1IIDA

Crystal structure of saccharomyces cerevisiae n-myristoyltransferase with bound s-(2-oxo)pentadecylcoa and the octapeptide glyaskla
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
422
structure length
422
Chain Sequence
AMKDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Saccharomyces cerevisiae N-myristoyltransferase with bound myristoylCoA and peptide provide insights about substrate recognition and catalysis.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Peptide N-myristoyltransferase
total genus 115
structure length 422
sequence length 422
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2001-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iidA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iidA02
2CNSA 5F49A 2OZHA 4NF1A 1QSOA 1YR0A 3F0AA 4PK2A 4UWJA 3FNCA 3E0KA 1LRZA 4CAVA 4YFJA 1QSRA 4U9YA 3TE4A 3FIXA 3W6SA 4AVBA 3IGRA 1IYKA 4AB7A 4NEXA 2Q0YA 2Z10A 4UWIA 1Q2CA 4II9A 4UBRA 2OZUA 5KTCA 2REEA 2C27A 2Q04A 4B5PA 4KOYA 3IWGA 1Y7RA 3KKWA 1XEBA 1U6MA 2CY2A 2AE6A 1N71A 4RS2A 2HQYA 2R98A 2I00A 2JDDA 3C26A 3I9SA 2B5GB 4XPLA 4LX9A 4KVOE 5FVJA 2GIVA 3D8PA 1RXTA 2PQ8A 3CXPA 1L0CA 2Z0ZA 1BO4A 3EC4A 3TOBA 3DR6A 2PSWA 1YLEA 2F5IA 2PRBA 3R95A 2ZW6A 3LD2A 4OADA 4KOUA 4Y49C 5KTAA 1B87A 4FD7A 2FSRA 3VWEA 3LODA 3GYAA 1P4NA 2VEZA 2IL4A 1QSTA 4RI1A 4MBUA 1Q2DA 2FE7A 4KVME 3EFAA 3SHPA 1P0HA 4M3SA 1IB1E 4AVAA 3GKRA 5I0CA 3I3GA 4MHDA 3TO7A 2R8VA 1I21A 3PZJA 1NSLA 3TO6A 4U5YA 2I79A 2QMLA 4I49A 2FL4A 4QB9A 1M1DA 2ZW5A 1NMTA 4YGOA 3F8KA 2B5GA 4L89A 4FD5A 4H89A 4OAEA 4LUAA 1ON0A 4JWPA 5C88A 3P2FA 4JXRA 3W91A 4E8OA 1IICA 4BMHA 4KLVA 2Q4YA 4H6ZA 4FD4A 2NMTA 2ATRA 4B5OA 3P2HA 5EC4A 2EUIA 1XIXA 3FRMA 2G3AA 4KUBA 1CM0A 2VZYA 4JJXA 1S7KA 4KVXA 2K5TA 1S7FA 5H86A 4AG9A 2HV2A 1CJWA 1I1DA 2BSWA 2G0BA 3B8GA 5C82A 4E0AA 5E96A 3S6GA 4JD6A 3QB8A 4KLWA 3G8WA 1XE4A 5DWNA 3PP9A 1BOBA 3JVNA 5JQ4A 2VZZA 2H5MA 1QSNA 3N7ZA 2R7HA 1MJ9A 4MY3A 3R9FA 1GHEA 4MJ8A 3DDDA 2REFA 4X5KA 1I12A 1NE9A 1TIQA 1PUAA 1XF8A 3DR8A 4KOSA 1MJAA 1Y9WA 5F48A 3F5BA 3DSBA 1YVKA 2GE3A 2GANA 2WPWA 1VKCA 3NE7A 2G3TA 2DXQA 5DWMA 3R9GA 1KUXA 3TFYA 2FS5A 3EO4A 4JXQA 3ZJ0A 3ZZIA 2P6FA 3EXNA 2B3UA 3OWCA 4XPKA 2VI7A 3UY5A 1PU9A 2OH1A 4L8AA 3S6FA 5HMNA 2FIAA 2J8MA 1B6BA 1Z4EA 2JEVA 2PR1A 3T90A 3WR7A 4U9ZA 4F0YA 1YK3A 2VXKA 4PSXA 4XPDB 3T9YA 3CXQA 5J8FA 4JLYA 2B4DA 2BL1A 3R9EA 1KUVA 4NCZA 5IV0A 1J4JA 3QAHA 1SQHA 2B4BA 4HNYB 3BJ7A 5GCNA 2A4NA 4KOWA 4FD6A 3MGDA 5ISVA 2FCKA 4IF5A 2PC1A 4MI4A 3S6HA 2ZPAA 4J3GA 3TO9A 3SXNA 2KCWA 1M44A 1YREA 2ZXVA 1Y9KA 4XPDC 5F46A 3GY9A 3S6KA 2BEIA 2FXFA 2VBQA 4KORA 4R57A 5JPHA 3R1KA 1MJBA 4QBJA 3DNSA 4QUSA 3EY5A 3VWDA 2EVNA 1M4DA 2Y0MA 2B3VA 4KUAA 2Z11A 2ZW4A 4PK3A 2AJ6A 2VQYA 4CRZB 1FY7A 3FYNA 1XMTA 1RO5A 2B58A 2QIRA 4KZTA 5F47A 4QC6A 4F6AA 2OZGA 4DNCA 5KTDA 3FB3A 4ONUA 2ARHA 2RC4A 3D3SA 5IX3A 4HNWB 1WK4A 4IUSA 1VHSA 5HH1A 1S5KA 2JLMA 4QVTA 4GS4A 2J8RA 1S7LA 2OB0A 3R96A 3D2MA 4HNXB 2JDCA 2X7BA 2R1IA 4YRHA 2CNMA 3TCVA 1UFHA 1Z4RA 3K9UA 2J8NA 3TOAA 4UA3A 3G3SA 2Q7BA 4Y49B 1M4GA 1IIDA 2Q44A 5H84A 4NSQA 3H4QA 4PSWA 4R3LA 3BLNA 1YX0A 2ZW7A 5IB0A 4CAXA 3FXTA 3W6XA 1MK4A 1KUYA 4PV6A 4NXYA 4HKFA 4EVYA 2HUZA 3BJ8A 3TT2A 3FBUA 4MY0A 1YGHA 2WPXA 2FIWA 1S7NA 2B4DB 2P0WA 3RYOA 1S60A 4CS0B 3D2PA 4CRYB 4H6UA 1IYLA 4K30A 5J8CA 4AG7A 1QSMA 2P6GA 2Q4VA 2D4OA 1WWZA 3JUWA 1S3ZA 4KOTA 2O28A 2FT0A 4B5PB 1R57A 1Q2YA 4R87A 1M4IA 4R3KA 4XNHB 4KOVA 2P6EA 2PDOA 1K4JA 1OZPA 3TTHA 2BUEA 4M85A 3CXSA 2D4PA 1Z9UA 5EBVA 4ORFA 4E2AA 3SXOA 3V8IA 2QECA 3PGPA 4KOXA 5CNPA 4AVCA 4ZBGA 1YVOA 1KZFA 4CAWA 1V0CA 4R9MA 2PR8A 4OLLA 2OU2A 2CNTA 4XNHC
chains in the Genus database with same CATH superfamily
2EK9A 2CNSA 5F49A 2Q51A 3RO0A 4CGPA 2OZHA 4FUUA 4NF1A 3V7ZA 1QSOA 1YR0A 4MHYA 3F0AA 2PIYA 4PK2A 4UWJA 3FNCA 4PXBA 4UCPA 4IK2A 1CBXA 3E0KA 3MRUA 2BCOA 1LRZA 4CAVA 4F0XA 4YFJA 1QSRA 2JBJA 2PCUA 1LAMA 2Q43A 4U9YA 7CPAA 3CZXA 2AFWA 4P4IA 3FIXA 3TE4A 3QNVA 3W6SA 3H5ZA 3KI9A 4OMEA 4AVBA 1LAPA 5I4MA 3IGRA 1IYKA 4AB7A 1BPNA 3S9LA 3CPXA 1AYEA 4NEXA 1X10A 2Q0YA 2Z10A 4UWIA 2Z3MA 1BLLE 3KHZA 3NFZA 1Q2CA 2F7VA 4UEEA 3PBEA 4II9A 4UBRA 2OZUA 4UFWA 5KTCA 3A9LA 2CIJA 2REEA 5HVHA 2C27A 2Q04A 3VARA 2XEJA 4B5PA 5F09A 1TF9A 2PIZA 4KOYA 1R43A 1ELMP 3IWGA 1Y7RA 3KKWA 2ZEDA 4Q38A 4UIBA 3I1UA 4OC3A 4UFVA 3KR5A 1JWQA 4OP4A 3BI1A 1XEBA 1U6MA 2CY2A 1ZG7A 5A28A 2AE6A 1HDUA 1N71A 1PCAA 1Z8XA 2HQYA 4RS2A 4CGMA 3CT9A 1TKHA 2R98A 2I00A 2JDDA 3IU2A 3JTKA 4MXUA 3C26A 3I9SA 4A38A 2B5GB 1IGBA 4UF4A 4XPLA 4LX9A 4KVOE 5DS0A 5FVJA 2GIVA 2GREA 3D8PA 3NE8A 4KSFA 1RXTA 1ARLA 2PQ8A 3CXPA 1L0CA 2Z0ZA 1BO4A 3EC4A 4JYWA 3SJEA 3DR6A 3TOBA 2PSWA 1YLEA 3FEEA 2F5IA 2PRBA 3R95A 2ZW6A 3LD2A 2DF5A 4OADA 3K2KA 4KOUA 3DGVA 2YGWA 4UCMA 4TWEA 4UCNA 4Y49C 1B87A 4FD7A 2FSRA 4ONWA 3VWEA 5D29A 5KTAA 3LODA 3GYAA 1P4NA 2VEZA 2IL4A 3RBUA 1QSTA 5AGEA 3S9NA 4RI1A 1F57A 2Z3PA 3PEIA 5LRJA 2J9AA 4B11A 4M6GA 4IHMA 1DE4C 4CGOA 4MRIA 4Z65A 4MBUA 4A94A 1Q2DA 2FE7A 4KVME 4C2ZA 3EFAA 3SHPA 2ZEGA 1P0HA 5JGFA 4M3SA 5CBMA 2PJ7A 3ISXA 1IB1E 4FWUA 4AVAA 3GKRA 5I0CA 3I3GA 4MHDA 3TO7A 3D4UA 4DYOA 5AG5A 4P6YA 4MMOA 2R8VA 1Z5RA 2ZENA 1I21A 2ZELA 3PZJA 4NGTA 1NSLA 4JZ0A 4MFPA 5HXDA 3TO6A 4U5YA 2I79A 2QMLA 4I49A 2FL4A 4QB9A 4KSIA 1M1DA 2ZW5A 1NMTA 4BD9A 1AUGA 4PPZA 4YGOA 4NGNA 2B5GA 3F8KA 4FD5A 3H8GA 4L89A 4H89A 2ZEHA 1TKJA 2WZNA 4MHPA 2OR4A 4LUAA 2PJ1A 4OAEA 4P4BA 1ON0A 4H2KA 4JWPA 4CGNA 3GB0A 3P2FA 4JXRA 5C88A 3W91A 4E8OA 1IICA 4ZYQA 4BMHA 2EBJA 4KLVA 3QAYA 4OC1A 4HPSA 4MCRA 2Q4YA 3BHXA 1LOKA 4FD4A 4H6ZA 5G1ZA 2NMTA 2BO9A 1ZLIA 3FX6A 5HVFA 2ATRA 4CYNA 4B5OA 3P2HA 3LACA 4MFKA 5EC4A 2GFQA 2EUIA 3IWWA 2C6CA 1XIXA 3D68A 3FRMA 4YU9A 4PXCA 2DPSA 2G3AA 3B3WA 4KUBA 1CM0A 4NGPA 2AFSA 2VZYA 2CTBA 3FJUA 4JJXA 3SI2A 1S7KA 2QYVA 4KVXA 2K5TA 3CDXA 5EMIA 2JBKA 5G21A 1FNOA 1S7FA 2VL1A 4UEZA 3NH4A 5H86A 4AG9A 3N5FA 4OC2A 2HV2A 1CJWA 1I1DA 5ELYA 2BSWA 2G0BA 2PRQA 3VH9A 4EFDA 3B8GA 5C82A 1VGYA 4E0AA 2V8DA 5E96A 3B3SA 3S6GA 4JD6A 3QB8A 4KLWA 1YW4A 3WC6A 3G8WA 3TC8A 3SI1A 2PJ0A 1XE4A 2PJ4A 5DWNA 4LQ6A 3PP9A 4AXVA 1BOBA 4WJBA 3JVNA 5JQ4A 2VZZA 1F2OA 2H5MA 1QSNA 4A33A 4NGSA 3N7ZA 2V8GA 2R7HA 1MJ9A 3HLPA 3LMSA 4MY3A 2YNCA 3SI0A 3R9FA 2Q4ZA 3B3TA 3GUXA 1IU8A 2Z3LA 1GHEA 4MJ8A 3DDDA 3FH4A 2REFA 4X5KA 4RUHA 3PB7X 1I12A 1NE9A 2I3CA 1TIQA 2QJ8A 1PUAA 4P4FA 1XF8A 3DR8A 1QQ9A 4KOSA 1MJAA 5THWA 8CPAA 1Y9WA 5F48A 1VHOA 3F5BA 4OIDA 3DSBA 4ZY1A 5K8OA 4DUKA 2ZEOA 5G22A 3KQZA 1YQEA 4F8ZA 1Y0RA 1YVKA 2GE3A 2GANA 2WPWA 2AFMA 1VKCA 3IJ3A 3IEHA 2DPTA 3NE7A 2G3TA 4Q36A 2DXQA 5DWMA 4NGRA 3R9GA 1KUXA 3TX8A 3TFYA 2FS5A 3EO4A 4NGQA 4JXQA 4ZGYB 3ZJ0A 1LCPA 4OC0A 2O4HA 3ZZIA 2ABZA 1LANA 1AMPA 2GU2A 2NSMA 2O53A 2P6FA 3EXNA 3IFEA 3WT4A 2B3UA 1GYTA 5G20A 3OWCA 4BBHA 2PVWA 2VI7A 2ZEEA 3KGQA 4XPKA 3UY5A 1PU9A 2OH1A 4L8AA 3S6FA 3D66A 5AG4A 2FIAA 5HMNA 2J8MA 1DTDA 1B6BA 1EE3P 2EK8A 2PJAA 4R7MA 1Z4EA 2JEVA 3K9TA 2PR1A 2V8HA 5IB9A 5K8NA 1H8LA 3VATA 3NH8A 3T90A 3WR7A 4U9ZA 4F0YA 2ZEMA 1YK3A 3PFEA 2VXKA 4PSXA 4XPDB 4G1PA 2Z3OA 2AFUA 4C68A 3MN8A 3T9YA 3FMCA 1CPSA 1CP6A 3CXQA 5J8FA 4JLYA 2B4DA 2C6GA 2BL1A 5J1QA 3R9EA 1IY7A 4P45A 1KUVA 4NCZA 5IV0A 3B3CA 1J4JA 2ZEPA 4ZY0A 1UWYA 3QAHA 3IU1A 1SQHA 1ZO0A 4BINA 4P4JA 5JM6A 4YWYA 5LYDA 2B4BA 1X12A 4HNYB 5LYFA 3BJ7A 5GCNA 2A4NA 3PB9X 4R6TA 1XJOA 4KOWA 4P44A 4CYPA 3WC7A 4A32A 4C7IA 4FD6A 3MGDA 5ISVA 1VHEA 2ZOFA 4O23A 2FCKA 1CP7A 4GM5A 4IF5A 2C6PA 2XEFA 4UEFA 2PC1A 4MI4A 1R3NA 5K8MA 3S6HA 4A2ZA 2ZPAA 4J3GA 3KR4A 4MFQA 3TO9A 3FECA 4Q7AA 3SXNA 2KCWA 1M44A 1YREA 3KHXA 2ZXVA 4P4DA 1Y9KA 4XPDC 5F46A 4KSAA 3H8FA 2GLJA 2YNDA 4MCSA 3GY9A 3S6KA 4LQGA 2C1CA 2BEIA 2FXFA 2VBQA 4KORA 3BI0A 4C2YA 2YNEA 2NYQA 2WSAA 4R57A 2OOTA 2QVPA 4X3RA 5JPHA 1F2PA 2PJ5A 3D7DA 3V38A 6CPAA 3R1KA 1MJBA 4QBJA 2AFOA 3DNSA 4QUSA 1YSJA 1Z8WA 3EY5A 4MFZA 4CPAA 2PJ3A 3VWDA 2PJ8A 1HDQA 2EVNA 3JRUA 1M4DA 4OC5A 4K3NA 2Y0MA 5A27A 1VIXA 2B3VA 2CF4A 4PQAA 4B6ZA 1KWMA 4KUAA 2Z11A 2ZW4A 4PK3A 1BPMA 1XBUA 2BOAA 4A37A 4CGLA 1CPXA 1M4LA 2AJ6A 2VQYA 5D8NA 4CRZB 3WC5A 1FY7A 2F8HA 1ZG8A 2PJ2A 2Z3NA 3FYNA 3SJGA 1XMTA 1RO5A 2B58A 4MCQA 4ZX8A 4C2XA 2QIRA 4KZTA 5F47A 4QC6A 4UIAA 2PJCA 1ZLHA 3IWEA 4F6AA 2OZGA 2PJ9A 2V77A 4DNCA 5KTDA 3HUVA 3FB3A 4ONUA 2ARHA 2CTCA 2RC4A 1RTQA 1XFOA 3D3SA 4HNWB 4A31A 5IX3A 3PFOA 1WK4A 4IUSA 1VHSA 4B14A 2PVVA 3ISZA 4CAFA 2YNCC 5HH1A 2GLFA 1S5KA 2JLMA 3PRTA 5K8PA 4C7HA 1XOVA 2Q7SA 4QVTA 5CPAA 4GS4A 4W9YA 3FEDA 3PBBA 1NSAA 2J8RA 1Z8LA 4GXHA 4MHNA 1S7LA 2OB0A 3R96A 2JEWA 2V8VA 3B7IA 3FF3A 3D2MA 2X7BA 2JDCA 3IIBA 2R1IA 4HNXB 4YRHA 5BWAB 2CNMA 3TCVA 1UFHA 1Z4RA 3IO1A 2J8NA 3K9UA 3PB4X 2DEAA 4OC4A 3S9MA 5LYLA 2PJBA 3TOAA 2IQ6A 4F9UA 4UA3A 3G3SA 2Q7BA 1ARMA 1Z2LA 3FVLA 2EO8A 4Y49B 1M4GA 1YW6A 1ELLP 1TKFA 3B35A 1Y0YA 3KQXA 3D67A 4X2TA 4EWTA 1IIDA 4KS9A 2Q44A 3L2NA 5H84A 4PXEA 3B3VA 4NSQA 4FBEA 3H4QA 4PSWA 3KZWA 2PE3A 2ZOGA 4MCPA 4EMEA 4R3LA 3BLNA 1YX0A 2ZW7A 5IB0A 1CG2A 2AFZA 4R76A 4CAXA 3FXTA 4P10A 1FT7A 2EWBA 3W6XA 5LRKA 1MK4A 2ODFA 1Q7LA 3DLJA 4ZI6A 1KUYA 1Z8TA 4PV6A 4PXDA 4NXYA 4HKFA 4B10A 4EVYA 1XRYA 2HUZA 3RAMA 3BJ8A 5AG7A 4A39A 4A95A 1YMEA 3GIUA 3TT2A 3FBUA 3GLJA 1ZG9A 4MY0A 1YGHA 4A30A 3D7FA 4M6HA 2G9DA 1CX8A 1PYTB 1S7NA 2B4DB 2FIWA 2P0WA 2WPXA 4R8FA 4XNHC 3RYOA 4CYOA 4NJRA 1OBRA 2IMOA 3SJXA 1S60A 1IOFA 4NGMA 3WABA 4CS0B 3BXMA 2RFHA 2HB6A 3T8WA 3D2PA 3KL9A 4CRYB 4H6UA 1IYLA 4K30A 4M6IA 4P4EA 5J8CA 4AG7A 4B13A 1TF8A 1QSMA 1XMBA 4OKOA 5LRGA 2P6GA 3PB6X 2Q4VA 2D4OA 1WWZA 2IJZA 2WUUA 3H8EA 3JUWA 4CYQA 1S3ZA 3NA6A 4NJQA 4KOTA 1YLOA 1LFWA 2ANPA 4RN7A 3RZAA 2O28A 2FT0A 2XEIA 4B5PB 1R57A 4DJLA 1Q2YA 4R87A 4X8IA 4MFJA 1M4IA 4R3KA 4XNHB 4IAVA 4MHZA 2PJ6A 4OIWA 3CPAA 4NFRA 1IOIA 4KOVA 3SJFA 2P6EA 4CAEA 2PDOA 2POKA 1K4JA 3B2YA 3LWUA 2CXAA 4MFLA 1OZPA 3TTHA 1HEEA 4ZX9A 1A2ZA 2AFXA 2BUEA 4M85A 3CXSA 2D4PA 1Z9UA 2ZEFA 5EBVA 2RB7A 3NH5A 4ORFA 4TNUA 3D7GA 4E2AA 2FVGA 3SXOA 2HC9A 4WWVA 3IC1A 4B12A 5AG6A 3V8IA 2QECA 3PGPA 1BAVA 4KOXA 1JQGA 5JH9A 5CNPA 4UFXA 4AVCA 3D7HA 1TXRA 4ZBGA 3RNZA 4ZY2A 1Y7EA 1YVOA 5LYIA 1QMUA 1KZFA 4CAWA 2Z3KA 5HVGA 1V0CA 4FAIA 4F9VA 3PB8X 3KASA 2XEGA 4R9MA 2PR8A 4OLLA 2OU2A 2CNTA 2WYRA
chains in the Genus database with same CATH topology
4CGPA 2CNSA 5F49A 2OZHA 4NF1A 1QSOA 1YR0A 3F0AA 4PK2A 4UWJA 3FNCA 4UCPA 3E0KA 1LRZA 4CAVA 4F0XA 4YFJA 1QSRA 4U9YA 3TE4A 3FIXA 3W6SA 3H5ZA 4AVBA 3IGRA 1IYKA 4AB7A 4NEXA 2Q0YA 2Z10A 4UWIA 2Z3MA 1Q2CA 4II9A 4UBRA 2OZUA 4UFWA 5KTCA 3A9LA 2REEA 2C27A 2Q04A 4B5PA 4KOYA 3IWGA 1Y7RA 3KKWA 4Q38A 4UFVA 1XEBA 1U6MA 2CY2A 5A28A 2AE6A 1N71A 4RS2A 2HQYA 4CGMA 2R98A 2I00A 2JDDA 3IU2A 3JTKA 3C26A 3I9SA 2B5GB 4XPLA 4LX9A 4KVOE 5FVJA 2GIVA 3D8PA 4KSFA 1RXTA 2PQ8A 3CXPA 1L0CA 2Z0ZA 1BO4A 3EC4A 3TOBA 3DR6A 2PSWA 1YLEA 2F5IA 2PRBA 3R95A 2ZW6A 3LD2A 4OADA 4KOUA 2YGWA 4UCMA 4UCNA 4Y49C 1B87A 4FD7A 2FSRA 3VWEA 5KTAA 3LODA 3GYAA 1P4NA 2VEZA 2IL4A 1QSTA 5AGEA 4RI1A 2Z3PA 4B11A 4CGOA 4MBUA 1Q2DA 2FE7A 4KVME 4C2ZA 3EFAA 3SHPA 1P0HA 4M3SA 1IB1E 4AVAA 3GKRA 5I0CA 3I3GA 4MHDA 3TO7A 5AG5A 2R8VA 1I21A 3PZJA 1NSLA 4MFPA 3TO6A 4U5YA 2I79A 2QMLA 4I49A 2FL4A 4QB9A 1M1DA 2ZW5A 1NMTA 4YGOA 3F8KA 2B5GA 4L89A 4FD5A 4H89A 4OAEA 4LUAA 1ON0A 4JWPA 4CGNA 5C88A 3P2FA 4JXRA 3W91A 4E8OA 1IICA 4BMHA 4KLVA 2Q4YA 4H6ZA 4FD4A 5G1ZA 2NMTA 2ATRA 4CYNA 4B5OA 3P2HA 4MFKA 5EC4A 2EUIA 1XIXA 3FRMA 2DPSA 2G3AA 4KUBA 1CM0A 2VZYA 4JJXA 1S7KA 4KVXA 2K5TA 5G21A 1S7FA 5H86A 4AG9A 2HV2A 1CJWA 1I1DA 2BSWA 2G0BA 3B8GA 5C82A 4E0AA 5E96A 3S6GA 4JD6A 3QB8A 4KLWA 3G8WA 1XE4A 5DWNA 3PP9A 1BOBA 3JVNA 5JQ4A 2VZZA 2H5MA 1QSNA 4A33A 3N7ZA 2R7HA 1MJ9A 4MY3A 2YNCA 3R9FA 2Z3LA 1GHEA 4MJ8A 3DDDA 2REFA 4X5KA 1I12A 1NE9A 1TIQA 1PUAA 1XF8A 3DR8A 4KOSA 1MJAA 1Y9WA 5F48A 3F5BA 3DSBA 5G22A 1YVKA 2GE3A 2GANA 2WPWA 1VKCA 2DPTA 3NE7A 2G3TA 4Q36A 2DXQA 5DWMA 3R9GA 1KUXA 3TFYA 2FS5A 3EO4A 4JXQA 4ZGYB 3ZJ0A 3ZZIA 2P6FA 5AG4A 3EXNA 2B3UA 5G20A 3OWCA 4BBHA 4XPKA 2VI7A 3UY5A 1PU9A 2OH1A 4L8AA 3S6FA 5HMNA 2FIAA 2J8MA 1B6BA 1Z4EA 2JEVA 2PR1A 3T90A 3WR7A 4U9ZA 4F0YA 1YK3A 2VXKA 4PSXA 4XPDB 2Z3OA 4C68A 3T9YA 3CXQA 5J8FA 4JLYA 2B4DA 2BL1A 3R9EA 1KUVA 4NCZA 5IV0A 1J4JA 3QAHA 3IU1A 1SQHA 1ZO0A 2B4BA 4HNYB 3BJ7A 5GCNA 2A4NA 4KOWA 4CYPA 4A32A 4C7IA 4FD6A 3MGDA 5ISVA 2FCKA 4IF5A 2PC1A 4MI4A 3S6HA 4A2ZA 2ZPAA 4J3GA 4MFQA 3TO9A 3SXNA 2KCWA 1M44A 1YREA 2ZXVA 1Y9KA 4XPDC 5F46A 4KSAA 2YNDA 3GY9A 3S6KA 2BEIA 2FXFA 2VBQA 4KORA 4C2YA 2YNEA 2WSAA 4R57A 5JPHA 3R1KA 1MJBA 4QBJA 3DNSA 4QUSA 3EY5A 4MFZA 3VWDA 2EVNA 1M4DA 2Y0MA 5A27A 2B3VA 4KUAA 2Z11A 2ZW4A 4PK3A 4CGLA 2AJ6A 2VQYA 4CRZB 1FY7A 2Z3NA 3FYNA 1XMTA 1RO5A 2B58A 4C2XA 2QIRA 4KZTA 5F47A 4QC6A 3IWEA 4F6AA 2OZGA 4DNCA 5KTDA 3FB3A 4ONUA 2ARHA 2RC4A 3D3SA 5IX3A 4HNWB 4A31A 1WK4A 4IUSA 1VHSA 4B14A 4CAFA 2YNCC 5HH1A 1S5KA 2JLMA 4C7HA 4QVTA 4GS4A 2J8RA 1S7LA 2OB0A 3R96A 5BWAB 3D2MA 4HNXB 2JDCA 2X7BA 2R1IA 4YRHA 2CNMA 3TCVA 1UFHA 1Z4RA 3K9UA 2J8NA 3TOAA 4UA3A 3G3SA 2Q7BA 4Y49B 1M4GA 1IIDA 4KS9A 2Q44A 5H84A 4NSQA 3H4QA 4PSWA 4R3LA 3BLNA 1YX0A 2ZW7A 5IB0A 4CAXA 3FXTA 3W6XA 1MK4A 1KUYA 4PV6A 4NXYA 4HKFA 4B10A 4EVYA 4A95A 2HUZA 3BJ8A 5AG7A 3TT2A 3FBUA 4MY0A 1YGHA 4A30A 2WPXA 2FIWA 1S7NA 2B4DB 2P0WA 3RYOA 4CYOA 1S60A 4CS0B 3D2PA 4CRYB 4H6UA 1IYLA 4K30A 5J8CA 4AG7A 4B13A 1QSMA 2P6GA 2Q4VA 2D4OA 1WWZA 2WUUA 3JUWA 4CYQA 1S3ZA 4KOTA 2O28A 2FT0A 4B5PB 1R57A 1Q2YA 4R87A 4MFJA 1M4IA 4R3KA 4XNHB 4KOVA 2P6EA 4CAEA 2PDOA 1K4JA 2CXAA 4MFLA 1OZPA 3TTHA 2BUEA 4M85A 3CXSA 2D4PA 1Z9UA 5EBVA 4ORFA 4E2AA 3SXOA 4B12A 5AG6A 3V8IA 2QECA 3PGPA 4KOXA 5CNPA 4UFXA 4AVCA 4ZBGA 1YVOA 1KZFA 4CAWA 2Z3KA 1V0CA 4R9MA 2PR8A 4OLLA 2OU2A 2CNTA 4XNHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNS A;  5F49 A;  2OZH A;  4NF1 A;  1QSO A;  1YR0 A;  3F0A A;  4PK2 A;  4UWJ A;  3FNC A;  3E0K A;  1LRZ A;  4CAV A;  4YFJ A;  1QSR A;  4U9Y A;  3TE4 A;  3FIX A;  3W6S A;  4AVB A;  3IGR A;  1IYK A;  4AB7 A;  4NEX A;  2Q0Y A;  2Z10 A;  4UWI A;  1Q2C A;  4II9 A;  4UBR A;  2OZU A;  5KTC A;  2REE A;  2C27 A;  2Q04 A;  4B5P A;  4KOY A;  3IWG A;  1Y7R A;  3KKW A;  1XEB A;  1U6M A;  2CY2 A;  2AE6 A;  1N71 A;  4RS2 A;  2HQY A;  2R98 A;  2I00 A;  2JDD A;  3C26 A;  3I9S A;  2B5G B;  4XPL A;  4LX9 A;  4KVO E;  5FVJ A;  2GIV A;  3D8P A;  1RXT A;  2PQ8 A;  3CXP A;  1L0C A;  2Z0Z A;  1BO4 A;  3EC4 A;  3TOB A;  3DR6 A;  2PSW A;  1YLE A;  2F5I A;  2PRB A;  3R95 A;  2ZW6 A;  3LD2 A;  4OAD A;  4KOU A;  4Y49 C;  5KTA A;  1B87 A;  4FD7 A;  2FSR A;  3VWE A;  3LOD A;  3GYA A;  1P4N A;  2VEZ A;  2IL4 A;  1QST A;  4RI1 A;  4MBU A;  1Q2D A;  2FE7 A;  4KVM E;  3EFA A;  3SHP A;  1P0H A;  4M3S A;  1IB1 E;  4AVA A;  3GKR A;  5I0C A;  3I3G A;  4MHD A;  3TO7 A;  2R8V A;  1I21 A;  3PZJ A;  1NSL A;  3TO6 A;  4U5Y A;  2I79 A;  2QML A;  4I49 A;  2FL4 A;  4QB9 A;  1M1D A;  2ZW5 A;  1NMT A;  4YGO A;  3F8K A;  2B5G A;  4L89 A;  4FD5 A;  4H89 A;  4OAE A;  4LUA A;  1ON0 A;  4JWP A;  5C88 A;  3P2F A;  4JXR A;  3W91 A;  4E8O A;  1IIC A;  4BMH A;  4KLV A;  2Q4Y A;  4H6Z A;  4FD4 A;  2NMT A;  2ATR A;  4B5O A;  3P2H A;  5EC4 A;  2EUI A;  1XIX A;  3FRM A;  2G3A A;  4KUB A;  1CM0 A;  2VZY A;  4JJX A;  1S7K A;  4KVX A;  2K5T A;  1S7F A;  5H86 A;  4AG9 A;  2HV2 A;  1CJW A;  1I1D A;  2BSW A;  2G0B A;  3B8G A;  5C82 A;  4E0A A;  5E96 A;  3S6G A;  4JD6 A;  3QB8 A;  4KLW A;  3G8W A;  1XE4 A;  5DWN A;  3PP9 A;  1BOB A;  3JVN A;  5JQ4 A;  2VZZ A;  2H5M A;  1QSN A;  3N7Z A;  2R7H A;  1MJ9 A;  4MY3 A;  3R9F A;  1GHE A;  4MJ8 A;  3DDD A;  2REF A;  4X5K A;  1I12 A;  1NE9 A;  1TIQ A;  1PUA A;  1XF8 A;  3DR8 A;  4KOS A;  1MJA A;  1Y9W A;  5F48 A;  3F5B A;  3DSB A;  1YVK A;  2GE3 A;  2GAN A;  2WPW A;  1VKC A;  3NE7 A;  2G3T A;  2DXQ A;  5DWM A;  3R9G A;  1KUX A;  3TFY A;  2FS5 A;  3EO4 A;  4JXQ A;  3ZJ0 A;  3ZZI A;  2P6F A;  3EXN A;  2B3U A;  3OWC A;  4XPK A;  2VI7 A;  3UY5 A;  1PU9 A;  2OH1 A;  4L8A A;  3S6F A;  5HMN A;  2FIA A;  2J8M A;  1B6B A;  1Z4E A;  2JEV A;  2PR1 A;  3T90 A;  3WR7 A;  4U9Z A;  4F0Y A;  1YK3 A;  2VXK A;  4PSX A;  4XPD B;  3T9Y A;  3CXQ A;  5J8F A;  4JLY A;  2B4D A;  2BL1 A;  3R9E A;  1KUV A;  4NCZ A;  5IV0 A;  1J4J A;  3QAH A;  1SQH A;  2B4B A;  4HNY B;  3BJ7 A;  5GCN A;  2A4N A;  4KOW A;  4FD6 A;  3MGD A;  5ISV A;  2FCK A;  4IF5 A;  2PC1 A;  4MI4 A;  3S6H A;  2ZPA A;  4J3G A;  3TO9 A;  3SXN A;  2KCW A;  1M44 A;  1YRE A;  2ZXV A;  1Y9K A;  4XPD C;  5F46 A;  3GY9 A;  3S6K A;  2BEI A;  2FXF A;  2VBQ A;  4KOR A;  4R57 A;  5JPH A;  3R1K A;  1MJB A;  4QBJ A;  3DNS A;  4QUS A;  3EY5 A;  3VWD A;  2EVN A;  1M4D A;  2Y0M A;  2B3V A;  4KUA A;  2Z11 A;  2ZW4 A;  4PK3 A;  2AJ6 A;  2VQY A;  4CRZ B;  1FY7 A;  3FYN A;  1XMT A;  1RO5 A;  2B58 A;  2QIR A;  4KZT A;  5F47 A;  4QC6 A;  4F6A A;  2OZG A;  4DNC A;  5KTD A;  3FB3 A;  4ONU A;  2ARH A;  2RC4 A;  3D3S A;  5IX3 A;  4HNW B;  1WK4 A;  4IUS A;  1VHS A;  5HH1 A;  1S5K A;  2JLM A;  4QVT A;  4GS4 A;  2J8R A;  1S7L A;  2OB0 A;  3R96 A;  3D2M A;  4HNX B;  2JDC A;  2X7B A;  2R1I A;  4YRH A;  2CNM A;  3TCV A;  1UFH A;  1Z4R A;  3K9U A;  2J8N A;  3TOA A;  4UA3 A;  3G3S A;  2Q7B A;  4Y49 B;  1M4G A;  1IID A;  2Q44 A;  5H84 A;  4NSQ A;  3H4Q A;  4PSW A;  4R3L A;  3BLN A;  1YX0 A;  2ZW7 A;  5IB0 A;  4CAX A;  3FXT A;  3W6X A;  1MK4 A;  1KUY A;  4PV6 A;  4NXY A;  4HKF A;  4EVY A;  2HUZ A;  3BJ8 A;  3TT2 A;  3FBU A;  4MY0 A;  1YGH A;  2WPX A;  2FIW A;  1S7N A;  2B4D B;  2P0W A;  3RYO A;  1S60 A;  4CS0 B;  3D2P A;  4CRY B;  4H6U A;  1IYL A;  4K30 A;  5J8C A;  4AG7 A;  1QSM A;  2P6G A;  2Q4V A;  2D4O A;  1WWZ A;  3JUW A;  1S3Z A;  4KOT A;  2O28 A;  2FT0 A;  4B5P B;  1R57 A;  1Q2Y A;  4R87 A;  1M4I A;  4R3K A;  4XNH B;  4KOV A;  2P6E A;  2PDO A;  1K4J A;  1OZP A;  3TTH A;  2BUE A;  4M85 A;  3CXS A;  2D4P A;  1Z9U A;  5EBV A;  4ORF A;  4E2A A;  3SXO A;  3V8I A;  2QEC A;  3PGP A;  4KOX A;  5CNP A;  4AVC A;  4ZBG A;  1YVO A;  1KZF A;  4CAW A;  1V0C A;  4R9M A;  2PR8 A;  4OLL A;  2OU2 A;  2CNT A;  4XNH C; 
#chains in the Genus database with same CATH topology
 2EK9 A;  2CNS A;  5F49 A;  2Q51 A;  3RO0 A;  4CGP A;  2OZH A;  4FUU A;  4NF1 A;  3V7Z A;  1QSO A;  1YR0 A;  4MHY A;  3F0A A;  2PIY A;  4PK2 A;  4UWJ A;  3FNC A;  4PXB A;  4UCP A;  4IK2 A;  1CBX A;  3E0K A;  3MRU A;  2BCO A;  1LRZ A;  4CAV A;  4F0X A;  4YFJ A;  1QSR A;  2JBJ A;  2PCU A;  1LAM A;  2Q43 A;  4U9Y A;  7CPA A;  3CZX A;  2AFW A;  4P4I A;  3FIX A;  3TE4 A;  3QNV A;  3W6S A;  3H5Z A;  3KI9 A;  4OME A;  4AVB A;  1LAP A;  5I4M A;  3IGR A;  1IYK A;  4AB7 A;  1BPN A;  3S9L A;  3CPX A;  1AYE A;  4NEX A;  1X10 A;  2Q0Y A;  2Z10 A;  4UWI A;  2Z3M A;  1BLL E;  3KHZ A;  3NFZ A;  1Q2C A;  2F7V A;  4UEE A;  3PBE A;  4II9 A;  4UBR A;  2OZU A;  4UFW A;  5KTC A;  3A9L A;  2CIJ A;  2REE A;  5HVH A;  2C27 A;  2Q04 A;  3VAR A;  2XEJ A;  4B5P A;  5F09 A;  1TF9 A;  2PIZ A;  4KOY A;  1R43 A;  1ELM P;  3IWG A;  1Y7R A;  3KKW A;  2ZED A;  4Q38 A;  4UIB A;  3I1U A;  4OC3 A;  4UFV A;  3KR5 A;  1JWQ A;  4OP4 A;  3BI1 A;  1XEB A;  1U6M A;  2CY2 A;  1ZG7 A;  5A28 A;  2AE6 A;  1HDU A;  1N71 A;  1PCA A;  1Z8X A;  2HQY A;  4RS2 A;  4CGM A;  3CT9 A;  1TKH A;  2R98 A;  2I00 A;  2JDD A;  3IU2 A;  3JTK A;  4MXU A;  3C26 A;  3I9S A;  4A38 A;  2B5G B;  1IGB A;  4UF4 A;  4XPL A;  4LX9 A;  4KVO E;  5DS0 A;  5FVJ A;  2GIV A;  2GRE A;  3D8P A;  3NE8 A;  4KSF A;  1RXT A;  1ARL A;  2PQ8 A;  3CXP A;  1L0C A;  2Z0Z A;  1BO4 A;  3EC4 A;  4JYW A;  3SJE A;  3DR6 A;  3TOB A;  2PSW A;  1YLE A;  3FEE A;  2F5I A;  2PRB A;  3R95 A;  2ZW6 A;  3LD2 A;  2DF5 A;  4OAD A;  3K2K A;  4KOU A;  3DGV A;  2YGW A;  4UCM A;  4TWE A;  4UCN A;  4Y49 C;  1B87 A;  4FD7 A;  2FSR A;  4ONW A;  3VWE A;  5D29 A;  5KTA A;  3LOD A;  3GYA A;  1P4N A;  2VEZ A;  2IL4 A;  3RBU A;  1QST A;  5AGE A;  3S9N A;  4RI1 A;  1F57 A;  2Z3P A;  3PEI A;  5LRJ A;  2J9A A;  4B11 A;  4M6G A;  4IHM A;  1DE4 C;  4CGO A;  4MRI A;  4Z65 A;  4MBU A;  4A94 A;  1Q2D A;  2FE7 A;  4KVM E;  4C2Z A;  3EFA A;  3SHP A;  2ZEG A;  1P0H A;  5JGF A;  4M3S A;  5CBM A;  2PJ7 A;  3ISX A;  1IB1 E;  4FWU A;  4AVA A;  3GKR A;  5I0C A;  3I3G A;  4MHD A;  3TO7 A;  3D4U A;  4DYO A;  5AG5 A;  4P6Y A;  4MMO A;  2R8V A;  1Z5R A;  2ZEN A;  1I21 A;  2ZEL A;  3PZJ A;  4NGT A;  1NSL A;  4JZ0 A;  4MFP A;  5HXD A;  3TO6 A;  4U5Y A;  2I79 A;  2QML A;  4I49 A;  2FL4 A;  4QB9 A;  4KSI A;  1M1D A;  2ZW5 A;  1NMT A;  4BD9 A;  1AUG A;  4PPZ A;  4YGO A;  4NGN A;  2B5G A;  3F8K A;  4FD5 A;  3H8G A;  4L89 A;  4H89 A;  2ZEH A;  1TKJ A;  2WZN A;  4MHP A;  2OR4 A;  4LUA A;  2PJ1 A;  4OAE A;  4P4B A;  1ON0 A;  4H2K A;  4JWP A;  4CGN A;  3GB0 A;  3P2F A;  4JXR A;  5C88 A;  3W91 A;  4E8O A;  1IIC A;  4ZYQ A;  4BMH A;  2EBJ A;  4KLV A;  3QAY A;  4OC1 A;  4HPS A;  4MCR A;  2Q4Y A;  3BHX A;  1LOK A;  4FD4 A;  4H6Z A;  5G1Z A;  2NMT A;  2BO9 A;  1ZLI A;  3FX6 A;  5HVF A;  2ATR A;  4CYN A;  4B5O A;  3P2H A;  3LAC A;  4MFK A;  5EC4 A;  2GFQ A;  2EUI A;  3IWW A;  2C6C A;  1XIX A;  3D68 A;  3FRM A;  4YU9 A;  4PXC A;  2DPS A;  2G3A A;  3B3W A;  4KUB A;  1CM0 A;  4NGP A;  2AFS A;  2VZY A;  2CTB A;  3FJU A;  4JJX A;  3SI2 A;  1S7K A;  2QYV A;  4KVX A;  2K5T A;  3CDX A;  5EMI A;  2JBK A;  5G21 A;  1FNO A;  1S7F A;  2VL1 A;  4UEZ A;  3NH4 A;  5H86 A;  4AG9 A;  3N5F A;  4OC2 A;  2HV2 A;  1CJW A;  1I1D A;  5ELY A;  2BSW A;  2G0B A;  2PRQ A;  3VH9 A;  4EFD A;  3B8G A;  5C82 A;  1VGY A;  4E0A A;  2V8D A;  5E96 A;  3B3S A;  3S6G A;  4JD6 A;  3QB8 A;  4KLW A;  1YW4 A;  3WC6 A;  3G8W A;  3TC8 A;  3SI1 A;  2PJ0 A;  1XE4 A;  2PJ4 A;  5DWN A;  4LQ6 A;  3PP9 A;  4AXV A;  1BOB A;  4WJB A;  3JVN A;  5JQ4 A;  2VZZ A;  1F2O A;  2H5M A;  1QSN A;  4A33 A;  4NGS A;  3N7Z A;  2V8G A;  2R7H A;  1MJ9 A;  3HLP A;  3LMS A;  4MY3 A;  2YNC A;  3SI0 A;  3R9F A;  2Q4Z A;  3B3T A;  3GUX A;  1IU8 A;  2Z3L A;  1GHE A;  4MJ8 A;  3DDD A;  3FH4 A;  2REF A;  4X5K A;  4RUH A;  3PB7 X;  1I12 A;  1NE9 A;  2I3C A;  1TIQ A;  2QJ8 A;  1PUA A;  4P4F A;  1XF8 A;  3DR8 A;  1QQ9 A;  4KOS A;  1MJA A;  5THW A;  8CPA A;  1Y9W A;  5F48 A;  1VHO A;  3F5B A;  4OID A;  3DSB A;  4ZY1 A;  5K8O A;  4DUK A;  2ZEO A;  5G22 A;  3KQZ A;  1YQE A;  4F8Z A;  1Y0R A;  1YVK A;  2GE3 A;  2GAN A;  2WPW A;  2AFM A;  1VKC A;  3IJ3 A;  3IEH A;  2DPT A;  3NE7 A;  2G3T A;  4Q36 A;  2DXQ A;  5DWM A;  4NGR A;  3R9G A;  1KUX A;  3TX8 A;  3TFY A;  2FS5 A;  3EO4 A;  4NGQ A;  4JXQ A;  4ZGY B;  3ZJ0 A;  1LCP A;  4OC0 A;  2O4H A;  3ZZI A;  2ABZ A;  1LAN A;  1AMP A;  2GU2 A;  2NSM A;  2O53 A;  2P6F A;  3EXN A;  3IFE A;  3WT4 A;  2B3U A;  1GYT A;  5G20 A;  3OWC A;  4BBH A;  2PVW A;  2VI7 A;  2ZEE A;  3KGQ A;  4XPK A;  3UY5 A;  1PU9 A;  2OH1 A;  4L8A A;  3S6F A;  3D66 A;  5AG4 A;  2FIA A;  5HMN A;  2J8M A;  1DTD A;  1B6B A;  1EE3 P;  2EK8 A;  2PJA A;  4R7M A;  1Z4E A;  2JEV A;  3K9T A;  2PR1 A;  2V8H A;  5IB9 A;  5K8N A;  1H8L A;  3VAT A;  3NH8 A;  3T90 A;  3WR7 A;  4U9Z A;  4F0Y A;  2ZEM A;  1YK3 A;  3PFE A;  2VXK A;  4PSX A;  4XPD B;  4G1P A;  2Z3O A;  2AFU A;  4C68 A;  3MN8 A;  3T9Y A;  3FMC A;  1CPS A;  1CP6 A;  3CXQ A;  5J8F A;  4JLY A;  2B4D A;  2C6G A;  2BL1 A;  5J1Q A;  3R9E A;  1IY7 A;  4P45 A;  1KUV A;  4NCZ A;  5IV0 A;  3B3C A;  1J4J A;  2ZEP A;  4ZY0 A;  1UWY A;  3QAH A;  3IU1 A;  1SQH A;  1ZO0 A;  4BIN A;  4P4J A;  5JM6 A;  4YWY A;  5LYD A;  2B4B A;  1X12 A;  4HNY B;  5LYF A;  3BJ7 A;  5GCN A;  2A4N A;  3PB9 X;  4R6T A;  1XJO A;  4KOW A;  4P44 A;  4CYP A;  3WC7 A;  4A32 A;  4C7I A;  4FD6 A;  3MGD A;  5ISV A;  1VHE A;  2ZOF A;  4O23 A;  2FCK A;  1CP7 A;  4GM5 A;  4IF5 A;  2C6P A;  2XEF A;  4UEF A;  2PC1 A;  4MI4 A;  1R3N A;  5K8M A;  3S6H A;  4A2Z A;  2ZPA A;  4J3G A;  3KR4 A;  4MFQ A;  3TO9 A;  3FEC A;  4Q7A A;  3SXN A;  2KCW A;  1M44 A;  1YRE A;  3KHX A;  2ZXV A;  4P4D A;  1Y9K A;  4XPD C;  5F46 A;  4KSA A;  3H8F A;  2GLJ A;  2YND A;  4MCS A;  3GY9 A;  3S6K A;  4LQG A;  2C1C A;  2BEI A;  2FXF A;  2VBQ A;  4KOR A;  3BI0 A;  4C2Y A;  2YNE A;  2NYQ A;  2WSA A;  4R57 A;  2OOT A;  2QVP A;  4X3R A;  5JPH A;  1F2P A;  2PJ5 A;  3D7D A;  3V38 A;  6CPA A;  3R1K A;  1MJB A;  4QBJ A;  2AFO A;  3DNS A;  4QUS A;  1YSJ A;  1Z8W A;  3EY5 A;  4MFZ A;  4CPA A;  2PJ3 A;  3VWD A;  2PJ8 A;  1HDQ A;  2EVN A;  3JRU A;  1M4D A;  4OC5 A;  4K3N A;  2Y0M A;  5A27 A;  1VIX A;  2B3V A;  2CF4 A;  4PQA A;  4B6Z A;  1KWM A;  4KUA A;  2Z11 A;  2ZW4 A;  4PK3 A;  1BPM A;  1XBU A;  2BOA A;  4A37 A;  4CGL A;  1CPX A;  1M4L A;  2AJ6 A;  2VQY A;  5D8N A;  4CRZ B;  3WC5 A;  1FY7 A;  2F8H A;  1ZG8 A;  2PJ2 A;  2Z3N A;  3FYN A;  3SJG A;  1XMT A;  1RO5 A;  2B58 A;  4MCQ A;  4ZX8 A;  4C2X A;  2QIR A;  4KZT A;  5F47 A;  4QC6 A;  4UIA A;  2PJC A;  1ZLH A;  3IWE A;  4F6A A;  2OZG A;  2PJ9 A;  2V77 A;  4DNC A;  5KTD A;  3HUV A;  3FB3 A;  4ONU A;  2ARH A;  2CTC A;  2RC4 A;  1RTQ A;  1XFO A;  3D3S A;  4HNW B;  4A31 A;  5IX3 A;  3PFO A;  1WK4 A;  4IUS A;  1VHS A;  4B14 A;  2PVV A;  3ISZ A;  4CAF A;  2YNC C;  5HH1 A;  2GLF A;  1S5K A;  2JLM A;  3PRT A;  5K8P A;  4C7H A;  1XOV A;  2Q7S A;  4QVT A;  5CPA A;  4GS4 A;  4W9Y A;  3FED A;  3PBB A;  1NSA A;  2J8R A;  1Z8L A;  4GXH A;  4MHN A;  1S7L A;  2OB0 A;  3R96 A;  2JEW A;  2V8V A;  3B7I A;  3FF3 A;  3D2M A;  2X7B A;  2JDC A;  3IIB A;  2R1I A;  4HNX B;  4YRH A;  5BWA B;  2CNM A;  3TCV A;  1UFH A;  1Z4R A;  3IO1 A;  2J8N A;  3K9U A;  3PB4 X;  2DEA A;  4OC4 A;  3S9M A;  5LYL A;  2PJB A;  3TOA A;  2IQ6 A;  4F9U A;  4UA3 A;  3G3S A;  2Q7B A;  1ARM A;  1Z2L A;  3FVL A;  2EO8 A;  4Y49 B;  1M4G A;  1YW6 A;  1ELL P;  1TKF A;  3B35 A;  1Y0Y A;  3KQX A;  3D67 A;  4X2T A;  4EWT A;  1IID A;  4KS9 A;  2Q44 A;  3L2N A;  5H84 A;  4PXE A;  3B3V A;  4NSQ A;  4FBE A;  3H4Q A;  4PSW A;  3KZW A;  2PE3 A;  2ZOG A;  4MCP A;  4EME A;  4R3L A;  3BLN A;  1YX0 A;  2ZW7 A;  5IB0 A;  1CG2 A;  2AFZ A;  4R76 A;  4CAX A;  3FXT A;  4P10 A;  1FT7 A;  2EWB A;  3W6X A;  5LRK A;  1MK4 A;  2ODF A;  1Q7L A;  3DLJ A;  4ZI6 A;  1KUY A;  1Z8T A;  4PV6 A;  4PXD A;  4NXY A;  4HKF A;  4B10 A;  4EVY A;  1XRY A;  2HUZ A;  3RAM A;  3BJ8 A;  5AG7 A;  4A39 A;  4A95 A;  1YME A;  3GIU A;  3TT2 A;  3FBU A;  3GLJ A;  1ZG9 A;  4MY0 A;  1YGH A;  4A30 A;  3D7F A;  4M6H A;  2G9D A;  1CX8 A;  1PYT B;  1S7N A;  2B4D B;  2FIW A;  2P0W A;  2WPX A;  4R8F A;  4XNH C;  3RYO A;  4CYO A;  4NJR A;  1OBR A;  2IMO A;  3SJX A;  1S60 A;  1IOF A;  4NGM A;  3WAB A;  4CS0 B;  3BXM A;  2RFH A;  2HB6 A;  3T8W A;  3D2P A;  3KL9 A;  4CRY B;  4H6U A;  1IYL A;  4K30 A;  4M6I A;  4P4E A;  5J8C A;  4AG7 A;  4B13 A;  1TF8 A;  1QSM A;  1XMB A;  4OKO A;  5LRG A;  2P6G A;  3PB6 X;  2Q4V A;  2D4O A;  1WWZ A;  2IJZ A;  2WUU A;  3H8E A;  3JUW A;  4CYQ A;  1S3Z A;  3NA6 A;  4NJQ A;  4KOT A;  1YLO A;  1LFW A;  2ANP A;  4RN7 A;  3RZA A;  2O28 A;  2FT0 A;  2XEI A;  4B5P B;  1R57 A;  4DJL A;  1Q2Y A;  4R87 A;  4X8I A;  4MFJ A;  1M4I A;  4R3K A;  4XNH B;  4IAV A;  4MHZ A;  2PJ6 A;  4OIW A;  3CPA A;  4NFR A;  1IOI A;  4KOV A;  3SJF A;  2P6E A;  4CAE A;  2PDO A;  2POK A;  1K4J A;  3B2Y A;  3LWU A;  2CXA A;  4MFL A;  1OZP A;  3TTH A;  1HEE A;  4ZX9 A;  1A2Z A;  2AFX A;  2BUE A;  4M85 A;  3CXS A;  2D4P A;  1Z9U A;  2ZEF A;  5EBV A;  2RB7 A;  3NH5 A;  4ORF A;  4TNU A;  3D7G A;  4E2A A;  2FVG A;  3SXO A;  2HC9 A;  4WWV A;  3IC1 A;  4B12 A;  5AG6 A;  3V8I A;  2QEC A;  3PGP A;  1BAV A;  4KOX A;  1JQG A;  5JH9 A;  5CNP A;  4UFX A;  4AVC A;  3D7H A;  1TXR A;  4ZBG A;  3RNZ A;  4ZY2 A;  1Y7E A;  1YVO A;  5LYI A;  1QMU A;  1KZF A;  4CAW A;  2Z3K A;  5HVG A;  1V0C A;  4FAI A;  4F9V A;  3PB8 X;  3KAS A;  2XEG A;  4R9M A;  2PR8 A;  4OLL A;  2OU2 A;  2CNT A;  2WYR A; 
#chains in the Genus database with same CATH homology
 4CGP A;  2CNS A;  5F49 A;  2OZH A;  4NF1 A;  1QSO A;  1YR0 A;  3F0A A;  4PK2 A;  4UWJ A;  3FNC A;  4UCP A;  3E0K A;  1LRZ A;  4CAV A;  4F0X A;  4YFJ A;  1QSR A;  4U9Y A;  3TE4 A;  3FIX A;  3W6S A;  3H5Z A;  4AVB A;  3IGR A;  1IYK A;  4AB7 A;  4NEX A;  2Q0Y A;  2Z10 A;  4UWI A;  2Z3M A;  1Q2C A;  4II9 A;  4UBR A;  2OZU A;  4UFW A;  5KTC A;  3A9L A;  2REE A;  2C27 A;  2Q04 A;  4B5P A;  4KOY A;  3IWG A;  1Y7R A;  3KKW A;  4Q38 A;  4UFV A;  1XEB A;  1U6M A;  2CY2 A;  5A28 A;  2AE6 A;  1N71 A;  4RS2 A;  2HQY A;  4CGM A;  2R98 A;  2I00 A;  2JDD A;  3IU2 A;  3JTK A;  3C26 A;  3I9S A;  2B5G B;  4XPL A;  4LX9 A;  4KVO E;  5FVJ A;  2GIV A;  3D8P A;  4KSF A;  1RXT A;  2PQ8 A;  3CXP A;  1L0C A;  2Z0Z A;  1BO4 A;  3EC4 A;  3TOB A;  3DR6 A;  2PSW A;  1YLE A;  2F5I A;  2PRB A;  3R95 A;  2ZW6 A;  3LD2 A;  4OAD A;  4KOU A;  2YGW A;  4UCM A;  4UCN A;  4Y49 C;  1B87 A;  4FD7 A;  2FSR A;  3VWE A;  5KTA A;  3LOD A;  3GYA A;  1P4N A;  2VEZ A;  2IL4 A;  1QST A;  5AGE A;  4RI1 A;  2Z3P A;  4B11 A;  4CGO A;  4MBU A;  1Q2D A;  2FE7 A;  4KVM E;  4C2Z A;  3EFA A;  3SHP A;  1P0H A;  4M3S A;  1IB1 E;  4AVA A;  3GKR A;  5I0C A;  3I3G A;  4MHD A;  3TO7 A;  5AG5 A;  2R8V A;  1I21 A;  3PZJ A;  1NSL A;  4MFP A;  3TO6 A;  4U5Y A;  2I79 A;  2QML A;  4I49 A;  2FL4 A;  4QB9 A;  1M1D A;  2ZW5 A;  1NMT A;  4YGO A;  3F8K A;  2B5G A;  4L89 A;  4FD5 A;  4H89 A;  4OAE A;  4LUA A;  1ON0 A;  4JWP A;  4CGN A;  5C88 A;  3P2F A;  4JXR A;  3W91 A;  4E8O A;  1IIC A;  4BMH A;  4KLV A;  2Q4Y A;  4H6Z A;  4FD4 A;  5G1Z A;  2NMT A;  2ATR A;  4CYN A;  4B5O A;  3P2H A;  4MFK A;  5EC4 A;  2EUI A;  1XIX A;  3FRM A;  2DPS A;  2G3A A;  4KUB A;  1CM0 A;  2VZY A;  4JJX A;  1S7K A;  4KVX A;  2K5T A;  5G21 A;  1S7F A;  5H86 A;  4AG9 A;  2HV2 A;  1CJW A;  1I1D A;  2BSW A;  2G0B A;  3B8G A;  5C82 A;  4E0A A;  5E96 A;  3S6G A;  4JD6 A;  3QB8 A;  4KLW A;  3G8W A;  1XE4 A;  5DWN A;  3PP9 A;  1BOB A;  3JVN A;  5JQ4 A;  2VZZ A;  2H5M A;  1QSN A;  4A33 A;  3N7Z A;  2R7H A;  1MJ9 A;  4MY3 A;  2YNC A;  3R9F A;  2Z3L A;  1GHE A;  4MJ8 A;  3DDD A;  2REF A;  4X5K A;  1I12 A;  1NE9 A;  1TIQ A;  1PUA A;  1XF8 A;  3DR8 A;  4KOS A;  1MJA A;  1Y9W A;  5F48 A;  3F5B A;  3DSB A;  5G22 A;  1YVK A;  2GE3 A;  2GAN A;  2WPW A;  1VKC A;  2DPT A;  3NE7 A;  2G3T A;  4Q36 A;  2DXQ A;  5DWM A;  3R9G A;  1KUX A;  3TFY A;  2FS5 A;  3EO4 A;  4JXQ A;  4ZGY B;  3ZJ0 A;  3ZZI A;  2P6F A;  5AG4 A;  3EXN A;  2B3U A;  5G20 A;  3OWC A;  4BBH A;  4XPK A;  2VI7 A;  3UY5 A;  1PU9 A;  2OH1 A;  4L8A A;  3S6F A;  5HMN A;  2FIA A;  2J8M A;  1B6B A;  1Z4E A;  2JEV A;  2PR1 A;  3T90 A;  3WR7 A;  4U9Z A;  4F0Y A;  1YK3 A;  2VXK A;  4PSX A;  4XPD B;  2Z3O A;  4C68 A;  3T9Y A;  3CXQ A;  5J8F A;  4JLY A;  2B4D A;  2BL1 A;  3R9E A;  1KUV A;  4NCZ A;  5IV0 A;  1J4J A;  3QAH A;  3IU1 A;  1SQH A;  1ZO0 A;  2B4B A;  4HNY B;  3BJ7 A;  5GCN A;  2A4N A;  4KOW A;  4CYP A;  4A32 A;  4C7I A;  4FD6 A;  3MGD A;  5ISV A;  2FCK A;  4IF5 A;  2PC1 A;  4MI4 A;  3S6H A;  4A2Z A;  2ZPA A;  4J3G A;  4MFQ A;  3TO9 A;  3SXN A;  2KCW A;  1M44 A;  1YRE A;  2ZXV A;  1Y9K A;  4XPD C;  5F46 A;  4KSA A;  2YND A;  3GY9 A;  3S6K A;  2BEI A;  2FXF A;  2VBQ A;  4KOR A;  4C2Y A;  2YNE A;  2WSA A;  4R57 A;  5JPH A;  3R1K A;  1MJB A;  4QBJ A;  3DNS A;  4QUS A;  3EY5 A;  4MFZ A;  3VWD A;  2EVN A;  1M4D A;  2Y0M A;  5A27 A;  2B3V A;  4KUA A;  2Z11 A;  2ZW4 A;  4PK3 A;  4CGL A;  2AJ6 A;  2VQY A;  4CRZ B;  1FY7 A;  2Z3N A;  3FYN A;  1XMT A;  1RO5 A;  2B58 A;  4C2X A;  2QIR A;  4KZT A;  5F47 A;  4QC6 A;  3IWE A;  4F6A A;  2OZG A;  4DNC A;  5KTD A;  3FB3 A;  4ONU A;  2ARH A;  2RC4 A;  3D3S A;  5IX3 A;  4HNW B;  4A31 A;  1WK4 A;  4IUS A;  1VHS A;  4B14 A;  4CAF A;  2YNC C;  5HH1 A;  1S5K A;  2JLM A;  4C7H A;  4QVT A;  4GS4 A;  2J8R A;  1S7L A;  2OB0 A;  3R96 A;  5BWA B;  3D2M A;  4HNX B;  2JDC A;  2X7B A;  2R1I A;  4YRH A;  2CNM A;  3TCV A;  1UFH A;  1Z4R A;  3K9U A;  2J8N A;  3TOA A;  4UA3 A;  3G3S A;  2Q7B A;  4Y49 B;  1M4G A;  1IID A;  4KS9 A;  2Q44 A;  5H84 A;  4NSQ A;  3H4Q A;  4PSW A;  4R3L A;  3BLN A;  1YX0 A;  2ZW7 A;  5IB0 A;  4CAX A;  3FXT A;  3W6X A;  1MK4 A;  1KUY A;  4PV6 A;  4NXY A;  4HKF A;  4B10 A;  4EVY A;  4A95 A;  2HUZ A;  3BJ8 A;  5AG7 A;  3TT2 A;  3FBU A;  4MY0 A;  1YGH A;  4A30 A;  2WPX A;  2FIW A;  1S7N A;  2B4D B;  2P0W A;  3RYO A;  4CYO A;  1S60 A;  4CS0 B;  3D2P A;  4CRY B;  4H6U A;  1IYL A;  4K30 A;  5J8C A;  4AG7 A;  4B13 A;  1QSM A;  2P6G A;  2Q4V A;  2D4O A;  1WWZ A;  2WUU A;  3JUW A;  4CYQ A;  1S3Z A;  4KOT A;  2O28 A;  2FT0 A;  4B5P B;  1R57 A;  1Q2Y A;  4R87 A;  4MFJ A;  1M4I A;  4R3K A;  4XNH B;  4KOV A;  2P6E A;  4CAE A;  2PDO A;  1K4J A;  2CXA A;  4MFL A;  1OZP A;  3TTH A;  2BUE A;  4M85 A;  3CXS A;  2D4P A;  1Z9U A;  5EBV A;  4ORF A;  4E2A A;  3SXO A;  4B12 A;  5AG6 A;  3V8I A;  2QEC A;  3PGP A;  4KOX A;  5CNP A;  4UFX A;  4AVC A;  4ZBG A;  1YVO A;  1KZF A;  4CAW A;  2Z3K A;  1V0C A;  4R9M A;  2PR8 A;  4OLL A;  2OU2 A;  2CNT A;  4XNH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...