQA 3N0TA 2O19A 2CZCA 1DKMA 3KYDB 4NV1A 3FNIA 1E0KA 2G08A 3L7CA 2JK0A 3SQNA 3VC1A 2OR3A 4HNSA 2VBGA 4RBNA 3VMFA 3U13A 3ZE8A 5L4NA 3RVDA 1I2ZA 2NU7A 4D3SA 5IT5A 1MCZA 3U3OA 2IA5A 3RUHA 1NJ6A 2GNPA 2XUFA 4RVOA 2E0IA 5BNTA 5TMPA 2Q3DA 2I66A 2CLFB 1IUPA 2NADA 2VDPB 1ZGAA 2FZVA 1A96A 4OP1A 1LLQA 4JBYA 1E2NA 1YR6A 1VKRA 2BP7B 2YY6A 3AFIA 3I9FA 4RV5A 5AW6A 1OQAA 3SXUB 1L8XA 3UWOA 3I05A 2WAYA 5CFPA 2PE5A 2QA5A 1FVOA 1EB8A 4BBJA 4FGKA 1JHOA 5IUNC 1O8BA 3FTNA 4MQFA 3MTIA 1AJEA 3G49A 1L3IA 2GCPA 3H9EO 4F3TA 3M1AA 1PKXA 5EYPA 2DQZA 3T9AA 4GSKA 5LMZA 1E3TA 1NV9A 1J25A 1RYMA 2FWIA 4MS4A 1FBTA 3EAGA 4L50A 4TUYA 5A6SA 3BN3A 4H16A 3VQTA 4P0TA 1O5OA 1PP4A 4PQYA 3KPYA 3F3MA 3OWXA 5G41A 1AQYA 2SBTA 5JQWA 4I9NA 2QUKA 4DTIA 3HRKA 4B8YA 3QF4B 5FOUA 2ZIUB 3DXFA 4LKRA 3HA2A 4Q16A 2FW8A 4MHOA 3SZ3A 5TNXA 2YZMA 5A0TA 4ETIA 4D4GA 5IAGA 1H2FA 2P9GA 2V0NA 4OSEA 3D0RA 3UMBA 2JC3A 4EL5A 3EVNA 1I4DD 5C7IO 2VWHA 4OYRA 3G6WA 2DHCA 2CLCX 2IUUA 5LQDA 1DIHA 4RVDA 5ALFA 3URMA 3RS0A 3UANA 2ZR9A 4DN6A 2OB1A 4LXYA 1DINA 3EA4A 3RC8A 2ZRMA 1G8YA 3CUVA 4J2HA 2A0XA 3P0IA 5LYJF 4JP2A 1NZDA 3UB3A 3KVNA 5DX8A 2Q9AA 2O5VA 4NQZA 3ZQJA 2AZDA 3KSBC 5CFOA 3PDJA 3ZDAA 5GOTA 5BMOA 1UK7A 4WY8A 2HA5A 1V25A 1IU9A 1Z0JA 3PNQA 4LWQA 2X8AA 3SF8B 2C99A 1J8QA 1ONSA 5JAUA 1YBAA 2IP1A 3B2QA 4X84A 1TD1A 3JQ9C 1CJUC 3NVAA 4L0MA 4TLEA 3VA7A 5FWDA 5A4AA 1E58A 3OQVA 2BI7A 3M6WA 3PQ5A 3RIHA 1IN7A 2F90A 2XE4A 2ASVA 1DEAA 2G9UA 4AN1A 1U5CA 2GZDA 1IOLA 2P62A 3KJQA 3RYTC 1MO2A 5KVSA 3K6SA 2HBZA 3NHZA 5JY1A 5DSTA 3M2PA 3CKLA 2HO4A 3OAAA 3G7SA 2VDWB 5EMKA 2XUGA 1EWQA 4B7UA 5BN1A 1EJBA 3EOZA 4PPGA 5AW5A 1R0KA 2VDOB 4LXGA 3VM6A 3X44A 1FTYA 5IX8A 2VDRB 5F4BA 1RBZA 3UN1A 4DMCA 2F3UA 3F98A 3ZDZB 1EFRA 4XYLA 3PYLA 5I8PA 4PZYA 4JIMA 2UYGA 3BGSA 2NXCA 4WLVA 4ERNA 1E8DA 1HURA 2NSDA 4URFA 3NQ41 3FUTA 4ZT5A 3ZJTA 3MRVA 4BXOA 4ISCA 2GJSA 4MLCA 3T7RA 4OA8A 4TXJA 2ZRPA 3CNQS 2J0VA 4W7HA 3Q98A 2JGNA 4TKUB 2B9VA 1EVEA 1TJ4A 2V6BA 3NHSA 1KI7A 4ZU1X 5A3SA 5HGXA 2B6HA 2BSXA 3LAWA 3G5TA 4AZWA 2OCLA 2QMQA 3AOEA 4MUIA 3ZXYA 1VA5A 4Q12A 1YACA 4Q6BA 2IYVA 3V8NA 1T5SA 1TUGA 3TLKA 4BMDA 1TCBA 5K7SA 2P90A 2GSWA 4X20B 1QIGA 3FSRA 1VFNA 1ZK1A 4HDSB 4IMJB 2P9YA 1Z28A 3GCXA 3LGXA 2QYTA 4H9GA 4OHZA 2WQ7A 1VPVA 3BL5A 3BH6A 2O8BB 1GQFA 1WDTA 5B1HA 5KNCH 4OX9Y 1EGVB 4MV8A 2QP4A 4DMFA 4EFLA 3I6ZA 5CFNA 1R6BX 4KH1A 4YRRA 4YRIA 4Q93A 4NK4A 1PVOA 3PWSA 4PG6A 1YRBA 2D7JA 3A4VA 4ZPXA 3HO8A 1QLHA 2ZETA 3D54D 4TXNA 5K0ZA 3ER8A 2LCIA 3DOUA 2XXBA 4GUDA 2AGVA 1T3LA 4I19A 4EHKA 5CT9A 2GBLA 5BN4B 5DBOA 3S68A 1EK6A 3EQ7A 3DV0B 1E1CA 2CCJA 1TQ2A 3QWAA 4GM0A 2H6EA 4HGYA 2A88A 4HDMB 1BGXT 2QVZX 1ONOA 1ZISA 1TDJA 1JYFA 3RTCA 4NV0A 5B2ZA 1BXZA 5I51A 2VP6A 1C2TA 2ZBEA 1RI5A 2AG8A 4Y6RA 1C3JA 4U8HA 3STHA 4K40A 2X7HA 3BREA 4UFOA 4XDHA 2RGEA 2EX1A 2ZB8A 4V02A 4FLMA 3J80A 1LY1A 3A3YA 4BTEA 1WKVA 1XVAA 3U4IA 4XB2A 5KJFA 2D00A 4LS3A 1O95A 4KX5A 2X6RA 3LOUA 4IW3B 2F00A 1V35A 1CD5A 3QWBA 1UBCA 3OQPA 1U7PA 3P94A 5JTUA 3TG8A 5BUQA 4EG0A 4JXJA 1I5EA 1GRCA 4CLRA 2QUHA 4R16A 4N5DA 1ZG3A 2P2ZA 3D2LA 3TVTA 4FIDA 4AKHA 4OQQA 4G0PA 1EUZA 3D7SA 3LO5A 1DQPA 4HY3A 4K46A 4ZANA 4C2UA 2G17A 1ZUWA 2CNBA 3DFIA 3OLZA 1PFKA 4QU0A 4C0JA 3LFUA 2AR0A 2CZQA 3ESBA 2RHWA 1U9IA 4P5PA 2HYDA 3CLTC 3OJCA 4JLJA 4BX0A 4BYGA 3Q7RA 1PUJA 2NUAB 3E27A 2P27A 2C4HA 2GWHA 3ZW8A 2B83A 3DEZA 4F11A 2VTBA 4UCWA 5IC6A 4NAUA 4RLFA 1M2OA 1TQDA 2PEYA 3MLEA 1XRJA 4JJ6A 4WXRA 2HA2A 3REOA 5AK3A 2HNKA 3EC2A 2HAEA 1JMYA