1IIDA

Crystal structure of saccharomyces cerevisiae n-myristoyltransferase with bound s-(2-oxo)pentadecylcoa and the octapeptide glyaskla
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
422
structure length
422
Chain Sequence
AMKDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Saccharomyces cerevisiae N-myristoyltransferase with bound myristoylCoA and peptide provide insights about substrate recognition and catalysis.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Peptide N-myristoyltransferase
total genus 115
structure length 422
sequence length 422
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2001-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iidA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iidA02
4KOXA 1GHEA 4KORA 2P6FA 1M1DA 5E96A 3DR6A 2PQ8A 2B58A 4Y49B 3WR7A 1Q2CA 4HNYB 3V8IA 4J3GA 1VHSA 4FD6A 4YFJA 1YVKA 3BLNA 1VKCA 4KOUA 2NMTA 4R3LA 1Y9WA 4K30A 1S7FA 2ZPAA 1YGHA 3S6HA 4JXRA 4AG9A 1Z9UA 1M4GA 4U9ZA 2P6GA 1I21A 4CS0B 2OZUA 2C27A 4HNWB 4KOYA 2J8NA 1CJWA 3S6FA 2BEIA 4F6AA 4UWJA 1Z4RA 2PDOA 5GCNA 4U5YA 4KVME 5EC4A 1RO5A 3I9SA 2AJ6A 1WWZA 2Y0MA 4NEXA 1M4IA 1K4JA 3I3GA 5H86A 4E0AA 4CAXA 1YREA 1R57A 3FXTA 2PC1A 4I49A 4ONUA 1KUYA 2G3TA 1TIQA 4UWIA 3S6KA 1QSOA 2G0BA 2Q4YA 2FL4A 5JPHA 3EY5A 5C88A 5HH1A 3EO4A 2VI7A 3TO6A 2QMLA 4H6ZA 1S5KA 5ISVA 3TTHA 2B3VA 3IGRA 1YX0A 2BSWA 4OAEA 2ZW6A 4L8AA 4NXYA 3ZJ0A 3BJ8A 1YVOA 3CXQA 4E2AA 4FD4A 2OZHA 3S6GA 1M44A 4R57A 2CNSA 2REEA 1P0HA 1MK4A 2R7HA 3P2FA 2JDDA 3SHPA 4GS4A 5C82A 1NMTA 5KTCA 4YRHA 2ARHA 4KUBA 4UBRA 1QSRA 2P6EA 4QVTA 4KOWA 4XPDB 4CRZB 5KTDA 4ORFA 1B87A 5F49A 4XPKA 3BJ7A 1PUAA 2Q7BA 2Z10A 1S7LA 5H84A 2B5GA 3LD2A 3N7ZA 3T90A 4PSWA 3R9EA 3F5BA 1NE9A 5JQ4A 4CAVA 3E0KA 4MHDA 2O28A 4KUAA 4QUSA 3DSBA 2FSRA 3LODA 3D2MA 2GE3A 4FD7A 3EXNA 3TO9A 1M4DA 4JWPA 1I1DA 1KUVA 4NSQA 2J8MA 3QB8A 4UA3A 2IL4A 1YK3A 2H5MA 2QIRA 2R98A 2GIVA 1S3ZA 2FIWA 2G3AA 4JD6A 2WPWA 1OZPA 3EC4A 2ZXVA 4BMHA 4B5OA 3TOAA 4MJ8A 3FYNA 4H89A 2Z0ZA 3R1KA 4CRYB 1LRZA 3MGDA 4KVOE 1MJBA 2I79A 2R8VA 3CXSA 3W6SA 5FVJA 1N71A 1IICA 2FS5A 1SQHA 1Z4EA 1FY7A 3GY9A 3PZJA 4JJXA 3R9FA 1QSTA 2D4OA 2FCKA 2PRBA 2Q04A 4IUSA 4QC6A 2REFA 4X5KA 4AVBA 4MY0A 4R3KA 4FD5A 3SXNA 2GANA 3DR8A 1V0CA 1UFHA 3PGPA 4JXQA 4DNCA 4KZTA 1Q2DA 4KVXA 3T9YA 5I0CA 2QECA 3GKRA 4H6UA 2JEVA 3PP9A 4L89A 2VZZA 3D8PA 3JVNA 2PR1A 4MBUA 4NCZA 5J8FA 5IX3A 4LUAA 2DXQA 2FT0A 1BOBA 3KKWA 2KCWA 4II9A 2Q44A 3P2HA 1IYKA 2VZYA 1XEBA 1XIXA 1WK4A 3TO7A 1MJAA 3C26A 1NSLA 2ZW4A 4XPLA 2PSWA 2BL1A 1YLEA 4XPDC 5F48A 2EUIA 5EBVA 1Y7RA 1QSNA 3FB3A 2BUEA 2A4NA 2OB0A 4KLWA 1IB1E 2EVNA 4XNHC 4EVYA 1U6MA 3SXOA 4QBJA 4HKFA 3DNSA 4NF1A 4KLVA 2CNTA 4R9MA 2VQYA 2B4DA 2Q0YA 3F8KA 4AB7A 1BO4A 4OLLA 2ZW5A 1S7NA 4AVCA 1XF8A 3QAHA 2Q4VA 1Y9KA 4IF5A 4CAWA 3FNCA 2OU2A 2HV2A 4B5PB 2WPXA 4PK2A 2ZW7A 2I00A 1CM0A 3TT2A 1S7KA 5DWMA 4PV6A 2Z11A 3FIXA 2ATRA 4YGOA 3OWCA 1KUXA 4ZBGA 3RYOA 1P4NA 2OH1A 2VXKA 2R1IA 1ON0A 2B5GB 5KTAA 3UY5A 1B6BA 3GYAA 2FIAA 3EFAA 1XE4A 3W6XA 1PU9A 4B5PA 4XNHB 3VWEA 4Y49C 5IV0A 3DDDA 5J8CA 2B4DB 1J4JA 3K9UA 2RC4A 4RS2A 4MI4A 4RI1A 3D3SA 4KOVA 3CXPA 5F46A 3TOBA 2B3UA 1YR0A 5IB0A 2P0WA 1IIDA 2CY2A 3FRMA 2D4PA 4PSXA 2PR8A 4AG7A 2JDCA 3R95A 3TFYA 4M3SA 3TCVA 5DWNA 4KOSA 3ZZIA 3R96A 3JUWA 5F47A 2JLMA 2K5TA 1Q2YA 2HQYA 1L0CA 4M85A 2VEZA 4MY3A 4AVAA 4JLYA 2FXFA 1MJ9A 3B8GA 3R9GA 4OADA 2OZGA 2VBQA 3W91A 2HUZA 4QB9A 1I12A 2AE6A 2J8RA 3TE4A 1KZFA 1RXTA 4PK3A 3VWDA 4U9YA 2FE7A 3NE7A 5CNPA 2X7BA 4F0YA 3H4QA 3F0AA 1IYLA 4R87A 4KOTA 4LX9A 3FBUA 1S60A 4E8OA 3G3SA 3D2PA 5HMNA 2B4BA 1QSMA 4HNXB 1XMTA 2CNMA 3IWGA 2F5IA 3G8WA
chains in the Genus database with same CATH superfamily
2Q51A 5ELYA 4KOXA 4IAVA 1GHEA 2PJAA 3IC1A 4KORA 2C6GA 3D68A 5A28A 2P6FA 4P4IA 1M1DA 5E96A 2Z3NA 5HXDA 2EWBA 3FEEA 1DE4C 4MFPA 3DR6A 2PQ8A 3PB7X 2B58A 4MFZA 4WWVA 5AGEA 3KR5A 4Y49B 1CG2A 1ZG9A 1FNOA 4OC2A 3WR7A 3PRTA 1BPNA 1CPSA 1Q2CA 2IJZA 4HNYB 4J3GA 1VHSA 3V8IA 2PJ9A 1XOVA 4FD6A 5AG5A 4YFJA 5LYIA 1YVKA 3BLNA 3K9TA 4BD9A 1VKCA 4ONWA 2EK9A 1XMBA 4M6IA 3MRUA 5CBMA 1A2ZA 2PJ3A 4KOUA 3WABA 2NMTA 4R3LA 3NH4A 1Y9WA 4K30A 1S7FA 2ZPAA 1YGHA 1Z8WA 3S6HA 4JXRA 4AG9A 1Z9UA 1M4GA 3JRUA 4U9ZA 2P6GA 1IOFA 1CP6A 1I21A 4CS0B 2OZUA 4C7HA 2C27A 3DGVA 4UIAA 3IWWA 2IMOA 4PXCA 4Q36A 2NSMA 4HNWB 4KOYA 2J8NA 1GYTA 4A94A 1CJWA 1YQEA 4PXBA 4OKOA 3S6FA 2XEJA 1TF8A 4MFKA 2BEIA 4F6AA 4OIWA 2F7VA 4MRIA 4Q7AA 2C6PA 4TWEA 4UWJA 1Z4RA 2PDOA 5CPAA 1IOIA 5GCNA 1LFWA 4R8FA 3D67A 2PIYA 2EK8A 4U5YA 4F9UA 1ZO0A 3I1UA 3NE8A 4KVME 5EC4A 1RO5A 2Z3LA 3I9SA 4FAIA 2AJ6A 4Z65A 1X10A 4P4FA 1Y0RA 1TKFA 1WWZA 2Y0MA 4NEXA 4JZ0A 1LAPA 1M4IA 3SI1A 4NJRA 1K4JA 3I3GA 5H86A 4NGNA 2ABZA 4E0AA 2PJ6A 2PJ4A 4CAXA 1YREA 1R57A 1HDUA 2ZELA 3FXTA 3SI0A 1IY7A 4CGMA 2DF5A 2PC1A 2YNEA 3IU1A 2PCUA 4I49A 3T8WA 5DS0A 4ONUA 1KUYA 1Z8XA 3PEIA 4NFRA 2G3TA 1TIQA 3H8GA 4UWIA 3S6KA 1QSOA 1YW6A 4NGRA 2PE3A 2G0BA 1PCAA 2Q4YA 2FL4A 5JPHA 3SJGA 3CPXA 2ZEMA 3EY5A 1CP7A 4MCSA 5C88A 4PPZA 1TXRA 5HH1A 5BWAB 2QJ8A 4ZYQA 3EO4A 2VI7A 1JQGA 1LAMA 3WT4A 3B2YA 2QMLA 3L2NA 4H6ZA 4FWUA 3S9MA 3TO6A 1S5KA 2GREA 3FVLA 4YWYA 5ISVA 2DPSA 3TTHA 2B3VA 3IGRA 1YX0A 2IQ6A 2BSWA 3PFOA 3IFEA 4OAEA 2PJ0A 2ZW6A 2QVPA 4L8AA 2AFOA 1YSJA 4NXYA 1XBUA 2J9AA 3ZJ0A 2XEGA 3BJ8A 1YVOA 4HPSA 3CXQA 1YLOA 5A27A 1JWQA 4LQ6A 5J1QA 1ARMA 4E2AA 2V8DA 1EE3P 4FD4A 2GLJA 2OZHA 1QQ9A 1M44A 3A9LA 3CPAA 4R57A 2OOTA 2CNSA 3S6GA 4CGNA 4CGOA 2REEA 1P0HA 1MK4A 2R7HA 3P2FA 1H8LA 2JDDA 3PBEA 3SHPA 3QNVA 4GS4A 5C82A 1NMTA 7CPAA 5KTCA 4YRHA 2ARHA 4B10A 4JYWA 3GIUA 4X8IA 1XFOA 4KUBA 4UBRA 1QSRA 1NSAA 1LOKA 2P6EA 4KOWA 4QVTA 3D66A 4XPDB 3VARA 3ISZA 4IHMA 4CRZB 3B3CA 2POKA 4MFQA 4ORFA 5KTDA 5AG7A 1B87A 5F49A 1ZLHA 2AFUA 2YNCA 4XPKA 3BJ7A 1PUAA 4ZY2A 2Q7BA 3KZWA 4P4DA 2Z10A 4A30A 1S7LA 1F2PA 2XEFA 4MHNA 2B5GA 5H84A 3LD2A 2PRQA 1YW4A 3N7ZA 1R43A 3NH8A 2PVVA 3T90A 4PSWA 4OC1A 4ZX9A 1LCPA 3KHXA 4MCQA 3R9EA 2V8VA 3F5BA 1NE9A 5JQ4A 4OC3A 3PFEA 2ZEFA 4CAVA 2BO9A 3E0KA 4MHDA 2O28A 4C7IA 4KUAA 1AMPA 4F9VA 4QUSA 4R7MA 3DSBA 3FJUA 2FSRA 3LODA 4KSAA 3D2MA 2GE3A 4BBHA 2CF4A 4FD7A 4KS9A 4CGPA 3H8EA 2V77A 3EXNA 3TO9A 1M4DA 1KWMA 4UIBA 4JWPA 1I1DA 1KUVA 3B3TA 3HLPA 4LQGA 3NA6A 4NSQA 2AFMA 2J8MA 3QB8A 1AYEA 1CX8A 4UA3A 2IL4A 1YK3A 1Z2LA 2H5MA 3WC5A 2QIRA 4P4BA 1PYTB 4P4JA 4P44A 4B6ZA 3MN8A 4ZY1A 1XRYA 3IO1A 2ZOGA 4A31A 2R98A 2GIVA 1S3ZA 3KI9A 5G21A 2FIWA 4P10A 4OIDA 2G3AA 2RB7A 2WPWA 4JD6A 2Q7SA 1OZPA 5K8PA 3EC4A 1HEEA 2ZXVA 3FMCA 1FT7A 4BMHA 4B5OA 4IK2A 5LRGA 3TOAA 2HC9A 2CIJA 3FYNA 2O53A 2Z0ZA 3R1KA 4H89A 4MJ8A 1LRZA 3VATA 3MGDA 3IJ3A 4CRYB 4CYNA 2Q43A 4KVOE 2PJ8A 1MJBA 4CAEA 4DJLA 1YMEA 2C1CA 2I79A 5LYLA 2R8VA 3CXSA 3FECA 3FX6A 2CTBA 3W6SA 1AUGA 5FVJA 3BI0A 1N71A 2ZEOA 3D7DA 1ELLP 1IICA 4H2KA 2PJ2A 2DPTA 3V38A 4F0XA 3PBBA 2FS5A 2PVWA 4OMEA 3D7GA 4NGMA 4OC4A 4A39A 2I3CA 1SQHA 1Z4EA 2VL1A 4ZY0A 1FY7A 3GY9A 3PZJA 4JJXA 4UFXA 3R9FA 4B11A 2JBJA 1QSTA 2D4OA 2FCKA 2PRBA 2Q04A 3BXMA 2YNCC 3NFZA 4IUSA 2REFA 4KSIA 4X5KA 2GU2A 1M4LA 4AVBA 2O4HA 2V8GA 4MY0A 4R3KA 1ZG7A 4FD5A 4R6TA 3SXNA 2ANPA 4CAFA 3CDXA 4CGLA 2CTCA 5G20A 3ISXA 1ARLA 2GANA 3DR8A 1V0CA 4OC0A 4P6YA 2ODFA 1UFHA 3PGPA 4JXQA 1BAVA 3IEHA 3VH9A 4DNCA 2WYRA 4KZTA 3PB4X 1Q2DA 4KVXA 3T9YA 5I0CA 2QECA 1IU8A 4NJQA 3GKRA 2PJCA 3K2KA 4H6UA 1VGYA 2JEVA 2PJ7A 3PP9A 4L89A 2VZZA 4C68A 3D8PA 3JVNA 2PR1A 1BPMA 4MBUA 4NCZA 5J8FA 2ZENA 5IX3A 4LUAA 3WC6A 2DXQA 2FT0A 1BOBA 2RFHA 1BLLE 3IU2A 4RN7A 4R76A 3KKWA 2ZEEA 3RO0A 2KCWA 4MHPA 4II9A 2Q44A 3P2HA 3RNZA 5K8MA 1IYKA 4MHZA 4Q38A 2VZYA 3HUVA 5JH9A 3GLJA 5IB9A 1XEBA 3FEDA 1QMUA 1WK4A 1XIXA 1TF9A 3TO7A 1MJAA 2DEAA 1CBXA 3BI1A 3SJXA 1VIXA 3C26A 2XEIA 4W9YA 1NSLA 5F09A 2ZW4A 4ZI6A 3S9NA 3B3SA 5D8NA 3KQZA 2YNDA 4K3NA 2ZEGA 4UF4A 3FF3A 4MCPA 5AG6A 2WZNA 2PSWA 4XPLA 2BL1A 2GLFA 1YLEA 3B3VA 4XPDC 5F48A 4DYOA 2EUIA 4MCRA 2ZEPA 2PIZA 4M6HA 3JTKA 3B35A 2BOAA 4C2YA 5EBVA 2Z3MA 2NYQA 1TKJA 1Y7RA 1QSNA 3FB3A 1Z8TA 2C6CA 2QYVA 2BUEA 4WJBA 2A4NA 2WUUA 2OB0A 1X12A 4KLWA 1IB1E 2EVNA 2V8HA 4XNHC 1LANA 1OBRA 4EVYA 1U6MA 1VHOA 1ZG8A 3SXOA 4QBJA 3TX8A 1CPXA 4HKFA 3DNSA 4CPAA 4NF1A 4KLVA 5G22A 2CNTA 4R9MA 2VQYA 2B4DA 2Q0YA 3SJEA 1HDQA 3F8KA 2ZOFA 4X3RA 1BO4A 2ZEHA 4OLLA 2ZW5A 3GB0A 4AB7A 1S7NA 4AVCA 4A32A 3CZXA 5LRKA 1XF8A 4UFVA 2G9DA 3QAHA 4AXVA 4EFDA 2Q4VA 1Y9KA 3V7ZA 4IF5A 3B3WA 4CAWA 1R3NA 2OU2A 3FNCA 2HV2A 4M6GA 4B5PB 2WPXA 4PK2A 4F8ZA 2ZW7A 2I00A 2Z3PA 1CM0A 2YGWA 3TT2A 1S7KA 5DWMA 4PV6A 1XJOA 2Z11A 2ATRA 3FIXA 4YGOA 4A37A 3OWCA 2AFWA 3B7IA 4TNUA 1KUXA 4ZBGA 3RYOA 1P4NA 4G1PA 3KR4A 4P45A 1TKHA 3DLJA 2EO8A 2OH1A 3LMSA 2VXKA 2R1IA 3KL9A 3BHXA 4DUKA 1ON0A 4EWTA 1IGBA 2B5GB 3NH5A 4BINA 5KTAA 2BCOA 4UCPA 4O23A 1B6BA 3UY5A 5EMIA 3GYAA 2FIAA 3EFAA 3CT9A 4FUUA 5LRJA 1Z8LA 3PB8X 1XE4A 2CXAA 3RBUA 3W6XA 5JM6A 1PU9A 4B5PA 5I4MA 4A33A 4PXEA 4A38A 3KASA 4QC6A 5JGFA 4XNHB 4UFWA 1Y0YA 3KQXA 4Y49C 3VWEA 5IV0A 3DDDA 5J8CA 4ZGYB 4UEZA 5D29A 2B4DB 4P4EA 1J4JA 4MHYA 3K9UA 4X2TA 4KSFA 2AFSA 4B14A 4MFJA 2FVGA 2JBKA 2RC4A 4RS2A 3SI2A 2PJ5A 4OP4A 2F8HA 4MI4A 4UEFA 4RI1A 3D3SA 3IIBA 3CXPA 4KOVA 4CYQA 3D4UA 5G1ZA 5F46A 4A95A 3QAYA 3TOBA 2B3UA 5THWA 1Q7LA 1YR0A 5IB0A 2JEWA 2AFXA 4UCNA 2P0WA 5AG4A 4MFLA 1IIDA 2CY2A 3FRMA 3H5ZA 3SJFA 4NGSA 2D4PA 4PSXA 2PR8A 2Q4ZA 4YU9A 4AG7A 4NGPA 2JDCA 3R95A 4GM5A 5HVHA 3N5FA 3TFYA 4M3SA 3TCVA 3S9LA 3D7HA 4UEEA 5DWNA 4MXUA 4KOSA 2GFQA 4PXDA 3ZZIA 3PB6X 4OC5A 1ELMP 3IWEA 3JUWA 3R96A 5K8NA 1RTQA 4ZX8A 5F47A 4EMEA 4RUHA 2JLMA 2HB6A 2K5TA 4CYOA 1Q2YA 2HQYA 5HVGA 3FH4A 1L0CA 4M85A 3RZAA 3WC7A 2VEZA 4GXHA 4MY3A 2PJ1A 5K8OA 4CYPA 1ZLIA 4AVAA 4JLYA 5HVFA 2FXFA 1MJ9A 2WSAA 3B8GA 3R9GA 3H8FA 4C2XA 4MMOA 2OZGA 3LACA 2VBQA 4OADA 4NGTA 3PB9X 2Z3KA 5LYFA 3RAMA 2EBJA 3W91A 2HUZA 4QB9A 4A2ZA 1DTDA 2PJBA 1I12A 2AE6A 1VHEA 2J8RA 2Z3OA 3TC8A 3TE4A 1KZFA 1Y7EA 1RXTA 3KGQA 1F57A 4PK3A 2ZEDA 1Z5RA 3VWDA 4U9YA 2FE7A 3NE7A 5CNPA 4UCMA 2X7BA 3GUXA 3LWUA 4F0YA 2AFZA 3H4QA 3F0AA 1IYLA 4R87A 4C2ZA 4FBEA 3KHZA 4KOTA 4NGQA 1UWYA 3D7FA 4LX9A 3FBUA 8CPAA 1S60A 5LYDA 4E8OA 3G3SA 3D2PA 5HMNA 4B12A 2B4BA 1QSMA 1XMTA 4HNXB 4PQAA 2CNMA 2OR4A 6CPAA 3IWGA 2F5IA 3G8WA 4B13A 1F2OA
chains in the Genus database with same CATH topology
4KOXA 1GHEA 4KORA 5A28A 2P6FA 1M1DA 5E96A 2Z3NA 4MFPA 3DR6A 2PQ8A 4MFZA 2B58A 5AGEA 4Y49B 3WR7A 1Q2CA 4HNYB 3V8IA 4J3GA 1VHSA 4FD6A 5AG5A 4YFJA 1YVKA 3BLNA 1VKCA 4KOUA 2NMTA 4R3LA 1Y9WA 4K30A 1S7FA 2ZPAA 1YGHA 3S6HA 4JXRA 4AG9A 1Z9UA 1M4GA 4U9ZA 2P6GA 1I21A 4CS0B 2OZUA 4C7HA 2C27A 4Q36A 4HNWB 4KOYA 2J8NA 1CJWA 3S6FA 4MFKA 2BEIA 4F6AA 4UWJA 1Z4RA 2PDOA 5GCNA 4U5YA 1ZO0A 4KVME 5EC4A 1RO5A 2Z3LA 3I9SA 2AJ6A 1WWZA 2Y0MA 4NEXA 1M4IA 1K4JA 3I3GA 5H86A 4E0AA 4CAXA 1YREA 1R57A 3FXTA 4CGMA 2PC1A 2YNEA 3IU1A 4I49A 4ONUA 1KUYA 2G3TA 1TIQA 4UWIA 3S6KA 1QSOA 2G0BA 2Q4YA 2FL4A 5JPHA 3EY5A 5C88A 5HH1A 5BWAB 3EO4A 2VI7A 3TO6A 2QMLA 4H6ZA 1S5KA 5ISVA 2DPSA 3TTHA 2B3VA 3IGRA 1YX0A 2BSWA 4OAEA 2ZW6A 4L8AA 4NXYA 3ZJ0A 3BJ8A 1YVOA 3CXQA 5A27A 4E2AA 4FD4A 2OZHA 3A9LA 3S6GA 1M44A 4CGNA 4R57A 2CNSA 4CGOA 2REEA 1P0HA 1MK4A 2R7HA 3P2FA 2JDDA 3SHPA 4GS4A 5C82A 1NMTA 5KTCA 4YRHA 2ARHA 4B10A 4KUBA 4UBRA 1QSRA 2P6EA 4QVTA 4KOWA 4XPDB 4CRZB 4MFQA 4ORFA 5KTDA 5AG7A 1B87A 5F49A 2YNCA 4XPKA 3BJ7A 1PUAA 2Q7BA 2Z10A 4A30A 1S7LA 5H84A 2B5GA 3LD2A 3N7ZA 3T90A 4PSWA 3R9EA 3F5BA 1NE9A 5JQ4A 4CAVA 3E0KA 4MHDA 2O28A 4C7IA 4KUAA 4QUSA 3DSBA 4KSAA 2FSRA 3LODA 3D2MA 2GE3A 4BBHA 4FD7A 4KS9A 4CGPA 3EXNA 3TO9A 1M4DA 4JWPA 1I1DA 1KUVA 4NSQA 2J8MA 3QB8A 4UA3A 2IL4A 1YK3A 2H5MA 2QIRA 4A31A 2R98A 2GIVA 1S3ZA 5G21A 2FIWA 2G3AA 4JD6A 2WPWA 1OZPA 3EC4A 2ZXVA 4BMHA 4B5OA 3TOAA 3FYNA 4H89A 2Z0ZA 3R1KA 4MJ8A 4CRYB 1LRZA 4CYNA 3MGDA 4KVOE 1MJBA 4CAEA 2I79A 2R8VA 3CXSA 3W6SA 5FVJA 1N71A 1IICA 4F0XA 2DPTA 2FS5A 1SQHA 1Z4EA 1FY7A 3GY9A 3PZJA 4JJXA 4UFXA 3R9FA 4B11A 1QSTA 2D4OA 2FCKA 2PRBA 2Q04A 4IUSA 2YNCC 4QC6A 2REFA 4X5KA 4AVBA 4MY0A 4R3KA 4FD5A 3SXNA 4CAFA 4CGLA 5G20A 2GANA 3DR8A 1V0CA 1UFHA 3PGPA 4JXQA 4DNCA 4KZTA 1Q2DA 4KVXA 3T9YA 5I0CA 2QECA 3GKRA 4H6UA 2JEVA 3PP9A 4L89A 2VZZA 4C68A 3D8PA 3JVNA 2PR1A 4MBUA 4NCZA 5J8FA 5IX3A 4LUAA 2DXQA 2FT0A 1BOBA 3IU2A 3KKWA 2KCWA 4II9A 2Q44A 3P2HA 1IYKA 4Q38A 2VZYA 1XEBA 1XIXA 1WK4A 3TO7A 1MJAA 3C26A 1NSLA 2ZW4A 2YNDA 5AG6A 4XPLA 2PSWA 2BL1A 1YLEA 4XPDC 5F48A 2EUIA 3JTKA 4C2YA 5EBVA 2Z3MA 1Y7RA 1QSNA 3FB3A 2BUEA 2A4NA 2WUUA 2OB0A 4KLWA 1IB1E 2EVNA 4XNHC 4EVYA 1U6MA 3SXOA 4QBJA 4HKFA 3DNSA 4NF1A 4KLVA 5G22A 2CNTA 4R9MA 2VQYA 2B4DA 2Q0YA 3F8KA 4AB7A 1BO4A 4OLLA 2ZW5A 1S7NA 4AVCA 4A32A 1XF8A 4UFVA 3QAHA 2Q4VA 1Y9KA 4IF5A 4CAWA 3FNCA 2OU2A 2HV2A 4B5PB 2WPXA 4PK2A 2ZW7A 2I00A 2Z3PA 1CM0A 2YGWA 3TT2A 1S7KA 5DWMA 4PV6A 2Z11A 3FIXA 2ATRA 4YGOA 3OWCA 1KUXA 4ZBGA 3RYOA 1P4NA 2OH1A 2VXKA 2R1IA 1ON0A 2B5GB 5KTAA 4UCPA 3UY5A 1B6BA 3GYAA 2FIAA 3EFAA 1XE4A 2CXAA 3W6XA 1PU9A 4B5PA 4A33A 4XNHB 4UFWA 3VWEA 4Y49C 5IV0A 3DDDA 5J8CA 4ZGYB 2B4DB 1J4JA 3K9UA 4KSFA 4B14A 4MFJA 2RC4A 4RS2A 4MI4A 4RI1A 3D3SA 4KOVA 3CXPA 4CYQA 5G1ZA 5F46A 4A95A 3TOBA 2B3UA 1YR0A 5IB0A 4UCNA 2P0WA 5AG4A 4MFLA 1IIDA 2CY2A 3FRMA 3H5ZA 2D4PA 4PSXA 2PR8A 4AG7A 2JDCA 3R95A 3TFYA 4M3SA 3TCVA 5DWNA 4KOSA 3ZZIA 3R96A 3IWEA 3JUWA 5F47A 2JLMA 2K5TA 4CYOA 1Q2YA 2HQYA 1L0CA 4M85A 2VEZA 4MY3A 4CYPA 4AVAA 4JLYA 2FXFA 1MJ9A 2WSAA 3B8GA 3R9GA 4C2XA 4OADA 2OZGA 2VBQA 2Z3KA 3W91A 2HUZA 4QB9A 4A2ZA 1I12A 2AE6A 2J8RA 2Z3OA 3TE4A 1KZFA 1RXTA 4PK3A 3VWDA 4U9YA 2FE7A 3NE7A 5CNPA 4UCMA 2X7BA 4F0YA 3H4QA 3F0AA 1IYLA 4R87A 4C2ZA 4KOTA 4LX9A 3FBUA 1S60A 4E8OA 3G3SA 3D2PA 5HMNA 4B12A 2B4BA 1QSMA 4HNXB 1XMTA 2CNMA 3IWGA 2F5IA 3G8WA 4B13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOX A;  1GHE A;  4KOR A;  2P6F A;  1M1D A;  5E96 A;  3DR6 A;  2PQ8 A;  2B58 A;  4Y49 B;  3WR7 A;  1Q2C A;  4HNY B;  3V8I A;  4J3G A;  1VHS A;  4FD6 A;  4YFJ A;  1YVK A;  3BLN A;  1VKC A;  4KOU A;  2NMT A;  4R3L A;  1Y9W A;  4K30 A;  1S7F A;  2ZPA A;  1YGH A;  3S6H A;  4JXR A;  4AG9 A;  1Z9U A;  1M4G A;  4U9Z A;  2P6G A;  1I21 A;  4CS0 B;  2OZU A;  2C27 A;  4HNW B;  4KOY A;  2J8N A;  1CJW A;  3S6F A;  2BEI A;  4F6A A;  4UWJ A;  1Z4R A;  2PDO A;  5GCN A;  4U5Y A;  4KVM E;  5EC4 A;  1RO5 A;  3I9S A;  2AJ6 A;  1WWZ A;  2Y0M A;  4NEX A;  1M4I A;  1K4J A;  3I3G A;  5H86 A;  4E0A A;  4CAX A;  1YRE A;  1R57 A;  3FXT A;  2PC1 A;  4I49 A;  4ONU A;  1KUY A;  2G3T A;  1TIQ A;  4UWI A;  3S6K A;  1QSO A;  2G0B A;  2Q4Y A;  2FL4 A;  5JPH A;  3EY5 A;  5C88 A;  5HH1 A;  3EO4 A;  2VI7 A;  3TO6 A;  2QML A;  4H6Z A;  1S5K A;  5ISV A;  3TTH A;  2B3V A;  3IGR A;  1YX0 A;  2BSW A;  4OAE A;  2ZW6 A;  4L8A A;  4NXY A;  3ZJ0 A;  3BJ8 A;  1YVO A;  3CXQ A;  4E2A A;  4FD4 A;  2OZH A;  3S6G A;  1M44 A;  4R57 A;  2CNS A;  2REE A;  1P0H A;  1MK4 A;  2R7H A;  3P2F A;  2JDD A;  3SHP A;  4GS4 A;  5C82 A;  1NMT A;  5KTC A;  4YRH A;  2ARH A;  4KUB A;  4UBR A;  1QSR A;  2P6E A;  4QVT A;  4KOW A;  4XPD B;  4CRZ B;  5KTD A;  4ORF A;  1B87 A;  5F49 A;  4XPK A;  3BJ7 A;  1PUA A;  2Q7B A;  2Z10 A;  1S7L A;  5H84 A;  2B5G A;  3LD2 A;  3N7Z A;  3T90 A;  4PSW A;  3R9E A;  3F5B A;  1NE9 A;  5JQ4 A;  4CAV A;  3E0K A;  4MHD A;  2O28 A;  4KUA A;  4QUS A;  3DSB A;  2FSR A;  3LOD A;  3D2M A;  2GE3 A;  4FD7 A;  3EXN A;  3TO9 A;  1M4D A;  4JWP A;  1I1D A;  1KUV A;  4NSQ A;  2J8M A;  3QB8 A;  4UA3 A;  2IL4 A;  1YK3 A;  2H5M A;  2QIR A;  2R98 A;  2GIV A;  1S3Z A;  2FIW A;  2G3A A;  4JD6 A;  2WPW A;  1OZP A;  3EC4 A;  2ZXV A;  4BMH A;  4B5O A;  3TOA A;  4MJ8 A;  3FYN A;  4H89 A;  2Z0Z A;  3R1K A;  4CRY B;  1LRZ A;  3MGD A;  4KVO E;  1MJB A;  2I79 A;  2R8V A;  3CXS A;  3W6S A;  5FVJ A;  1N71 A;  1IIC A;  2FS5 A;  1SQH A;  1Z4E A;  1FY7 A;  3GY9 A;  3PZJ A;  4JJX A;  3R9F A;  1QST A;  2D4O A;  2FCK A;  2PRB A;  2Q04 A;  4IUS A;  4QC6 A;  2REF A;  4X5K A;  4AVB A;  4MY0 A;  4R3K A;  4FD5 A;  3SXN A;  2GAN A;  3DR8 A;  1V0C A;  1UFH A;  3PGP A;  4JXQ A;  4DNC A;  4KZT A;  1Q2D A;  4KVX A;  3T9Y A;  5I0C A;  2QEC A;  3GKR A;  4H6U A;  2JEV A;  3PP9 A;  4L89 A;  2VZZ A;  3D8P A;  3JVN A;  2PR1 A;  4MBU A;  4NCZ A;  5J8F A;  5IX3 A;  4LUA A;  2DXQ A;  2FT0 A;  1BOB A;  3KKW A;  2KCW A;  4II9 A;  2Q44 A;  3P2H A;  1IYK A;  2VZY A;  1XEB A;  1XIX A;  1WK4 A;  3TO7 A;  1MJA A;  3C26 A;  1NSL A;  2ZW4 A;  4XPL A;  2PSW A;  2BL1 A;  1YLE A;  4XPD C;  5F48 A;  2EUI A;  5EBV A;  1Y7R A;  1QSN A;  3FB3 A;  2BUE A;  2A4N A;  2OB0 A;  4KLW A;  1IB1 E;  2EVN A;  4XNH C;  4EVY A;  1U6M A;  3SXO A;  4QBJ A;  4HKF A;  3DNS A;  4NF1 A;  4KLV A;  2CNT A;  4R9M A;  2VQY A;  2B4D A;  2Q0Y A;  3F8K A;  4AB7 A;  1BO4 A;  4OLL A;  2ZW5 A;  1S7N A;  4AVC A;  1XF8 A;  3QAH A;  2Q4V A;  1Y9K A;  4IF5 A;  4CAW A;  3FNC A;  2OU2 A;  2HV2 A;  4B5P B;  2WPX A;  4PK2 A;  2ZW7 A;  2I00 A;  1CM0 A;  3TT2 A;  1S7K A;  5DWM A;  4PV6 A;  2Z11 A;  3FIX A;  2ATR A;  4YGO A;  3OWC A;  1KUX A;  4ZBG A;  3RYO A;  1P4N A;  2OH1 A;  2VXK A;  2R1I A;  1ON0 A;  2B5G B;  5KTA A;  3UY5 A;  1B6B A;  3GYA A;  2FIA A;  3EFA A;  1XE4 A;  3W6X A;  1PU9 A;  4B5P A;  4XNH B;  3VWE A;  4Y49 C;  5IV0 A;  3DDD A;  5J8C A;  2B4D B;  1J4J A;  3K9U A;  2RC4 A;  4RS2 A;  4MI4 A;  4RI1 A;  3D3S A;  4KOV A;  3CXP A;  5F46 A;  3TOB A;  2B3U A;  1YR0 A;  5IB0 A;  2P0W A;  1IID A;  2CY2 A;  3FRM A;  2D4P A;  4PSX A;  2PR8 A;  4AG7 A;  2JDC A;  3R95 A;  3TFY A;  4M3S A;  3TCV A;  5DWN A;  4KOS A;  3ZZI A;  3R96 A;  3JUW A;  5F47 A;  2JLM A;  2K5T A;  1Q2Y A;  2HQY A;  1L0C A;  4M85 A;  2VEZ A;  4MY3 A;  4AVA A;  4JLY A;  2FXF A;  1MJ9 A;  3B8G A;  3R9G A;  4OAD A;  2OZG A;  2VBQ A;  3W91 A;  2HUZ A;  4QB9 A;  1I12 A;  2AE6 A;  2J8R A;  3TE4 A;  1KZF A;  1RXT A;  4PK3 A;  3VWD A;  4U9Y A;  2FE7 A;  3NE7 A;  5CNP A;  2X7B A;  4F0Y A;  3H4Q A;  3F0A A;  1IYL A;  4R87 A;  4KOT A;  4LX9 A;  3FBU A;  1S60 A;  4E8O A;  3G3S A;  3D2P A;  5HMN A;  2B4B A;  1QSM A;  4HNX B;  1XMT A;  2CNM A;  3IWG A;  2F5I A;  3G8W A; 
#chains in the Genus database with same CATH topology
 2Q51 A;  5ELY A;  4KOX A;  4IAV A;  1GHE A;  2PJA A;  3IC1 A;  4KOR A;  2C6G A;  3D68 A;  5A28 A;  2P6F A;  4P4I A;  1M1D A;  5E96 A;  2Z3N A;  5HXD A;  2EWB A;  3FEE A;  1DE4 C;  4MFP A;  3DR6 A;  2PQ8 A;  3PB7 X;  2B58 A;  4MFZ A;  4WWV A;  5AGE A;  3KR5 A;  4Y49 B;  1CG2 A;  1ZG9 A;  1FNO A;  4OC2 A;  3WR7 A;  3PRT A;  1BPN A;  1CPS A;  1Q2C A;  2IJZ A;  4HNY B;  4J3G A;  1VHS A;  3V8I A;  2PJ9 A;  1XOV A;  4FD6 A;  5AG5 A;  4YFJ A;  5LYI A;  1YVK A;  3BLN A;  3K9T A;  4BD9 A;  1VKC A;  4ONW A;  2EK9 A;  1XMB A;  4M6I A;  3MRU A;  5CBM A;  1A2Z A;  2PJ3 A;  4KOU A;  3WAB A;  2NMT A;  4R3L A;  3NH4 A;  1Y9W A;  4K30 A;  1S7F A;  2ZPA A;  1YGH A;  1Z8W A;  3S6H A;  4JXR A;  4AG9 A;  1Z9U A;  1M4G A;  3JRU A;  4U9Z A;  2P6G A;  1IOF A;  1CP6 A;  1I21 A;  4CS0 B;  2OZU A;  4C7H A;  2C27 A;  3DGV A;  4UIA A;  3IWW A;  2IMO A;  4PXC A;  4Q36 A;  2NSM A;  4HNW B;  4KOY A;  2J8N A;  1GYT A;  4A94 A;  1CJW A;  1YQE A;  4PXB A;  4OKO A;  3S6F A;  2XEJ A;  1TF8 A;  4MFK A;  2BEI A;  4F6A A;  4OIW A;  2F7V A;  4MRI A;  4Q7A A;  2C6P A;  4TWE A;  4UWJ A;  1Z4R A;  2PDO A;  5CPA A;  1IOI A;  5GCN A;  1LFW A;  4R8F A;  3D67 A;  2PIY A;  2EK8 A;  4U5Y A;  4F9U A;  1ZO0 A;  3I1U A;  3NE8 A;  4KVM E;  5EC4 A;  1RO5 A;  2Z3L A;  3I9S A;  4FAI A;  2AJ6 A;  4Z65 A;  1X10 A;  4P4F A;  1Y0R A;  1TKF A;  1WWZ A;  2Y0M A;  4NEX A;  4JZ0 A;  1LAP A;  1M4I A;  3SI1 A;  4NJR A;  1K4J A;  3I3G A;  5H86 A;  4NGN A;  2ABZ A;  4E0A A;  2PJ6 A;  2PJ4 A;  4CAX A;  1YRE A;  1R57 A;  1HDU A;  2ZEL A;  3FXT A;  3SI0 A;  1IY7 A;  4CGM A;  2DF5 A;  2PC1 A;  2YNE A;  3IU1 A;  2PCU A;  4I49 A;  3T8W A;  5DS0 A;  4ONU A;  1KUY A;  1Z8X A;  3PEI A;  4NFR A;  2G3T A;  1TIQ A;  3H8G A;  4UWI A;  3S6K A;  1QSO A;  1YW6 A;  4NGR A;  2PE3 A;  2G0B A;  1PCA A;  2Q4Y A;  2FL4 A;  5JPH A;  3SJG A;  3CPX A;  2ZEM A;  3EY5 A;  1CP7 A;  4MCS A;  5C88 A;  4PPZ A;  1TXR A;  5HH1 A;  5BWA B;  2QJ8 A;  4ZYQ A;  3EO4 A;  2VI7 A;  1JQG A;  1LAM A;  3WT4 A;  3B2Y A;  2QML A;  3L2N A;  4H6Z A;  4FWU A;  3S9M A;  3TO6 A;  1S5K A;  2GRE A;  3FVL A;  4YWY A;  5ISV A;  2DPS A;  3TTH A;  2B3V A;  3IGR A;  1YX0 A;  2IQ6 A;  2BSW A;  3PFO A;  3IFE A;  4OAE A;  2PJ0 A;  2ZW6 A;  2QVP A;  4L8A A;  2AFO A;  1YSJ A;  4NXY A;  1XBU A;  2J9A A;  3ZJ0 A;  2XEG A;  3BJ8 A;  1YVO A;  4HPS A;  3CXQ A;  1YLO A;  5A27 A;  1JWQ A;  4LQ6 A;  5J1Q A;  1ARM A;  4E2A A;  2V8D A;  1EE3 P;  4FD4 A;  2GLJ A;  2OZH A;  1QQ9 A;  1M44 A;  3A9L A;  3CPA A;  4R57 A;  2OOT A;  2CNS A;  3S6G A;  4CGN A;  4CGO A;  2REE A;  1P0H A;  1MK4 A;  2R7H A;  3P2F A;  1H8L A;  2JDD A;  3PBE A;  3SHP A;  3QNV A;  4GS4 A;  5C82 A;  1NMT A;  7CPA A;  5KTC A;  4YRH A;  2ARH A;  4B10 A;  4JYW A;  3GIU A;  4X8I A;  1XFO A;  4KUB A;  4UBR A;  1QSR A;  1NSA A;  1LOK A;  2P6E A;  4KOW A;  4QVT A;  3D66 A;  4XPD B;  3VAR A;  3ISZ A;  4IHM A;  4CRZ B;  3B3C A;  2POK A;  4MFQ A;  4ORF A;  5KTD A;  5AG7 A;  1B87 A;  5F49 A;  1ZLH A;  2AFU A;  2YNC A;  4XPK A;  3BJ7 A;  1PUA A;  4ZY2 A;  2Q7B A;  3KZW A;  4P4D A;  2Z10 A;  4A30 A;  1S7L A;  1F2P A;  2XEF A;  4MHN A;  2B5G A;  5H84 A;  3LD2 A;  2PRQ A;  1YW4 A;  3N7Z A;  1R43 A;  3NH8 A;  2PVV A;  3T90 A;  4PSW A;  4OC1 A;  4ZX9 A;  1LCP A;  3KHX A;  4MCQ A;  3R9E A;  2V8V A;  3F5B A;  1NE9 A;  5JQ4 A;  4OC3 A;  3PFE A;  2ZEF A;  4CAV A;  2BO9 A;  3E0K A;  4MHD A;  2O28 A;  4C7I A;  4KUA A;  1AMP A;  4F9V A;  4QUS A;  4R7M A;  3DSB A;  3FJU A;  2FSR A;  3LOD A;  4KSA A;  3D2M A;  2GE3 A;  4BBH A;  2CF4 A;  4FD7 A;  4KS9 A;  4CGP A;  3H8E A;  2V77 A;  3EXN A;  3TO9 A;  1M4D A;  1KWM A;  4UIB A;  4JWP A;  1I1D A;  1KUV A;  3B3T A;  3HLP A;  4LQG A;  3NA6 A;  4NSQ A;  2AFM A;  2J8M A;  3QB8 A;  1AYE A;  1CX8 A;  4UA3 A;  2IL4 A;  1YK3 A;  1Z2L A;  2H5M A;  3WC5 A;  2QIR A;  4P4B A;  1PYT B;  4P4J A;  4P44 A;  4B6Z A;  3MN8 A;  4ZY1 A;  1XRY A;  3IO1 A;  2ZOG A;  4A31 A;  2R98 A;  2GIV A;  1S3Z A;  3KI9 A;  5G21 A;  2FIW A;  4P10 A;  4OID A;  2G3A A;  2RB7 A;  2WPW A;  4JD6 A;  2Q7S A;  1OZP A;  5K8P A;  3EC4 A;  1HEE A;  2ZXV A;  3FMC A;  1FT7 A;  4BMH A;  4B5O A;  4IK2 A;  5LRG A;  3TOA A;  2HC9 A;  2CIJ A;  3FYN A;  2O53 A;  2Z0Z A;  3R1K A;  4H89 A;  4MJ8 A;  1LRZ A;  3VAT A;  3MGD A;  3IJ3 A;  4CRY B;  4CYN A;  2Q43 A;  4KVO E;  2PJ8 A;  1MJB A;  4CAE A;  4DJL A;  1YME A;  2C1C A;  2I79 A;  5LYL A;  2R8V A;  3CXS A;  3FEC A;  3FX6 A;  2CTB A;  3W6S A;  1AUG A;  5FVJ A;  3BI0 A;  1N71 A;  2ZEO A;  3D7D A;  1ELL P;  1IIC A;  4H2K A;  2PJ2 A;  2DPT A;  3V38 A;  4F0X A;  3PBB A;  2FS5 A;  2PVW A;  4OME A;  3D7G A;  4NGM A;  4OC4 A;  4A39 A;  2I3C A;  1SQH A;  1Z4E A;  2VL1 A;  4ZY0 A;  1FY7 A;  3GY9 A;  3PZJ A;  4JJX A;  4UFX A;  3R9F A;  4B11 A;  2JBJ A;  1QST A;  2D4O A;  2FCK A;  2PRB A;  2Q04 A;  3BXM A;  2YNC C;  3NFZ A;  4IUS A;  2REF A;  4KSI A;  4X5K A;  2GU2 A;  1M4L A;  4AVB A;  2O4H A;  2V8G A;  4MY0 A;  4R3K A;  1ZG7 A;  4FD5 A;  4R6T A;  3SXN A;  2ANP A;  4CAF A;  3CDX A;  4CGL A;  2CTC A;  5G20 A;  3ISX A;  1ARL A;  2GAN A;  3DR8 A;  1V0C A;  4OC0 A;  4P6Y A;  2ODF A;  1UFH A;  3PGP A;  4JXQ A;  1BAV A;  3IEH A;  3VH9 A;  4DNC A;  2WYR A;  4KZT A;  3PB4 X;  1Q2D A;  4KVX A;  3T9Y A;  5I0C A;  2QEC A;  1IU8 A;  4NJQ A;  3GKR A;  2PJC A;  3K2K A;  4H6U A;  1VGY A;  2JEV A;  2PJ7 A;  3PP9 A;  4L89 A;  2VZZ A;  4C68 A;  3D8P A;  3JVN A;  2PR1 A;  1BPM A;  4MBU A;  4NCZ A;  5J8F A;  2ZEN A;  5IX3 A;  4LUA A;  3WC6 A;  2DXQ A;  2FT0 A;  1BOB A;  2RFH A;  1BLL E;  3IU2 A;  4RN7 A;  4R76 A;  3KKW A;  2ZEE A;  3RO0 A;  2KCW A;  4MHP A;  4II9 A;  2Q44 A;  3P2H A;  3RNZ A;  5K8M A;  1IYK A;  4MHZ A;  4Q38 A;  2VZY A;  3HUV A;  5JH9 A;  3GLJ A;  5IB9 A;  1XEB A;  3FED A;  1QMU A;  1WK4 A;  1XIX A;  1TF9 A;  3TO7 A;  1MJA A;  2DEA A;  1CBX A;  3BI1 A;  3SJX A;  1VIX A;  3C26 A;  2XEI A;  4W9Y A;  1NSL A;  5F09 A;  2ZW4 A;  4ZI6 A;  3S9N A;  3B3S A;  5D8N A;  3KQZ A;  2YND A;  4K3N A;  2ZEG A;  4UF4 A;  3FF3 A;  4MCP A;  5AG6 A;  2WZN A;  2PSW A;  4XPL A;  2BL1 A;  2GLF A;  1YLE A;  3B3V A;  4XPD C;  5F48 A;  4DYO A;  2EUI A;  4MCR A;  2ZEP A;  2PIZ A;  4M6H A;  3JTK A;  3B35 A;  2BOA A;  4C2Y A;  5EBV A;  2Z3M A;  2NYQ A;  1TKJ A;  1Y7R A;  1QSN A;  3FB3 A;  1Z8T A;  2C6C A;  2QYV A;  2BUE A;  4WJB A;  2A4N A;  2WUU A;  2OB0 A;  1X12 A;  4KLW A;  1IB1 E;  2EVN A;  2V8H A;  4XNH C;  1LAN A;  1OBR A;  4EVY A;  1U6M A;  1VHO A;  1ZG8 A;  3SXO A;  4QBJ A;  3TX8 A;  1CPX A;  4HKF A;  3DNS A;  4CPA A;  4NF1 A;  4KLV A;  5G22 A;  2CNT A;  4R9M A;  2VQY A;  2B4D A;  2Q0Y A;  3SJE A;  1HDQ A;  3F8K A;  2ZOF A;  4X3R A;  1BO4 A;  2ZEH A;  4OLL A;  2ZW5 A;  3GB0 A;  4AB7 A;  1S7N A;  4AVC A;  4A32 A;  3CZX A;  5LRK A;  1XF8 A;  4UFV A;  2G9D A;  3QAH A;  4AXV A;  4EFD A;  2Q4V A;  1Y9K A;  3V7Z A;  4IF5 A;  3B3W A;  4CAW A;  1R3N A;  2OU2 A;  3FNC A;  2HV2 A;  4M6G A;  4B5P B;  2WPX A;  4PK2 A;  4F8Z A;  2ZW7 A;  2I00 A;  2Z3P A;  1CM0 A;  2YGW A;  3TT2 A;  1S7K A;  5DWM A;  4PV6 A;  1XJO A;  2Z11 A;  2ATR A;  3FIX A;  4YGO A;  4A37 A;  3OWC A;  2AFW A;  3B7I A;  4TNU A;  1KUX A;  4ZBG A;  3RYO A;  1P4N A;  4G1P A;  3KR4 A;  4P45 A;  1TKH A;  3DLJ A;  2EO8 A;  2OH1 A;  3LMS A;  2VXK A;  2R1I A;  3KL9 A;  3BHX A;  4DUK A;  1ON0 A;  4EWT A;  1IGB A;  2B5G B;  3NH5 A;  4BIN A;  5KTA A;  2BCO A;  4UCP A;  4O23 A;  1B6B A;  3UY5 A;  5EMI A;  3GYA A;  2FIA A;  3EFA A;  3CT9 A;  4FUU A;  5LRJ A;  1Z8L A;  3PB8 X;  1XE4 A;  2CXA A;  3RBU A;  3W6X A;  5JM6 A;  1PU9 A;  4B5P A;  5I4M A;  4A33 A;  4PXE A;  4A38 A;  3KAS A;  4QC6 A;  5JGF A;  4XNH B;  4UFW A;  1Y0Y A;  3KQX A;  4Y49 C;  3VWE A;  5IV0 A;  3DDD A;  5J8C A;  4ZGY B;  4UEZ A;  5D29 A;  2B4D B;  4P4E A;  1J4J A;  4MHY A;  3K9U A;  4X2T A;  4KSF A;  2AFS A;  4B14 A;  4MFJ A;  2FVG A;  2JBK A;  2RC4 A;  4RS2 A;  3SI2 A;  2PJ5 A;  4OP4 A;  2F8H A;  4MI4 A;  4UEF A;  4RI1 A;  3D3S A;  3IIB A;  3CXP A;  4KOV A;  4CYQ A;  3D4U A;  5G1Z A;  5F46 A;  4A95 A;  3QAY A;  3TOB A;  2B3U A;  5THW A;  1Q7L A;  1YR0 A;  5IB0 A;  2JEW A;  2AFX A;  4UCN A;  2P0W A;  5AG4 A;  4MFL A;  1IID A;  2CY2 A;  3FRM A;  3H5Z A;  3SJF A;  4NGS A;  2D4P A;  4PSX A;  2PR8 A;  2Q4Z A;  4YU9 A;  4AG7 A;  4NGP A;  2JDC A;  3R95 A;  4GM5 A;  5HVH A;  3N5F A;  3TFY A;  4M3S A;  3TCV A;  3S9L A;  3D7H A;  4UEE A;  5DWN A;  4MXU A;  4KOS A;  2GFQ A;  4PXD A;  3ZZI A;  3PB6 X;  4OC5 A;  1ELM P;  3IWE A;  3JUW A;  3R96 A;  5K8N A;  1RTQ A;  4ZX8 A;  5F47 A;  4EME A;  4RUH A;  2JLM A;  2HB6 A;  2K5T A;  4CYO A;  1Q2Y A;  2HQY A;  5HVG A;  3FH4 A;  1L0C A;  4M85 A;  3RZA A;  3WC7 A;  2VEZ A;  4GXH A;  4MY3 A;  2PJ1 A;  5K8O A;  4CYP A;  1ZLI A;  4AVA A;  4JLY A;  5HVF A;  2FXF A;  1MJ9 A;  2WSA A;  3B8G A;  3R9G A;  3H8F A;  4C2X A;  4MMO A;  2OZG A;  3LAC A;  2VBQ A;  4OAD A;  4NGT A;  3PB9 X;  2Z3K A;  5LYF A;  3RAM A;  2EBJ A;  3W91 A;  2HUZ A;  4QB9 A;  4A2Z A;  1DTD A;  2PJB A;  1I12 A;  2AE6 A;  1VHE A;  2J8R A;  2Z3O A;  3TC8 A;  3TE4 A;  1KZF A;  1Y7E A;  1RXT A;  3KGQ A;  1F57 A;  4PK3 A;  2ZED A;  1Z5R A;  3VWD A;  4U9Y A;  2FE7 A;  3NE7 A;  5CNP A;  4UCM A;  2X7B A;  3GUX A;  3LWU A;  4F0Y A;  2AFZ A;  3H4Q A;  3F0A A;  1IYL A;  4R87 A;  4C2Z A;  4FBE A;  3KHZ A;  4KOT A;  4NGQ A;  1UWY A;  3D7F A;  4LX9 A;  3FBU A;  8CPA A;  1S60 A;  5LYD A;  4E8O A;  3G3S A;  3D2P A;  5HMN A;  4B12 A;  2B4B A;  1QSM A;  1XMT A;  4HNX B;  4PQA A;  2CNM A;  2OR4 A;  6CPA A;  3IWG A;  2F5I A;  3G8W A;  4B13 A;  1F2O A; 
#chains in the Genus database with same CATH homology
 4KOX A;  1GHE A;  4KOR A;  5A28 A;  2P6F A;  1M1D A;  5E96 A;  2Z3N A;  4MFP A;  3DR6 A;  2PQ8 A;  4MFZ A;  2B58 A;  5AGE A;  4Y49 B;  3WR7 A;  1Q2C A;  4HNY B;  3V8I A;  4J3G A;  1VHS A;  4FD6 A;  5AG5 A;  4YFJ A;  1YVK A;  3BLN A;  1VKC A;  4KOU A;  2NMT A;  4R3L A;  1Y9W A;  4K30 A;  1S7F A;  2ZPA A;  1YGH A;  3S6H A;  4JXR A;  4AG9 A;  1Z9U A;  1M4G A;  4U9Z A;  2P6G A;  1I21 A;  4CS0 B;  2OZU A;  4C7H A;  2C27 A;  4Q36 A;  4HNW B;  4KOY A;  2J8N A;  1CJW A;  3S6F A;  4MFK A;  2BEI A;  4F6A A;  4UWJ A;  1Z4R A;  2PDO A;  5GCN A;  4U5Y A;  1ZO0 A;  4KVM E;  5EC4 A;  1RO5 A;  2Z3L A;  3I9S A;  2AJ6 A;  1WWZ A;  2Y0M A;  4NEX A;  1M4I A;  1K4J A;  3I3G A;  5H86 A;  4E0A A;  4CAX A;  1YRE A;  1R57 A;  3FXT A;  4CGM A;  2PC1 A;  2YNE A;  3IU1 A;  4I49 A;  4ONU A;  1KUY A;  2G3T A;  1TIQ A;  4UWI A;  3S6K A;  1QSO A;  2G0B A;  2Q4Y A;  2FL4 A;  5JPH A;  3EY5 A;  5C88 A;  5HH1 A;  5BWA B;  3EO4 A;  2VI7 A;  3TO6 A;  2QML A;  4H6Z A;  1S5K A;  5ISV A;  2DPS A;  3TTH A;  2B3V A;  3IGR A;  1YX0 A;  2BSW A;  4OAE A;  2ZW6 A;  4L8A A;  4NXY A;  3ZJ0 A;  3BJ8 A;  1YVO A;  3CXQ A;  5A27 A;  4E2A A;  4FD4 A;  2OZH A;  3A9L A;  3S6G A;  1M44 A;  4CGN A;  4R57 A;  2CNS A;  4CGO A;  2REE A;  1P0H A;  1MK4 A;  2R7H A;  3P2F A;  2JDD A;  3SHP A;  4GS4 A;  5C82 A;  1NMT A;  5KTC A;  4YRH A;  2ARH A;  4B10 A;  4KUB A;  4UBR A;  1QSR A;  2P6E A;  4QVT A;  4KOW A;  4XPD B;  4CRZ B;  4MFQ A;  4ORF A;  5KTD A;  5AG7 A;  1B87 A;  5F49 A;  2YNC A;  4XPK A;  3BJ7 A;  1PUA A;  2Q7B A;  2Z10 A;  4A30 A;  1S7L A;  5H84 A;  2B5G A;  3LD2 A;  3N7Z A;  3T90 A;  4PSW A;  3R9E A;  3F5B A;  1NE9 A;  5JQ4 A;  4CAV A;  3E0K A;  4MHD A;  2O28 A;  4C7I A;  4KUA A;  4QUS A;  3DSB A;  4KSA A;  2FSR A;  3LOD A;  3D2M A;  2GE3 A;  4BBH A;  4FD7 A;  4KS9 A;  4CGP A;  3EXN A;  3TO9 A;  1M4D A;  4JWP A;  1I1D A;  1KUV A;  4NSQ A;  2J8M A;  3QB8 A;  4UA3 A;  2IL4 A;  1YK3 A;  2H5M A;  2QIR A;  4A31 A;  2R98 A;  2GIV A;  1S3Z A;  5G21 A;  2FIW A;  2G3A A;  4JD6 A;  2WPW A;  1OZP A;  3EC4 A;  2ZXV A;  4BMH A;  4B5O A;  3TOA A;  3FYN A;  4H89 A;  2Z0Z A;  3R1K A;  4MJ8 A;  4CRY B;  1LRZ A;  4CYN A;  3MGD A;  4KVO E;  1MJB A;  4CAE A;  2I79 A;  2R8V A;  3CXS A;  3W6S A;  5FVJ A;  1N71 A;  1IIC A;  4F0X A;  2DPT A;  2FS5 A;  1SQH A;  1Z4E A;  1FY7 A;  3GY9 A;  3PZJ A;  4JJX A;  4UFX A;  3R9F A;  4B11 A;  1QST A;  2D4O A;  2FCK A;  2PRB A;  2Q04 A;  4IUS A;  2YNC C;  4QC6 A;  2REF A;  4X5K A;  4AVB A;  4MY0 A;  4R3K A;  4FD5 A;  3SXN A;  4CAF A;  4CGL A;  5G20 A;  2GAN A;  3DR8 A;  1V0C A;  1UFH A;  3PGP A;  4JXQ A;  4DNC A;  4KZT A;  1Q2D A;  4KVX A;  3T9Y A;  5I0C A;  2QEC A;  3GKR A;  4H6U A;  2JEV A;  3PP9 A;  4L89 A;  2VZZ A;  4C68 A;  3D8P A;  3JVN A;  2PR1 A;  4MBU A;  4NCZ A;  5J8F A;  5IX3 A;  4LUA A;  2DXQ A;  2FT0 A;  1BOB A;  3IU2 A;  3KKW A;  2KCW A;  4II9 A;  2Q44 A;  3P2H A;  1IYK A;  4Q38 A;  2VZY A;  1XEB A;  1XIX A;  1WK4 A;  3TO7 A;  1MJA A;  3C26 A;  1NSL A;  2ZW4 A;  2YND A;  5AG6 A;  4XPL A;  2PSW A;  2BL1 A;  1YLE A;  4XPD C;  5F48 A;  2EUI A;  3JTK A;  4C2Y A;  5EBV A;  2Z3M A;  1Y7R A;  1QSN A;  3FB3 A;  2BUE A;  2A4N A;  2WUU A;  2OB0 A;  4KLW A;  1IB1 E;  2EVN A;  4XNH C;  4EVY A;  1U6M A;  3SXO A;  4QBJ A;  4HKF A;  3DNS A;  4NF1 A;  4KLV A;  5G22 A;  2CNT A;  4R9M A;  2VQY A;  2B4D A;  2Q0Y A;  3F8K A;  4AB7 A;  1BO4 A;  4OLL A;  2ZW5 A;  1S7N A;  4AVC A;  4A32 A;  1XF8 A;  4UFV A;  3QAH A;  2Q4V A;  1Y9K A;  4IF5 A;  4CAW A;  3FNC A;  2OU2 A;  2HV2 A;  4B5P B;  2WPX A;  4PK2 A;  2ZW7 A;  2I00 A;  2Z3P A;  1CM0 A;  2YGW A;  3TT2 A;  1S7K A;  5DWM A;  4PV6 A;  2Z11 A;  3FIX A;  2ATR A;  4YGO A;  3OWC A;  1KUX A;  4ZBG A;  3RYO A;  1P4N A;  2OH1 A;  2VXK A;  2R1I A;  1ON0 A;  2B5G B;  5KTA A;  4UCP A;  3UY5 A;  1B6B A;  3GYA A;  2FIA A;  3EFA A;  1XE4 A;  2CXA A;  3W6X A;  1PU9 A;  4B5P A;  4A33 A;  4XNH B;  4UFW A;  3VWE A;  4Y49 C;  5IV0 A;  3DDD A;  5J8C A;  4ZGY B;  2B4D B;  1J4J A;  3K9U A;  4KSF A;  4B14 A;  4MFJ A;  2RC4 A;  4RS2 A;  4MI4 A;  4RI1 A;  3D3S A;  4KOV A;  3CXP A;  4CYQ A;  5G1Z A;  5F46 A;  4A95 A;  3TOB A;  2B3U A;  1YR0 A;  5IB0 A;  4UCN A;  2P0W A;  5AG4 A;  4MFL A;  1IID A;  2CY2 A;  3FRM A;  3H5Z A;  2D4P A;  4PSX A;  2PR8 A;  4AG7 A;  2JDC A;  3R95 A;  3TFY A;  4M3S A;  3TCV A;  5DWN A;  4KOS A;  3ZZI A;  3R96 A;  3IWE A;  3JUW A;  5F47 A;  2JLM A;  2K5T A;  4CYO A;  1Q2Y A;  2HQY A;  1L0C A;  4M85 A;  2VEZ A;  4MY3 A;  4CYP A;  4AVA A;  4JLY A;  2FXF A;  1MJ9 A;  2WSA A;  3B8G A;  3R9G A;  4C2X A;  4OAD A;  2OZG A;  2VBQ A;  2Z3K A;  3W91 A;  2HUZ A;  4QB9 A;  4A2Z A;  1I12 A;  2AE6 A;  2J8R A;  2Z3O A;  3TE4 A;  1KZF A;  1RXT A;  4PK3 A;  3VWD A;  4U9Y A;  2FE7 A;  3NE7 A;  5CNP A;  4UCM A;  2X7B A;  4F0Y A;  3H4Q A;  3F0A A;  1IYL A;  4R87 A;  4C2Z A;  4KOT A;  4LX9 A;  3FBU A;  1S60 A;  4E8O A;  3G3S A;  3D2P A;  5HMN A;  4B12 A;  2B4B A;  1QSM A;  4HNX B;  1XMT A;  2CNM A;  3IWG A;  2F5I A;  3G8W A;  4B13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...