1IIDA

Crystal structure of saccharomyces cerevisiae n-myristoyltransferase with bound s-(2-oxo)pentadecylcoa and the octapeptide glyaskla
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
422
structure length
422
Chain Sequence
AMKDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide N-myristoyltransferase
publication title Structures of Saccharomyces cerevisiae N-myristoyltransferase with bound myristoylCoA and peptide provide insights about substrate recognition and catalysis.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 115
structure length 422
sequence length 422
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2001-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iidA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iidA02
1KZFA 1S60A 3SHPA 3TOAA 1OZPA 5J8CA 1NMTA 5KTCA 2EVNA 1NSLA 1M1DA 5CNPA 4UBRA 3TOBA 3JVNA 4E8OA 2JEVA 4JD6A 2Z0ZA 2VZZA 4KOXA 2WPXA 2D4OA 2Q44A 4JJXA 2RC4A 3I9SA 4DNCA 4XPDC 4IF5A 4MBUA 3TO7A 2J8NA 4ZBGA 4AB7A 4B5PA 2B5GA 3CXPA 1XEBA 2PQ8A 1YVOA 4LUAA 1WWZA 1YK3A 5F46A 1V0CA 4XPKA 1KUYA 2B4DB 4U5YA 1XF8A 5GCNA 4HKFA 4OADA 1PUAA 1Z4RA 4F6AA 5JQ4A 1K4JA 2Q0YA 2FE7A 2BEIA 3B8GA 2Q4YA 5EC4A 3ZJ0A 1M4GA 3N7ZA 3T90A 2NMTA 3FNCA 3MGDA 3GY9A 1P4NA 2OU2A 3FXTA 2VXKA 2QMLA 4Y49B 3EC4A 3S6GA 1I21A 5J8FA 4M85A 3TO6A 2REEA 3NE7A 4JXRA 1XIXA 2PC1A 4J3GA 4QVTA 2PR8A 4II9A 2R1IA 4PSWA 2OZUA 4QB9A 1B87A 2OH1A 2FIWA 3CXSA 2VEZA 4U9ZA 3WR7A 2Z11A 1SQHA 4QUSA 4RS2A 2GE3A 5C88A 4CS0B 5F48A 3S6KA 4KOVA 1S7NA 4YRHA 2QECA 5EBVA 2HQYA 4PK2A 4KLVA 2JDDA 1RXTA 4NSQA 4R3LA 2P6FA 4XPLA 4MJ8A 2B4DA 2BUEA 1Y9KA 3PGPA 4Y49C 1S7KA 3IGRA 1IB1E 2VZYA 1L0CA 1S7LA 1Q2YA 4RI1A 5DWNA 3PP9A 4KOTA 4KUAA 1KUVA 4GS4A 4FD4A 1RO5A 1YLEA 3R9FA 2ZPAA 4MY3A 5E96A 1MJAA 2BL1A 3R95A 3GKRA 1IIDA 1YVKA 1J4JA 2VQYA 3EXNA 3E0KA 4H6UA 2JDCA 2C27A 4R57A 4UWJA 2CY2A 2ARHA 2R98A 4NF1A 1IYLA 1ON0A 3H4QA 4JLYA 3BJ8A 3KKWA 3PZJA 1TIQA 2P6EA 1S3ZA 3D2PA 1Q2DA 4KUBA 5KTDA 4IUSA 4HNYB 3FIXA 1M44A 4UA3A 3T9YA 3F8KA 3R1KA 4CRZB 3CXQA 4K30A 2ZW6A 2FXFA 4YFJA 3SXNA 4CAWA 1IICA 3TE4A 1QSNA 5DWMA 2FSRA 2HUZA 4L8AA 1I1DA 1B6BA 3V8IA 4YGOA 2H5MA 4H89A 4F0YA 2CNSA 2OZHA 3W91A 4FD5A 4AG7A 4AVBA 3P2HA 1YGHA 2R7HA 2BSWA 2JLMA 4B5OA 3DDDA 3LODA 3ZZIA 4XNHB 3DNSA 3TFYA 1YR0A 2G3AA 2Y0MA 4NXYA 3D2MA 1M4DA 3TCVA 4NCZA 5JPHA 5KTAA 1S5KA 4KORA 1XMTA 2VBQA 1IYKA 4PV6A 3DR6A 2J8RA 4I49A 1S7FA 1VHSA 2B3VA 1KUXA 2FL4A 4KZTA 2FS5A 3DSBA 3S6FA 4EVYA 3TT2A 3RYOA 5HH1A 4ONUA 3D3SA 2OB0A 2J8MA 2G0BA 2KCWA 1XE4A 4KVME 4KLWA 4FD7A 2FIAA 2B3UA 4JWPA 2QIRA 1M4IA 4HNWB 1P0HA 3P2FA 4E0AA 4XNHC 4OAEA 5H86A 1UFHA 4XPDB 1NE9A 2G3TA 3BJ7A 5HMNA 4QBJA 4U9YA 5IV0A 3D8PA 3SXOA 2Z10A 4CRYB 3EO4A 4L89A 2B4BA 1FY7A 3EY5A 2EUIA 4AVCA 2Q4VA 3W6SA 2HV2A 2O28A 5F47A 1MJ9A 1BO4A 5IB0A 1VKCA 3R9GA 2CNMA 4FD6A 3GYAA 2PR1A 3QB8A 5C82A 2IL4A 2AJ6A 3R9EA 2ZW5A 2VI7A 4CAVA 4NEXA 3R96A 2PRBA 2CNTA 3F5BA 3EFAA 1LRZA 1YX0A 4ORFA 4CAXA 4KOSA 2X7BA 2I00A 1Q2CA 3VWDA 1MJBA 4PSXA 3TTHA 1PU9A 2WPWA 3FBUA 2DXQA 2I79A 3DR8A 4MY0A 5F49A 1QSTA 4AG9A 2ATRA 3C26A 3LD2A 2B58A 3QAHA 5ISVA 3I3GA 3TO9A 4R3KA 2OZGA 4KOUA 4AVAA 4OLLA 2Q7BA 2GANA 2ZW7A 4M3SA 2R8VA 4HNXB 4R87A 1I12A 4MHDA 1U6MA 3IWGA 1BOBA 5IX3A 2AE6A 4UWIA 3S6HA 1Y9WA 3FYNA 1Z9UA 2REFA 4JXQA 4MI4A 1R57A 4KVXA 2PDOA 2PSWA 4QC6A 2F5IA 3K9UA 2Q04A 1QSOA 2A4NA 2K5TA 2P6GA 4B5PB 2B5GB 1N71A 2GIVA 3FRMA 3VWEA 1GHEA 1QSRA 2ZW4A 1CJWA 5H84A 5I0CA 3G8WA 2ZXVA 4LX9A 3JUWA 3FB3A 4E2AA 4X5KA 2FT0A 3G3SA 1Y7RA 4KVOE 2FCKA 4KOYA 2P0WA 1YREA 1Z4EA 3UY5A 5FVJA 1WK4A 2D4PA 4KOWA 3BLNA 4R9MA 3W6XA 4H6ZA 4PK3A 1MK4A 1CM0A 1QSMA 3OWCA 4BMHA 3F0AA
chains in the Genus database with same CATH superfamily
3FJUA 1KZFA 2WSAA 5AGEA 1S60A 3SHPA 3RNZA 3TOAA 1OZPA 5J8CA 1Y0RA 1NMTA 4KS9A 5KTCA 2EVNA 2PJ4A 5DS0A 4MFKA 3KASA 2PJ5A 1NSLA 1AUGA 1M1DA 1QMUA 1KWMA 5CNPA 4UBRA 2CXAA 2HC9A 4WWVA 3TOBA 4OC3A 3PB7X 5CBMA 3JVNA 4BBHA 5A27A 4E8OA 2JEVA 4JD6A 2Z0ZA 3NE8A 2VZZA 4HPSA 4KOXA 2WPXA 2D4OA 2VL1A 2YNCA 2Q44A 2QVPA 4JJXA 2RC4A 3I9SA 4DNCA 4XPDC 4IF5A 2G9DA 4MBUA 3TO7A 2J8NA 4ZBGA 4AB7A 1IU8A 4B5PA 2B5GA 3CXPA 4UEEA 1XOVA 3FVLA 1XEBA 2PQ8A 4CAEA 1YVOA 5G20A 4LUAA 1WWZA 1YK3A 5F46A 2PE3A 1V0CA 4XPKA 1KUYA 2B4DB 5JM6A 3BXMA 3DLJA 4U5YA 1XF8A 3NFZA 5GCNA 3KHZA 4HKFA 4MFPA 3B3WA 4OADA 1PUAA 1Z4RA 4ZY0A 3IEHA 4F6AA 3KI9A 4PQAA 1TF9A 5JQ4A 1K4JA 1HEEA 2Q0YA 2FE7A 2POKA 2BEIA 5HVFA 3FEDA 3B8GA 4MCRA 5AG5A 4ZI6A 2AFOA 4C2XA 2Q4YA 5EC4A 2YGWA 4Q38A 3ZJ0A 4CYPA 1M4GA 4A39A 3N7ZA 3T90A 2NMTA 2EO8A 3FNCA 3MGDA 4IK2A 1BPMA 4ZYQA 3GY9A 3FX6A 4ZX9A 1P4NA 2OU2A 3FXTA 2DPTA 2QMLA 2VXKA 2Z3NA 4Y49B 3EC4A 3S6GA 5HVHA 4MHZA 2GLJA 1Z8TA 1X12A 1I21A 1Z8LA 4MCSA 5AG7A 5J8FA 4M85A 4R8FA 5HVGA 3TO6A 5LRJA 4UFWA 5AG6A 3S9LA 2REEA 3PFOA 3NE7A 1HDQA 1CP6A 2Z3KA 4NGSA 4JXRA 3WT4A 1ZG9A 1XIXA 2PC1A 4J3GA 4QVTA 4TWEA 2PR8A 2BCOA 2ZEDA 2R1IA 4PSWA 4II9A 2OZUA 4QB9A 1B87A 2OH1A 2FIWA 3PBEA 3CXSA 2VEZA 4X2TA 4U9ZA 3WR7A 4MHYA 2Z11A 3PBBA 1SQHA 2AFXA 3B3CA 4QUSA 4RS2A 4DJLA 4DYOA 3QNVA 2GE3A 2CTBA 3ISZA 3LACA 2XEGA 4CGMA 5C88A 4WJBA 5F48A 4CS0B 2BOAA 3S6KA 4KOVA 1S7NA 4YRHA 2PJ1A 2QECA 5EBVA 2HQYA 4PK2A 4KLVA 2V8VA 2GU2A 4NGPA 4YU9A 4NGTA 2HB6A 2QYVA 3JTKA 3FEEA 2JDDA 1RXTA 3PB4X 3B7IA 3PRTA 4NSQA 3K9TA 1R43A 2P6FA 3KR5A 4R3LA 1YSJA 4XPLA 4MJ8A 1JQGA 2B4DA 2BUEA 3D68A 1Y9KA 3PGPA 4Y49C 1S7KA 3IGRA 4OC0A 3IWWA 2Q7SA 4FWUA 1IB1E 2V8HA 2VZYA 1L0CA 1Z2LA 1M4LA 3MRUA 1S7LA 1Q2YA 4RI1A 3KZWA 5DWNA 3PP9A 4KOTA 4KUAA 1KUVA 1GYTA 4GS4A 2J9AA 5ELYA 4FD4A 5I4MA 1RO5A 1YLEA 2JEWA 3KHXA 3R9FA 1RTQA 2ZPAA 4MY3A 5E96A 1MJAA 5K8NA 2OOTA 5LYDA 4P4BA 2YNCC 2Z3MA 2AFWA 2BL1A 3R95A 3GKRA 2ZOFA 1CPXA 1IIDA 1YVKA 4F9VA 1J4JA 2VQYA 1ARLA 5LYIA 3EXNA 3CPXA 1AMPA 1IY7A 3E0KA 1EE3P 2JDCA 4H6UA 4NGQA 2C27A 4P6YA 4R57A 4UWJA 1YLOA 1F2PA 2CY2A 2ARHA 2R98A 3B3TA 4NF1A 1IOIA 1IYLA 3FF3A 3H8EA 5LRGA 4DUKA 1ON0A 3H4QA 4JLYA 3BJ8A 3KKWA 4KSIA 3SJXA 1TF8A 1UWYA 1VGYA 2ZOGA 5A28A 1YW6A 4B13A 3H8GA 3PZJA 1TIQA 2P6EA 2ZEHA 1H8LA 1S3ZA 2XEFA 2GREA 2ZEGA 3PB9X 1AYEA 3D2PA 1Q2DA 4P44A 3RBUA 2DF5A 2ODFA 2YNEA 4KUBA 2RFHA 4IUSA 5KTDA 5LYLA 3D7FA 1PCAA 3KQZA 4HNYB 4UF4A 5D29A 3FIXA 3H8FA 1OBRA 2O53A 1ELMP 2C6GA 4R7MA 5THWA 5G1ZA 4F0XA 2PJAA 1ZO0A 4IHMA 2PVWA 5F09A 3IWEA 1M44A 4ZX8A 4UA3A 3T9YA 4AXVA 3F8KA 3R1KA 4ONWA 2AFSA 1XBUA 8CPAA 4CRZB 4OC2A 2C6CA 4BD9A 4P4JA 1YW4A 4M6IA 3CXQA 4K30A 4NJQA 2ZW6A 3B3SA 5K8MA 2WUUA 2FXFA 1F57A 2EK9A 2PJ7A 1VHEA 4TNUA 1PYTB 3PB6X 3K2KA 5CPAA 4YFJA 3IU1A 3NH5A 3SXNA 4CAWA 4CGPA 1IICA 3TE4A 2CIJA 4GXHA 4A30A 1TXRA 1QSNA 5DWMA 5BWAB 2FSRA 2HUZA 1YMEA 5G21A 1ZLHA 4L8AA 1I1DA 1ARMA 4KSAA 2DPSA 1B6BA 4P4FA 1ZG8A 2H5MA 4H89A 4YGOA 3V8IA 1BLLE 4UIBA 4F0YA 5D8NA 4IAVA 2CNSA 2JBJA 1CG2A 2GFQA 4A94A 2OZHA 1CPSA 2PJBA 3W91A 4FD5A 4PPZA 4AG7A 4AVBA 4RN7A 4C7HA 2IJZA 2EK8A 1Z8WA 1BAVA 5JH9A 4C68A 3P2HA 3A9LA 5G22A 2EWBA 4ZGYB 2NYQA 4G1PA 3D7HA 4OKOA 4A32A 1YGHA 1TKHA 2R7HA 4OIWA 1XJOA 2BSWA 2JLMA 2ANPA 3S9MA 4B5OA 4B12A 3DDDA 3LODA 3ZZIA 4A2ZA 2AFMA 1ZG7A 2ZEEA 3D4UA 4MHPA 4OC5A 2PJCA 2V8GA 1YQEA 3V38A 4XNHB 2RB7A 3DNSA 4ZY1A 3TFYA 1YR0A 1BPNA 3CZXA 3IJ3A 2PIZA 2G3AA 4H2KA 4CAFA 2Y0MA 1VHOA 2ZEPA 3NH8A 4OC4A 4NXYA 3RZAA 5JGFA 3D2MA 2V8DA 1M4DA 3TCVA 4CYNA 1FT7A 4NCZA 5JPHA 2PCUA 3H5ZA 5KTAA 1S5KA 4KORA 1XMTA 1IOFA 3LMSA 4UEZA 2VBQA 3CT9A 1IYKA 4PV6A 3DR6A 3HLPA 2J8RA 4MFJA 4I49A 4PXBA 1S7FA 1VHSA 2B3VA 4UIAA 4Z65A 5IB9A 1KUXA 2FL4A 1LFWA 3JRUA 4KZTA 2FS5A 3DSBA 3S6FA 4EVYA 3TT2A 3RYOA 4MFLA 4ONUA 3D3SA 5HH1A 2OB0A 4CPAA 2J8MA 1R3NA 2G0BA 3SI2A 2KCWA 1XE4A 3PB8X 4KVME 4KLWA 4F9UA 4UFVA 3BI0A 3PFEA 1CBXA 4FD7A 2FIAA 5K8OA 4P10A 2PJ3A 4JZ0A 2NSMA 3IFEA 4W9YA 3I1UA 2WYRA 2B3UA 4JWPA 2QIRA 1M4IA 4X3RA 4OMEA 4FBEA 4HNWB 1P0HA 3P2FA 4E0AA 3D7DA 3GLJA 3QAYA 1Z5RA 4XNHC 4OAEA 2PJ2A 4UCPA 5H86A 2PJ0A 1UFHA 4XPDB 2CF4A 1NE9A 2IQ6A 4FUUA 2G3TA 2I3CA 4MXUA 3BJ7A 5HMNA 4OP4A 4QBJA 3KGQA 4U9YA 2ZEOA 5IV0A 3D8PA 4CGNA 3SXOA 3LWUA 2Z10A 4CRYB 1Z8XA 3TX8A 3EO4A 4L89A 2XEIA 3GB0A 2B4BA 3RO0A 1FY7A 3EY5A 3WC6A 2EUIA 3SI0A 4AVCA 2Q4VA 1Y0YA 3W6SA 2HV2A 2Z3LA 2O28A 5F47A 2PJ9A 1MJ9A 3FMCA 1BO4A 2F8HA 4A37A 4EWTA 5IB0A 3D7GA 3PEIA 1VKCA 3R9GA 2ZELA 4RUHA 2CNMA 4FD6A 3KQXA 4A31A 3BI1A 3GYAA 1CP7A 4FAIA 2Z3PA 2PR1A 4A95A 3QB8A 1QQ9A 5C82A 2IL4A 2O4HA 2WZNA 4MRIA 4MFQA 3T8WA 3VARA 4NGRA 3VH9A 1TKJA 2AJ6A 3NA6A 3R9EA 2EBJA 1JWQA 2ZW5A 3ISXA 3WC7A 1ZLIA 2VI7A 4OC1A 1XFOA 5EMIA 3D67A 4OIDA 1IGBA 4CAVA 3IIBA 4PXDA 4YWYA 2PVVA 3V7ZA 3IC1A 1NSAA 4NEXA 3R96A 2PRBA 2CNTA 2ZEFA 4CGOA 3KR4A 2Z3OA 3F5BA 3EFAA 1F2OA 4A38A 3DGVA 1LRZA 2Q4ZA 1YX0A 4LQ6A 4CGLA 4X8IA 4ORFA 4CAXA 3L2NA 4NGMA 4KOSA 2X7BA 4MCPA 2I00A 1Q7LA 1Q2CA 1Y7EA 3VWDA 4O23A 1MJBA 4PSXA 3TTHA 1PU9A 2WPWA 3FBUA 4CYQA 2DXQA 2I79A 3DR8A 4MY0A 1LAMA 1DE4C 5F49A 2PIYA 3D66A 1LAPA 1QSTA 2PRQA 2BO9A 4B6ZA 4AG9A 1A2ZA 4R6TA 1LANA 3HUVA 3CPAA 3SI1A 4C7IA 2C6PA 3B2YA 2ATRA 3C26A 3B35A 4A33A 4EMEA 3CDXA 3LD2A 2B58A 3QAHA 4C2YA 4CYOA 2V77A 5ISVA 3I3GA 3TO9A 4MHNA 4R3KA 5LYFA 2OZGA 1HDUA 2PJ6A 2FVGA 4KOUA 4AVAA 7CPAA 5J1QA 4OLLA 2Q7BA 2F7VA 2GANA 4P4EA 4M6GA 2Q43A 2ZW7A 4M3SA 1LOKA 4ZY2A 4NJRA 2R8VA 4HNXB 3IU2A 4R87A 1I12A 4MHDA 1U6MA 4M6HA 3WC5A 3IWGA 1TKFA 4P4DA 1BOBA 5IX3A 2AE6A 3GIUA 4UWIA 3S6HA 3SJFA 1Y9WA 2OR4A 3FYNA 4GM5A 1Z9UA 2REFA 2DEAA 2ZEMA 4JXQA 3IO1A 3VATA 4UCMA 3FECA 4MI4A 1R57A 4KVXA 4B11A 3MN8A 2PDOA 2ABZA 2PSWA 4K3NA 4NFRA 1XRYA 4QC6A 4P4IA 2F5IA 2Q51A 4PXCA 4LQGA 5HXDA 2YNDA 3K9UA 4F8ZA 4B10A 2ZENA 3S9NA 5AG4A 4MFZA 4Q7AA 2Q04A 1QSOA 1DTDA 2A4NA 3SJEA 4BINA 4UCNA 4KSFA 2K5TA 2P6GA 3RAMA 4B5PB 6CPAA 2B5GB 3BHXA 2GLFA 3GUXA 1N71A 2GIVA 3FRMA 3VWEA 1GHEA 1XMBA 4PXEA 1FNOA 1QSRA 2ZW4A 1CJWA 5H84A 5I0CA 3G8WA 4MMOA 2ZXVA 1X10A 5LRKA 3NH4A 3JUWA 4LX9A 1VIXA 4MCQA 3FB3A 4P45A 3SJGA 4E2AA 4X5KA 1ELLP 2FT0A 2C1CA 3G3SA 1Y7RA 4KVOE 2FCKA 3B3VA 4KOYA 2PJ8A 4B14A 2P0WA 1YREA 1Z4EA 3UY5A 5FVJA 1WK4A 2D4PA 2CTCA 3FH4A 4KOWA 2IMOA 2QJ8A 4UFXA 2AFZA 5K8PA 3BLNA 3KL9A 4JYWA 4NGNA 2AFUA 4R76A 4R9MA 3W6XA 1CX8A 2XEJA 4H6ZA 4Q36A 4EFDA 4C2ZA 4PK3A 3TC8A 1MK4A 1CM0A 1QSMA 3N5FA 3OWCA 3WABA 4BMHA 1LCPA 3F0AA 2JBKA 4UEFA
chains in the Genus database with same CATH topology
1KZFA 2WSAA 5AGEA 1S60A 3SHPA 3TOAA 1OZPA 5J8CA 1NMTA 4KS9A 5KTCA 2EVNA 4MFKA 1NSLA 1M1DA 5CNPA 4UBRA 2CXAA 3TOBA 3JVNA 4BBHA 5A27A 4E8OA 2JEVA 4JD6A 2Z0ZA 2VZZA 4KOXA 2WPXA 2D4OA 2YNCA 2Q44A 4JJXA 2RC4A 3I9SA 4DNCA 4XPDC 4IF5A 4MBUA 3TO7A 2J8NA 4ZBGA 4AB7A 4B5PA 2B5GA 3CXPA 1XEBA 2PQ8A 4CAEA 1YVOA 5G20A 4LUAA 1WWZA 1YK3A 5F46A 1V0CA 4XPKA 1KUYA 2B4DB 4U5YA 1XF8A 5GCNA 4HKFA 4MFPA 4OADA 1PUAA 1Z4RA 4F6AA 5JQ4A 1K4JA 2Q0YA 2FE7A 2BEIA 3B8GA 5AG5A 4C2XA 2Q4YA 5EC4A 2YGWA 4Q38A 3ZJ0A 4CYPA 1M4GA 3N7ZA 3T90A 2NMTA 3FNCA 3MGDA 3GY9A 1P4NA 2OU2A 3FXTA 2DPTA 2QMLA 2VXKA 2Z3NA 4Y49B 3EC4A 3S6GA 1I21A 5AG7A 5J8FA 4M85A 3TO6A 4UFWA 5AG6A 2REEA 3NE7A 2Z3KA 4JXRA 1XIXA 2PC1A 4J3GA 4QVTA 2PR8A 4II9A 2R1IA 4PSWA 2OZUA 4QB9A 1B87A 2OH1A 2FIWA 3CXSA 2VEZA 4U9ZA 3WR7A 2Z11A 1SQHA 4QUSA 4RS2A 2GE3A 4CGMA 5C88A 4CS0B 5F48A 3S6KA 4KOVA 1S7NA 4YRHA 2QECA 5EBVA 2HQYA 4PK2A 4KLVA 3JTKA 2JDDA 1RXTA 4NSQA 4R3LA 2P6FA 4XPLA 4MJ8A 2B4DA 2BUEA 1Y9KA 3PGPA 4Y49C 1S7KA 3IGRA 1IB1E 2VZYA 1L0CA 1S7LA 1Q2YA 4RI1A 5DWNA 3PP9A 4KOTA 4KUAA 1KUVA 4GS4A 4FD4A 1RO5A 1YLEA 3R9FA 2ZPAA 4MY3A 5E96A 1MJAA 2YNCC 2Z3MA 2BL1A 3R95A 3GKRA 1IIDA 1YVKA 1J4JA 2VQYA 3EXNA 3E0KA 4H6UA 2JDCA 2C27A 4R57A 4UWJA 2CY2A 2ARHA 2R98A 4NF1A 1IYLA 1ON0A 3H4QA 4JLYA 3BJ8A 3KKWA 5A28A 4B13A 3PZJA 1TIQA 2P6EA 1S3ZA 3D2PA 1Q2DA 4KUBA 5KTDA 2YNEA 4IUSA 4HNYB 3FIXA 5G1ZA 4F0XA 1ZO0A 3IWEA 1M44A 4UA3A 3T9YA 3F8KA 3R1KA 4CRZB 3CXQA 4K30A 2ZW6A 2WUUA 2FXFA 4YFJA 3IU1A 3SXNA 4CAWA 4CGPA 1IICA 3TE4A 4A30A 1QSNA 5DWMA 5BWAB 2FSRA 2HUZA 5G21A 4L8AA 1I1DA 4KSAA 2DPSA 1B6BA 3V8IA 4YGOA 2H5MA 4H89A 4F0YA 2CNSA 2OZHA 3W91A 4FD5A 4AG7A 4AVBA 4C7HA 4C68A 3P2HA 3A9LA 5G22A 4ZGYB 4A32A 1YGHA 2R7HA 2BSWA 2JLMA 4B5OA 4B12A 3DDDA 3LODA 3ZZIA 4A2ZA 4XNHB 3DNSA 3TFYA 1YR0A 2G3AA 4CAFA 2Y0MA 4NXYA 3D2MA 1M4DA 3TCVA 4CYNA 4NCZA 5JPHA 3H5ZA 5KTAA 1S5KA 4KORA 1XMTA 2VBQA 1IYKA 4PV6A 3DR6A 2J8RA 4MFJA 4I49A 1S7FA 1VHSA 2B3VA 1KUXA 2FL4A 4KZTA 2FS5A 3DSBA 3S6FA 4EVYA 3TT2A 3RYOA 4MFLA 4ONUA 3D3SA 5HH1A 2OB0A 2J8MA 2G0BA 2KCWA 1XE4A 4KVME 4KLWA 4UFVA 4FD7A 2FIAA 4JWPA 2B3UA 2QIRA 1M4IA 4HNWB 1P0HA 3P2FA 4E0AA 4XNHC 4OAEA 4UCPA 5H86A 1UFHA 4XPDB 1NE9A 2G3TA 3BJ7A 5HMNA 4QBJA 4U9YA 5IV0A 3D8PA 4CGNA 3SXOA 2Z10A 4CRYB 3EO4A 4L89A 2B4BA 1FY7A 3EY5A 2EUIA 4AVCA 2Q4VA 3W6SA 2HV2A 2Z3LA 2O28A 5F47A 1MJ9A 1BO4A 5IB0A 1VKCA 3R9GA 2CNMA 4FD6A 4A31A 3GYAA 2Z3PA 2PR1A 4A95A 3QB8A 5C82A 2IL4A 4MFQA 2AJ6A 3R9EA 2ZW5A 2VI7A 4CAVA 4NEXA 3R96A 2PRBA 2CNTA 4CGOA 2Z3OA 3F5BA 3EFAA 1LRZA 1YX0A 4CGLA 4ORFA 4CAXA 4KOSA 2X7BA 2I00A 1Q2CA 3VWDA 1MJBA 4PSXA 3TTHA 1PU9A 2WPWA 3FBUA 4CYQA 2DXQA 2I79A 3DR8A 4MY0A 5F49A 1QSTA 4AG9A 4C7IA 2ATRA 3C26A 4A33A 3LD2A 2B58A 3QAHA 4C2YA 4CYOA 5ISVA 3I3GA 3TO9A 4R3KA 2OZGA 4KOUA 4AVAA 4OLLA 2Q7BA 2GANA 2ZW7A 4M3SA 2R8VA 4HNXB 3IU2A 4R87A 1I12A 4MHDA 1U6MA 3IWGA 1BOBA 5IX3A 2AE6A 4UWIA 3S6HA 1Y9WA 3FYNA 1Z9UA 2REFA 4JXQA 4UCMA 4MI4A 1R57A 4KVXA 4B11A 2PDOA 2PSWA 4QC6A 2F5IA 2YNDA 3K9UA 4B10A 5AG4A 4MFZA 2Q04A 1QSOA 2A4NA 4UCNA 4KSFA 2K5TA 2P6GA 4B5PB 2B5GB 1N71A 2GIVA 3FRMA 3VWEA 1GHEA 1QSRA 2ZW4A 1CJWA 5H84A 5I0CA 3G8WA 2ZXVA 4LX9A 3JUWA 3FB3A 4E2AA 4X5KA 2FT0A 3G3SA 1Y7RA 4KVOE 2FCKA 4KOYA 4B14A 2P0WA 1YREA 1Z4EA 3UY5A 5FVJA 1WK4A 2D4PA 4KOWA 4UFXA 3BLNA 4R9MA 3W6XA 4H6ZA 4Q36A 4C2ZA 4PK3A 1MK4A 1CM0A 1QSMA 3OWCA 4BMHA 3F0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZF A;  1S60 A;  3SHP A;  3TOA A;  1OZP A;  5J8C A;  1NMT A;  5KTC A;  2EVN A;  1NSL A;  1M1D A;  5CNP A;  4UBR A;  3TOB A;  3JVN A;  4E8O A;  2JEV A;  4JD6 A;  2Z0Z A;  2VZZ A;  4KOX A;  2WPX A;  2D4O A;  2Q44 A;  4JJX A;  2RC4 A;  3I9S A;  4DNC A;  4XPD C;  4IF5 A;  4MBU A;  3TO7 A;  2J8N A;  4ZBG A;  4AB7 A;  4B5P A;  2B5G A;  3CXP A;  1XEB A;  2PQ8 A;  1YVO A;  4LUA A;  1WWZ A;  1YK3 A;  5F46 A;  1V0C A;  4XPK A;  1KUY A;  2B4D B;  4U5Y A;  1XF8 A;  5GCN A;  4HKF A;  4OAD A;  1PUA A;  1Z4R A;  4F6A A;  5JQ4 A;  1K4J A;  2Q0Y A;  2FE7 A;  2BEI A;  3B8G A;  2Q4Y A;  5EC4 A;  3ZJ0 A;  1M4G A;  3N7Z A;  3T90 A;  2NMT A;  3FNC A;  3MGD A;  3GY9 A;  1P4N A;  2OU2 A;  3FXT A;  2VXK A;  2QML A;  4Y49 B;  3EC4 A;  3S6G A;  1I21 A;  5J8F A;  4M85 A;  3TO6 A;  2REE A;  3NE7 A;  4JXR A;  1XIX A;  2PC1 A;  4J3G A;  4QVT A;  2PR8 A;  4II9 A;  2R1I A;  4PSW A;  2OZU A;  4QB9 A;  1B87 A;  2OH1 A;  2FIW A;  3CXS A;  2VEZ A;  4U9Z A;  3WR7 A;  2Z11 A;  1SQH A;  4QUS A;  4RS2 A;  2GE3 A;  5C88 A;  4CS0 B;  5F48 A;  3S6K A;  4KOV A;  1S7N A;  4YRH A;  2QEC A;  5EBV A;  2HQY A;  4PK2 A;  4KLV A;  2JDD A;  1RXT A;  4NSQ A;  4R3L A;  2P6F A;  4XPL A;  4MJ8 A;  2B4D A;  2BUE A;  1Y9K A;  3PGP A;  4Y49 C;  1S7K A;  3IGR A;  1IB1 E;  2VZY A;  1L0C A;  1S7L A;  1Q2Y A;  4RI1 A;  5DWN A;  3PP9 A;  4KOT A;  4KUA A;  1KUV A;  4GS4 A;  4FD4 A;  1RO5 A;  1YLE A;  3R9F A;  2ZPA A;  4MY3 A;  5E96 A;  1MJA A;  2BL1 A;  3R95 A;  3GKR A;  1IID A;  1YVK A;  1J4J A;  2VQY A;  3EXN A;  3E0K A;  4H6U A;  2JDC A;  2C27 A;  4R57 A;  4UWJ A;  2CY2 A;  2ARH A;  2R98 A;  4NF1 A;  1IYL A;  1ON0 A;  3H4Q A;  4JLY A;  3BJ8 A;  3KKW A;  3PZJ A;  1TIQ A;  2P6E A;  1S3Z A;  3D2P A;  1Q2D A;  4KUB A;  5KTD A;  4IUS A;  4HNY B;  3FIX A;  1M44 A;  4UA3 A;  3T9Y A;  3F8K A;  3R1K A;  4CRZ B;  3CXQ A;  4K30 A;  2ZW6 A;  2FXF A;  4YFJ A;  3SXN A;  4CAW A;  1IIC A;  3TE4 A;  1QSN A;  5DWM A;  2FSR A;  2HUZ A;  4L8A A;  1I1D A;  1B6B A;  3V8I A;  4YGO A;  2H5M A;  4H89 A;  4F0Y A;  2CNS A;  2OZH A;  3W91 A;  4FD5 A;  4AG7 A;  4AVB A;  3P2H A;  1YGH A;  2R7H A;  2BSW A;  2JLM A;  4B5O A;  3DDD A;  3LOD A;  3ZZI A;  4XNH B;  3DNS A;  3TFY A;  1YR0 A;  2G3A A;  2Y0M A;  4NXY A;  3D2M A;  1M4D A;  3TCV A;  4NCZ A;  5JPH A;  5KTA A;  1S5K A;  4KOR A;  1XMT A;  2VBQ A;  1IYK A;  4PV6 A;  3DR6 A;  2J8R A;  4I49 A;  1S7F A;  1VHS A;  2B3V A;  1KUX A;  2FL4 A;  4KZT A;  2FS5 A;  3DSB A;  3S6F A;  4EVY A;  3TT2 A;  3RYO A;  5HH1 A;  4ONU A;  3D3S A;  2OB0 A;  2J8M A;  2G0B A;  2KCW A;  1XE4 A;  4KVM E;  4KLW A;  4FD7 A;  2FIA A;  2B3U A;  4JWP A;  2QIR A;  1M4I A;  4HNW B;  1P0H A;  3P2F A;  4E0A A;  4XNH C;  4OAE A;  5H86 A;  1UFH A;  4XPD B;  1NE9 A;  2G3T A;  3BJ7 A;  5HMN A;  4QBJ A;  4U9Y A;  5IV0 A;  3D8P A;  3SXO A;  2Z10 A;  4CRY B;  3EO4 A;  4L89 A;  2B4B A;  1FY7 A;  3EY5 A;  2EUI A;  4AVC A;  2Q4V A;  3W6S A;  2HV2 A;  2O28 A;  5F47 A;  1MJ9 A;  1BO4 A;  5IB0 A;  1VKC A;  3R9G A;  2CNM A;  4FD6 A;  3GYA A;  2PR1 A;  3QB8 A;  5C82 A;  2IL4 A;  2AJ6 A;  3R9E A;  2ZW5 A;  2VI7 A;  4CAV A;  4NEX A;  3R96 A;  2PRB A;  2CNT A;  3F5B A;  3EFA A;  1LRZ A;  1YX0 A;  4ORF A;  4CAX A;  4KOS A;  2X7B A;  2I00 A;  1Q2C A;  3VWD A;  1MJB A;  4PSX A;  3TTH A;  1PU9 A;  2WPW A;  3FBU A;  2DXQ A;  2I79 A;  3DR8 A;  4MY0 A;  5F49 A;  1QST A;  4AG9 A;  2ATR A;  3C26 A;  3LD2 A;  2B58 A;  3QAH A;  5ISV A;  3I3G A;  3TO9 A;  4R3K A;  2OZG A;  4KOU A;  4AVA A;  4OLL A;  2Q7B A;  2GAN A;  2ZW7 A;  4M3S A;  2R8V A;  4HNX B;  4R87 A;  1I12 A;  4MHD A;  1U6M A;  3IWG A;  1BOB A;  5IX3 A;  2AE6 A;  4UWI A;  3S6H A;  1Y9W A;  3FYN A;  1Z9U A;  2REF A;  4JXQ A;  4MI4 A;  1R57 A;  4KVX A;  2PDO A;  2PSW A;  4QC6 A;  2F5I A;  3K9U A;  2Q04 A;  1QSO A;  2A4N A;  2K5T A;  2P6G A;  4B5P B;  2B5G B;  1N71 A;  2GIV A;  3FRM A;  3VWE A;  1GHE A;  1QSR A;  2ZW4 A;  1CJW A;  5H84 A;  5I0C A;  3G8W A;  2ZXV A;  4LX9 A;  3JUW A;  3FB3 A;  4E2A A;  4X5K A;  2FT0 A;  3G3S A;  1Y7R A;  4KVO E;  2FCK A;  4KOY A;  2P0W A;  1YRE A;  1Z4E A;  3UY5 A;  5FVJ A;  1WK4 A;  2D4P A;  4KOW A;  3BLN A;  4R9M A;  3W6X A;  4H6Z A;  4PK3 A;  1MK4 A;  1CM0 A;  1QSM A;  3OWC A;  4BMH A;  3F0A A; 
#chains in the Genus database with same CATH topology
 3FJU A;  1KZF A;  2WSA A;  5AGE A;  1S60 A;  3SHP A;  3RNZ A;  3TOA A;  1OZP A;  5J8C A;  1Y0R A;  1NMT A;  4KS9 A;  5KTC A;  2EVN A;  2PJ4 A;  5DS0 A;  4MFK A;  3KAS A;  2PJ5 A;  1NSL A;  1AUG A;  1M1D A;  1QMU A;  1KWM A;  5CNP A;  4UBR A;  2CXA A;  2HC9 A;  4WWV A;  3TOB A;  4OC3 A;  3PB7 X;  5CBM A;  3JVN A;  4BBH A;  5A27 A;  4E8O A;  2JEV A;  4JD6 A;  2Z0Z A;  3NE8 A;  2VZZ A;  4HPS A;  4KOX A;  2WPX A;  2D4O A;  2VL1 A;  2YNC A;  2Q44 A;  2QVP A;  4JJX A;  2RC4 A;  3I9S A;  4DNC A;  4XPD C;  4IF5 A;  2G9D A;  4MBU A;  3TO7 A;  2J8N A;  4ZBG A;  4AB7 A;  1IU8 A;  4B5P A;  2B5G A;  3CXP A;  4UEE A;  1XOV A;  3FVL A;  1XEB A;  2PQ8 A;  4CAE A;  1YVO A;  5G20 A;  4LUA A;  1WWZ A;  1YK3 A;  5F46 A;  2PE3 A;  1V0C A;  4XPK A;  1KUY A;  2B4D B;  5JM6 A;  3BXM A;  3DLJ A;  4U5Y A;  1XF8 A;  3NFZ A;  5GCN A;  3KHZ A;  4HKF A;  4MFP A;  3B3W A;  4OAD A;  1PUA A;  1Z4R A;  4ZY0 A;  3IEH A;  4F6A A;  3KI9 A;  4PQA A;  1TF9 A;  5JQ4 A;  1K4J A;  1HEE A;  2Q0Y A;  2FE7 A;  2POK A;  2BEI A;  5HVF A;  3FED A;  3B8G A;  4MCR A;  5AG5 A;  4ZI6 A;  2AFO A;  4C2X A;  2Q4Y A;  5EC4 A;  2YGW A;  4Q38 A;  3ZJ0 A;  4CYP A;  1M4G A;  4A39 A;  3N7Z A;  3T90 A;  2NMT A;  2EO8 A;  3FNC A;  3MGD A;  4IK2 A;  1BPM A;  4ZYQ A;  3GY9 A;  3FX6 A;  4ZX9 A;  1P4N A;  2OU2 A;  3FXT A;  2DPT A;  2QML A;  2VXK A;  2Z3N A;  4Y49 B;  3EC4 A;  3S6G A;  5HVH A;  4MHZ A;  2GLJ A;  1Z8T A;  1X12 A;  1I21 A;  1Z8L A;  4MCS A;  5AG7 A;  5J8F A;  4M85 A;  4R8F A;  5HVG A;  3TO6 A;  5LRJ A;  4UFW A;  5AG6 A;  3S9L A;  2REE A;  3PFO A;  3NE7 A;  1HDQ A;  1CP6 A;  2Z3K A;  4NGS A;  4JXR A;  3WT4 A;  1ZG9 A;  1XIX A;  2PC1 A;  4J3G A;  4QVT A;  4TWE A;  2PR8 A;  2BCO A;  2ZED A;  2R1I A;  4PSW A;  4II9 A;  2OZU A;  4QB9 A;  1B87 A;  2OH1 A;  2FIW A;  3PBE A;  3CXS A;  2VEZ A;  4X2T A;  4U9Z A;  3WR7 A;  4MHY A;  2Z11 A;  3PBB A;  1SQH A;  2AFX A;  3B3C A;  4QUS A;  4RS2 A;  4DJL A;  4DYO A;  3QNV A;  2GE3 A;  2CTB A;  3ISZ A;  3LAC A;  2XEG A;  4CGM A;  5C88 A;  4WJB A;  5F48 A;  4CS0 B;  2BOA A;  3S6K A;  4KOV A;  1S7N A;  4YRH A;  2PJ1 A;  2QEC A;  5EBV A;  2HQY A;  4PK2 A;  4KLV A;  2V8V A;  2GU2 A;  4NGP A;  4YU9 A;  4NGT A;  2HB6 A;  2QYV A;  3JTK A;  3FEE A;  2JDD A;  1RXT A;  3PB4 X;  3B7I A;  3PRT A;  4NSQ A;  3K9T A;  1R43 A;  2P6F A;  3KR5 A;  4R3L A;  1YSJ A;  4XPL A;  4MJ8 A;  1JQG A;  2B4D A;  2BUE A;  3D68 A;  1Y9K A;  3PGP A;  4Y49 C;  1S7K A;  3IGR A;  4OC0 A;  3IWW A;  2Q7S A;  4FWU A;  1IB1 E;  2V8H A;  2VZY A;  1L0C A;  1Z2L A;  1M4L A;  3MRU A;  1S7L A;  1Q2Y A;  4RI1 A;  3KZW A;  5DWN A;  3PP9 A;  4KOT A;  4KUA A;  1KUV A;  1GYT A;  4GS4 A;  2J9A A;  5ELY A;  4FD4 A;  5I4M A;  1RO5 A;  1YLE A;  2JEW A;  3KHX A;  3R9F A;  1RTQ A;  2ZPA A;  4MY3 A;  5E96 A;  1MJA A;  5K8N A;  2OOT A;  5LYD A;  4P4B A;  2YNC C;  2Z3M A;  2AFW A;  2BL1 A;  3R95 A;  3GKR A;  2ZOF A;  1CPX A;  1IID A;  1YVK A;  4F9V A;  1J4J A;  2VQY A;  1ARL A;  5LYI A;  3EXN A;  3CPX A;  1AMP A;  1IY7 A;  3E0K A;  1EE3 P;  2JDC A;  4H6U A;  4NGQ A;  2C27 A;  4P6Y A;  4R57 A;  4UWJ A;  1YLO A;  1F2P A;  2CY2 A;  2ARH A;  2R98 A;  3B3T A;  4NF1 A;  1IOI A;  1IYL A;  3FF3 A;  3H8E A;  5LRG A;  4DUK A;  1ON0 A;  3H4Q A;  4JLY A;  3BJ8 A;  3KKW A;  4KSI A;  3SJX A;  1TF8 A;  1UWY A;  1VGY A;  2ZOG A;  5A28 A;  1YW6 A;  4B13 A;  3H8G A;  3PZJ A;  1TIQ A;  2P6E A;  2ZEH A;  1H8L A;  1S3Z A;  2XEF A;  2GRE A;  2ZEG A;  3PB9 X;  1AYE A;  3D2P A;  1Q2D A;  4P44 A;  3RBU A;  2DF5 A;  2ODF A;  2YNE A;  4KUB A;  2RFH A;  4IUS A;  5KTD A;  5LYL A;  3D7F A;  1PCA A;  3KQZ A;  4HNY B;  4UF4 A;  5D29 A;  3FIX A;  3H8F A;  1OBR A;  2O53 A;  1ELM P;  2C6G A;  4R7M A;  5THW A;  5G1Z A;  4F0X A;  2PJA A;  1ZO0 A;  4IHM A;  2PVW A;  5F09 A;  3IWE A;  1M44 A;  4ZX8 A;  4UA3 A;  3T9Y A;  4AXV A;  3F8K A;  3R1K A;  4ONW A;  2AFS A;  1XBU A;  8CPA A;  4CRZ B;  4OC2 A;  2C6C A;  4BD9 A;  4P4J A;  1YW4 A;  4M6I A;  3CXQ A;  4K30 A;  4NJQ A;  2ZW6 A;  3B3S A;  5K8M A;  2WUU A;  2FXF A;  1F57 A;  2EK9 A;  2PJ7 A;  1VHE A;  4TNU A;  1PYT B;  3PB6 X;  3K2K A;  5CPA A;  4YFJ A;  3IU1 A;  3NH5 A;  3SXN A;  4CAW A;  4CGP A;  1IIC A;  3TE4 A;  2CIJ A;  4GXH A;  4A30 A;  1TXR A;  1QSN A;  5DWM A;  5BWA B;  2FSR A;  2HUZ A;  1YME A;  5G21 A;  1ZLH A;  4L8A A;  1I1D A;  1ARM A;  4KSA A;  2DPS A;  1B6B A;  4P4F A;  1ZG8 A;  2H5M A;  4H89 A;  4YGO A;  3V8I A;  1BLL E;  4UIB A;  4F0Y A;  5D8N A;  4IAV A;  2CNS A;  2JBJ A;  1CG2 A;  2GFQ A;  4A94 A;  2OZH A;  1CPS A;  2PJB A;  3W91 A;  4FD5 A;  4PPZ A;  4AG7 A;  4AVB A;  4RN7 A;  4C7H A;  2IJZ A;  2EK8 A;  1Z8W A;  1BAV A;  5JH9 A;  4C68 A;  3P2H A;  3A9L A;  5G22 A;  2EWB A;  4ZGY B;  2NYQ A;  4G1P A;  3D7H A;  4OKO A;  4A32 A;  1YGH A;  1TKH A;  2R7H A;  4OIW A;  1XJO A;  2BSW A;  2JLM A;  2ANP A;  3S9M A;  4B5O A;  4B12 A;  3DDD A;  3LOD A;  3ZZI A;  4A2Z A;  2AFM A;  1ZG7 A;  2ZEE A;  3D4U A;  4MHP A;  4OC5 A;  2PJC A;  2V8G A;  1YQE A;  3V38 A;  4XNH B;  2RB7 A;  3DNS A;  4ZY1 A;  3TFY A;  1YR0 A;  1BPN A;  3CZX A;  3IJ3 A;  2PIZ A;  2G3A A;  4H2K A;  4CAF A;  2Y0M A;  1VHO A;  2ZEP A;  3NH8 A;  4OC4 A;  4NXY A;  3RZA A;  5JGF A;  3D2M A;  2V8D A;  1M4D A;  3TCV A;  4CYN A;  1FT7 A;  4NCZ A;  5JPH A;  2PCU A;  3H5Z A;  5KTA A;  1S5K A;  4KOR A;  1XMT A;  1IOF A;  3LMS A;  4UEZ A;  2VBQ A;  3CT9 A;  1IYK A;  4PV6 A;  3DR6 A;  3HLP A;  2J8R A;  4MFJ A;  4I49 A;  4PXB A;  1S7F A;  1VHS A;  2B3V A;  4UIA A;  4Z65 A;  5IB9 A;  1KUX A;  2FL4 A;  1LFW A;  3JRU A;  4KZT A;  2FS5 A;  3DSB A;  3S6F A;  4EVY A;  3TT2 A;  3RYO A;  4MFL A;  4ONU A;  3D3S A;  5HH1 A;  2OB0 A;  4CPA A;  2J8M A;  1R3N A;  2G0B A;  3SI2 A;  2KCW A;  1XE4 A;  3PB8 X;  4KVM E;  4KLW A;  4F9U A;  4UFV A;  3BI0 A;  3PFE A;  1CBX A;  4FD7 A;  2FIA A;  5K8O A;  4P10 A;  2PJ3 A;  4JZ0 A;  2NSM A;  3IFE A;  4W9Y A;  3I1U A;  2WYR A;  2B3U A;  4JWP A;  2QIR A;  1M4I A;  4X3R A;  4OME A;  4FBE A;  4HNW B;  1P0H A;  3P2F A;  4E0A A;  3D7D A;  3GLJ A;  3QAY A;  1Z5R A;  4XNH C;  4OAE A;  2PJ2 A;  4UCP A;  5H86 A;  2PJ0 A;  1UFH A;  4XPD B;  2CF4 A;  1NE9 A;  2IQ6 A;  4FUU A;  2G3T A;  2I3C A;  4MXU A;  3BJ7 A;  5HMN A;  4OP4 A;  4QBJ A;  3KGQ A;  4U9Y A;  2ZEO A;  5IV0 A;  3D8P A;  4CGN A;  3SXO A;  3LWU A;  2Z10 A;  4CRY B;  1Z8X A;  3TX8 A;  3EO4 A;  4L89 A;  2XEI A;  3GB0 A;  2B4B A;  3RO0 A;  1FY7 A;  3EY5 A;  3WC6 A;  2EUI A;  3SI0 A;  4AVC A;  2Q4V A;  1Y0Y A;  3W6S A;  2HV2 A;  2Z3L A;  2O28 A;  5F47 A;  2PJ9 A;  1MJ9 A;  3FMC A;  1BO4 A;  2F8H A;  4A37 A;  4EWT A;  5IB0 A;  3D7G A;  3PEI A;  1VKC A;  3R9G A;  2ZEL A;  4RUH A;  2CNM A;  4FD6 A;  3KQX A;  4A31 A;  3BI1 A;  3GYA A;  1CP7 A;  4FAI A;  2Z3P A;  2PR1 A;  4A95 A;  3QB8 A;  1QQ9 A;  5C82 A;  2IL4 A;  2O4H A;  2WZN A;  4MRI A;  4MFQ A;  3T8W A;  3VAR A;  4NGR A;  3VH9 A;  1TKJ A;  2AJ6 A;  3NA6 A;  3R9E A;  2EBJ A;  1JWQ A;  2ZW5 A;  3ISX A;  3WC7 A;  1ZLI A;  2VI7 A;  4OC1 A;  1XFO A;  5EMI A;  3D67 A;  4OID A;  1IGB A;  4CAV A;  3IIB A;  4PXD A;  4YWY A;  2PVV A;  3V7Z A;  3IC1 A;  1NSA A;  4NEX A;  3R96 A;  2PRB A;  2CNT A;  2ZEF A;  4CGO A;  3KR4 A;  2Z3O A;  3F5B A;  3EFA A;  1F2O A;  4A38 A;  3DGV A;  1LRZ A;  2Q4Z A;  1YX0 A;  4LQ6 A;  4CGL A;  4X8I A;  4ORF A;  4CAX A;  3L2N A;  4NGM A;  4KOS A;  2X7B A;  4MCP A;  2I00 A;  1Q7L A;  1Q2C A;  1Y7E A;  3VWD A;  4O23 A;  1MJB A;  4PSX A;  3TTH A;  1PU9 A;  2WPW A;  3FBU A;  4CYQ A;  2DXQ A;  2I79 A;  3DR8 A;  4MY0 A;  1LAM A;  1DE4 C;  5F49 A;  2PIY A;  3D66 A;  1LAP A;  1QST A;  2PRQ A;  2BO9 A;  4B6Z A;  4AG9 A;  1A2Z A;  4R6T A;  1LAN A;  3HUV A;  3CPA A;  3SI1 A;  4C7I A;  2C6P A;  3B2Y A;  2ATR A;  3C26 A;  3B35 A;  4A33 A;  4EME A;  3CDX A;  3LD2 A;  2B58 A;  3QAH A;  4C2Y A;  4CYO A;  2V77 A;  5ISV A;  3I3G A;  3TO9 A;  4MHN A;  4R3K A;  5LYF A;  2OZG A;  1HDU A;  2PJ6 A;  2FVG A;  4KOU A;  4AVA A;  7CPA A;  5J1Q A;  4OLL A;  2Q7B A;  2F7V A;  2GAN A;  4P4E A;  4M6G A;  2Q43 A;  2ZW7 A;  4M3S A;  1LOK A;  4ZY2 A;  4NJR A;  2R8V A;  4HNX B;  3IU2 A;  4R87 A;  1I12 A;  4MHD A;  1U6M A;  4M6H A;  3WC5 A;  3IWG A;  1TKF A;  4P4D A;  1BOB A;  5IX3 A;  2AE6 A;  3GIU A;  4UWI A;  3S6H A;  3SJF A;  1Y9W A;  2OR4 A;  3FYN A;  4GM5 A;  1Z9U A;  2REF A;  2DEA A;  2ZEM A;  4JXQ A;  3IO1 A;  3VAT A;  4UCM A;  3FEC A;  4MI4 A;  1R57 A;  4KVX A;  4B11 A;  3MN8 A;  2PDO A;  2ABZ A;  2PSW A;  4K3N A;  4NFR A;  1XRY A;  4QC6 A;  4P4I A;  2F5I A;  2Q51 A;  4PXC A;  4LQG A;  5HXD A;  2YND A;  3K9U A;  4F8Z A;  4B10 A;  2ZEN A;  3S9N A;  5AG4 A;  4MFZ A;  4Q7A A;  2Q04 A;  1QSO A;  1DTD A;  2A4N A;  3SJE A;  4BIN A;  4UCN A;  4KSF A;  2K5T A;  2P6G A;  3RAM A;  4B5P B;  6CPA A;  2B5G B;  3BHX A;  2GLF A;  3GUX A;  1N71 A;  2GIV A;  3FRM A;  3VWE A;  1GHE A;  1XMB A;  4PXE A;  1FNO A;  1QSR A;  2ZW4 A;  1CJW A;  5H84 A;  5I0C A;  3G8W A;  4MMO A;  2ZXV A;  1X10 A;  5LRK A;  3NH4 A;  3JUW A;  4LX9 A;  1VIX A;  4MCQ A;  3FB3 A;  4P45 A;  3SJG A;  4E2A A;  4X5K A;  1ELL P;  2FT0 A;  2C1C A;  3G3S A;  1Y7R A;  4KVO E;  2FCK A;  3B3V A;  4KOY A;  2PJ8 A;  4B14 A;  2P0W A;  1YRE A;  1Z4E A;  3UY5 A;  5FVJ A;  1WK4 A;  2D4P A;  2CTC A;  3FH4 A;  4KOW A;  2IMO A;  2QJ8 A;  4UFX A;  2AFZ A;  5K8P A;  3BLN A;  3KL9 A;  4JYW A;  4NGN A;  2AFU A;  4R76 A;  4R9M A;  3W6X A;  1CX8 A;  2XEJ A;  4H6Z A;  4Q36 A;  4EFD A;  4C2Z A;  4PK3 A;  3TC8 A;  1MK4 A;  1CM0 A;  1QSM A;  3N5F A;  3OWC A;  3WAB A;  4BMH A;  1LCP A;  3F0A A;  2JBK A;  4UEF A; 
#chains in the Genus database with same CATH homology
 1KZF A;  2WSA A;  5AGE A;  1S60 A;  3SHP A;  3TOA A;  1OZP A;  5J8C A;  1NMT A;  4KS9 A;  5KTC A;  2EVN A;  4MFK A;  1NSL A;  1M1D A;  5CNP A;  4UBR A;  2CXA A;  3TOB A;  3JVN A;  4BBH A;  5A27 A;  4E8O A;  2JEV A;  4JD6 A;  2Z0Z A;  2VZZ A;  4KOX A;  2WPX A;  2D4O A;  2YNC A;  2Q44 A;  4JJX A;  2RC4 A;  3I9S A;  4DNC A;  4XPD C;  4IF5 A;  4MBU A;  3TO7 A;  2J8N A;  4ZBG A;  4AB7 A;  4B5P A;  2B5G A;  3CXP A;  1XEB A;  2PQ8 A;  4CAE A;  1YVO A;  5G20 A;  4LUA A;  1WWZ A;  1YK3 A;  5F46 A;  1V0C A;  4XPK A;  1KUY A;  2B4D B;  4U5Y A;  1XF8 A;  5GCN A;  4HKF A;  4MFP A;  4OAD A;  1PUA A;  1Z4R A;  4F6A A;  5JQ4 A;  1K4J A;  2Q0Y A;  2FE7 A;  2BEI A;  3B8G A;  5AG5 A;  4C2X A;  2Q4Y A;  5EC4 A;  2YGW A;  4Q38 A;  3ZJ0 A;  4CYP A;  1M4G A;  3N7Z A;  3T90 A;  2NMT A;  3FNC A;  3MGD A;  3GY9 A;  1P4N A;  2OU2 A;  3FXT A;  2DPT A;  2QML A;  2VXK A;  2Z3N A;  4Y49 B;  3EC4 A;  3S6G A;  1I21 A;  5AG7 A;  5J8F A;  4M85 A;  3TO6 A;  4UFW A;  5AG6 A;  2REE A;  3NE7 A;  2Z3K A;  4JXR A;  1XIX A;  2PC1 A;  4J3G A;  4QVT A;  2PR8 A;  4II9 A;  2R1I A;  4PSW A;  2OZU A;  4QB9 A;  1B87 A;  2OH1 A;  2FIW A;  3CXS A;  2VEZ A;  4U9Z A;  3WR7 A;  2Z11 A;  1SQH A;  4QUS A;  4RS2 A;  2GE3 A;  4CGM A;  5C88 A;  4CS0 B;  5F48 A;  3S6K A;  4KOV A;  1S7N A;  4YRH A;  2QEC A;  5EBV A;  2HQY A;  4PK2 A;  4KLV A;  3JTK A;  2JDD A;  1RXT A;  4NSQ A;  4R3L A;  2P6F A;  4XPL A;  4MJ8 A;  2B4D A;  2BUE A;  1Y9K A;  3PGP A;  4Y49 C;  1S7K A;  3IGR A;  1IB1 E;  2VZY A;  1L0C A;  1S7L A;  1Q2Y A;  4RI1 A;  5DWN A;  3PP9 A;  4KOT A;  4KUA A;  1KUV A;  4GS4 A;  4FD4 A;  1RO5 A;  1YLE A;  3R9F A;  2ZPA A;  4MY3 A;  5E96 A;  1MJA A;  2YNC C;  2Z3M A;  2BL1 A;  3R95 A;  3GKR A;  1IID A;  1YVK A;  1J4J A;  2VQY A;  3EXN A;  3E0K A;  4H6U A;  2JDC A;  2C27 A;  4R57 A;  4UWJ A;  2CY2 A;  2ARH A;  2R98 A;  4NF1 A;  1IYL A;  1ON0 A;  3H4Q A;  4JLY A;  3BJ8 A;  3KKW A;  5A28 A;  4B13 A;  3PZJ A;  1TIQ A;  2P6E A;  1S3Z A;  3D2P A;  1Q2D A;  4KUB A;  5KTD A;  2YNE A;  4IUS A;  4HNY B;  3FIX A;  5G1Z A;  4F0X A;  1ZO0 A;  3IWE A;  1M44 A;  4UA3 A;  3T9Y A;  3F8K A;  3R1K A;  4CRZ B;  3CXQ A;  4K30 A;  2ZW6 A;  2WUU A;  2FXF A;  4YFJ A;  3IU1 A;  3SXN A;  4CAW A;  4CGP A;  1IIC A;  3TE4 A;  4A30 A;  1QSN A;  5DWM A;  5BWA B;  2FSR A;  2HUZ A;  5G21 A;  4L8A A;  1I1D A;  4KSA A;  2DPS A;  1B6B A;  3V8I A;  4YGO A;  2H5M A;  4H89 A;  4F0Y A;  2CNS A;  2OZH A;  3W91 A;  4FD5 A;  4AG7 A;  4AVB A;  4C7H A;  4C68 A;  3P2H A;  3A9L A;  5G22 A;  4ZGY B;  4A32 A;  1YGH A;  2R7H A;  2BSW A;  2JLM A;  4B5O A;  4B12 A;  3DDD A;  3LOD A;  3ZZI A;  4A2Z A;  4XNH B;  3DNS A;  3TFY A;  1YR0 A;  2G3A A;  4CAF A;  2Y0M A;  4NXY A;  3D2M A;  1M4D A;  3TCV A;  4CYN A;  4NCZ A;  5JPH A;  3H5Z A;  5KTA A;  1S5K A;  4KOR A;  1XMT A;  2VBQ A;  1IYK A;  4PV6 A;  3DR6 A;  2J8R A;  4MFJ A;  4I49 A;  1S7F A;  1VHS A;  2B3V A;  1KUX A;  2FL4 A;  4KZT A;  2FS5 A;  3DSB A;  3S6F A;  4EVY A;  3TT2 A;  3RYO A;  4MFL A;  4ONU A;  3D3S A;  5HH1 A;  2OB0 A;  2J8M A;  2G0B A;  2KCW A;  1XE4 A;  4KVM E;  4KLW A;  4UFV A;  4FD7 A;  2FIA A;  4JWP A;  2B3U A;  2QIR A;  1M4I A;  4HNW B;  1P0H A;  3P2F A;  4E0A A;  4XNH C;  4OAE A;  4UCP A;  5H86 A;  1UFH A;  4XPD B;  1NE9 A;  2G3T A;  3BJ7 A;  5HMN A;  4QBJ A;  4U9Y A;  5IV0 A;  3D8P A;  4CGN A;  3SXO A;  2Z10 A;  4CRY B;  3EO4 A;  4L89 A;  2B4B A;  1FY7 A;  3EY5 A;  2EUI A;  4AVC A;  2Q4V A;  3W6S A;  2HV2 A;  2Z3L A;  2O28 A;  5F47 A;  1MJ9 A;  1BO4 A;  5IB0 A;  1VKC A;  3R9G A;  2CNM A;  4FD6 A;  4A31 A;  3GYA A;  2Z3P A;  2PR1 A;  4A95 A;  3QB8 A;  5C82 A;  2IL4 A;  4MFQ A;  2AJ6 A;  3R9E A;  2ZW5 A;  2VI7 A;  4CAV A;  4NEX A;  3R96 A;  2PRB A;  2CNT A;  4CGO A;  2Z3O A;  3F5B A;  3EFA A;  1LRZ A;  1YX0 A;  4CGL A;  4ORF A;  4CAX A;  4KOS A;  2X7B A;  2I00 A;  1Q2C A;  3VWD A;  1MJB A;  4PSX A;  3TTH A;  1PU9 A;  2WPW A;  3FBU A;  4CYQ A;  2DXQ A;  2I79 A;  3DR8 A;  4MY0 A;  5F49 A;  1QST A;  4AG9 A;  4C7I A;  2ATR A;  3C26 A;  4A33 A;  3LD2 A;  2B58 A;  3QAH A;  4C2Y A;  4CYO A;  5ISV A;  3I3G A;  3TO9 A;  4R3K A;  2OZG A;  4KOU A;  4AVA A;  4OLL A;  2Q7B A;  2GAN A;  2ZW7 A;  4M3S A;  2R8V A;  4HNX B;  3IU2 A;  4R87 A;  1I12 A;  4MHD A;  1U6M A;  3IWG A;  1BOB A;  5IX3 A;  2AE6 A;  4UWI A;  3S6H A;  1Y9W A;  3FYN A;  1Z9U A;  2REF A;  4JXQ A;  4UCM A;  4MI4 A;  1R57 A;  4KVX A;  4B11 A;  2PDO A;  2PSW A;  4QC6 A;  2F5I A;  2YND A;  3K9U A;  4B10 A;  5AG4 A;  4MFZ A;  2Q04 A;  1QSO A;  2A4N A;  4UCN A;  4KSF A;  2K5T A;  2P6G A;  4B5P B;  2B5G B;  1N71 A;  2GIV A;  3FRM A;  3VWE A;  1GHE A;  1QSR A;  2ZW4 A;  1CJW A;  5H84 A;  5I0C A;  3G8W A;  2ZXV A;  4LX9 A;  3JUW A;  3FB3 A;  4E2A A;  4X5K A;  2FT0 A;  3G3S A;  1Y7R A;  4KVO E;  2FCK A;  4KOY A;  4B14 A;  2P0W A;  1YRE A;  1Z4E A;  3UY5 A;  5FVJ A;  1WK4 A;  2D4P A;  4KOW A;  4UFX A;  3BLN A;  4R9M A;  3W6X A;  4H6Z A;  4Q36 A;  4C2Z A;  4PK3 A;  1MK4 A;  1CM0 A;  1QSM A;  3OWC A;  4BMH A;  3F0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...