1IIDA

Crystal structure of saccharomyces cerevisiae n-myristoyltransferase with bound s-(2-oxo)pentadecylcoa and the octapeptide glyaskla
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
422
structure length
422
Chain Sequence
b'AMKDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide N-myristoyltransferase
publication title Structures of Saccharomyces cerevisiae N-myristoyltransferase with bound myristoylCoA and peptide provide insights about substrate recognition and catalysis.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 115
structure length 422
sequence length 422
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2001-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iidA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iidA02
2FCKA 3T9YA 2QMLA 4QVTA 5J8FA 2I79A 1U6MA 1TIQA 3BLNA 2IL4A 3QB8A 3R95A 3CXQA 5JQ4A 4E8OA 1KZFA 2BL1A 2FE7A 3NE7A 3FB3A 2Z10A 3D8PA 3ZZIA 3TO7A 4GS4A 5J8CA 2CNTA 4MY3A 1RXTA 2HV2A 4R57A 5FVJA 3TO9A 2PR1A 2FSRA 5H86A 2PDOA 3FNCA 2Y0MA 1MK4A 3B8GA 1IYKA 3F5BA 3DSBA 3GKRA 2NMTA 1M4GA 2G0BA 2P6FA 3CXPA 5I0CA 2I00A 1Y9WA 1WWZA 4UBRA 4I49A 1OZPA 4HNXB 4KOXA 1S7NA 2PR8A 4M85A 4YFJA 4LX9A 1P4NA 2FS5A 4OADA 5HMNA 4FD6A 3BJ8A 4AG7A 4Y49C 2ZPAA 2VBQA 1XE4A 5KTCA 3R96A 5F48A 4PSWA 3FBUA 4KLWA 4KOUA 4CAXA 4CAWA 2B4DB 2AJ6A 1QSMA 3EO4A 5F49A 4PV6A 3GY9A 3S6GA 2P6EA 3G8WA 3IGRA 2JDCA 4OAEA 1VHSA 5E96A 4R3LA 2D4PA 1M4IA 2R98A 3D3SA 1PU9A 3T90A 3W6XA 5ISVA 4YGOA 3S6KA 2Q04A 1IICA 2ZW5A 1XEBA 1S7LA 1RO5A 2HUZA 2OZHA 2KCWA 4IF5A 3R9EA 4JXRA 1Z4EA 3TE4A 3C26A 1FY7A 5H84A 3P2FA 2D4OA 4K30A 2FT0A 5IX3A 4CS0B 3FRMA 1M4DA 4KVME 2FIWA 1PUAA 2G3TA 1Z4RA 5F46A 2VEZA 2X7BA 4QUSA 4U9YA 2PRBA 3ZJ0A 3P2HA 3QAHA 3VWDA 2ZW7A 3TCVA 3I9SA 1SQHA 1QSRA 2B3UA 2R7HA 4FD7A 2K5TA 3FXTA 1LRZA 4R87A 4MI4A 3EFAA 2O28A 4F0YA 3TOBA 4MY0A 2P0WA 2VXKA 4QB9A 3I3GA 3TO6A 2EUIA 2P6GA 2ATRA 1MJ9A 1NE9A 2Q4VA 4AVBA 2J8MA 2WPXA 3E0KA 1S7KA 4XPKA 1MJAA 2JLMA 3PP9A 4EVYA 4FD5A 4FD4A 1KUXA 1N71A 4KVOE 1YVKA 2OU2A 3PGPA 1KUVA 2R8VA 2J8RA 4CRZB 3F0AA 2Q0YA 2WPWA 1IYLA 1YREA 3IWGA 4KOSA 3WR7A 2Z11A 3CXSA 1GHEA 2ZW4A 2FL4A 5DWNA 5C82A 3FIXA 4AVAA 1L0CA 4JLYA 4XNHB 2REEA 1K4JA 4H6UA 4PK3A 3VWEA 4KOWA 2B5GB 2OZUA 2PSWA 2RC4A 4B5PB 2HQYA 4NSQA 2BSWA 1M1DA 1J4JA 1S60A 2DXQA 4E2AA 2Q7BA 5C88A 1IB1E 4HKFA 4NF1A 3R9GA 4B5OA 3F8KA 3SXNA 4AB7A 2BUEA 3LODA 3EC4A 4KOTA 1S5KA 2B58A 3EXNA 1WK4A 2H5MA 5EC4A 2CY2A 2CNSA 4U5YA 3GYAA 2OB0A 1UFHA 2OH1A 1KUYA 3KKWA 1XMTA 4F6AA 4QC6A 1Q2DA 1S3ZA 3N7ZA 3DNSA 4UWJA 2JDDA 4KVXA 3EY5A 4KLVA 4ZBGA 5F47A 3JUWA 4E0AA 5GCNA 1CJWA 3LD2A 3SXOA 4YRHA 2JEVA 2Q4YA 3R1KA 1IIDA 4JJXA 4MHDA 1I12A 4OLLA 1YR0A 4AG9A 2AE6A 3W91A 1QSTA 3TFYA 2B3VA 4BMHA 4J3GA 4RI1A 4MBUA 3D2PA 1P0HA 3H4QA 4RS2A 3R9FA 1YVOA 3S6FA 2VZYA 3V8IA 3BJ7A 4XPDB 2ZW6A 1YK3A 2REFA 3W6SA 2PC1A 4LUAA 4UWIA 4KOYA 1Z9UA 4L89A 5HH1A 1BOBA 1CM0A 3TT2A 2GE3A 4NXYA 4KORA 4PSXA 3K9UA 4R3KA 4KUBA 2ZXVA 5KTAA 4ONUA 1VKCA 1YLEA 3MGDA 4JD6A 5CNPA 1S7FA 4XPLA 1I21A 4L8AA 3PZJA 2GIVA 4IUSA 2OZGA 2VI7A 2B4BA 3TTHA 1XIXA 4AVCA 2GANA 1B6BA 1Q2YA 1NMTA 1YX0A 1NSLA 2F5IA 2FIAA 1Y7RA 4M3SA 4KOVA 2C27A 2VQYA 3UY5A 4UA3A 4H89A 1XF8A 1QSOA 2B5GA 2G3AA 5IV0A 2B4DA 4B5PA 2Q44A 4XPDC 2VZZA 1MJBA 3DDDA 4JXQA 4R9MA 2R1IA 4NCZA 1M44A 4CAVA 4JWPA 4U9ZA 1B87A 4KUAA 3D2MA 1YGHA 1QSNA 3FYNA 5DWMA 4ORFA 2ARHA 2J8NA 2BEIA 5EBVA 4KZTA 4NEXA 4DNCA 2QECA 5IB0A 4MJ8A 1R57A 3DR6A 3S6HA 1V0CA 2EVNA 2PQ8A 3RYOA 4QBJA 3SHPA 3TOAA 2A4NA 4XNHC 2FXFA 5JPHA 1I1DA 5KTDA 4X5KA 1BO4A 3G3SA 3JVNA 4HNYB 2QIRA 3OWCA 4CRYB 1ON0A 1Y9KA 4HNWB 4II9A 2CNMA 4H6ZA 2Z0ZA 4PK2A 3DR8A 4Y49B 1Q2CA
chains in the Genus database with same CATH superfamily
2O53A 2FCKA 3T9YA 4MFQA 2QMLA 2PCUA 3CT9A 2ZEMA 4QVTA 5J8FA 2I79A 1U6MA 2XEGA 4OIWA 3PFOA 1TIQA 3BLNA 2PJ4A 2AFXA 4IHMA 2IL4A 2WYRA 2WZNA 1ARLA 5I4MA 3H8EA 3QB8A 3D7DA 3R95A 2F8HA 3CXQA 3B7IA 5HVGA 5JQ4A 1ZLIA 2NYQA 1KZFA 2BL1A 4IK2A 4E8OA 2DPSA 3D4UA 4PXDA 2FE7A 5EMIA 3NE7A 4ZY1A 3FB3A 5D8NA 3K2KA 4A37A 4YWYA 2Z10A 3CPXA 4A94A 4JYWA 3IU2A 3D8PA 3ZZIA 3TO7A 3B35A 4GS4A 5J8CA 4DJLA 2CNTA 4MY3A 1RXTA 4P4FA 5HVFA 3WC7A 2HV2A 1YQEA 4R57A 4BBHA 1DE4C 5FVJA 3TO9A 1RTQA 2PR1A 4W9YA 2FSRA 5H86A 2PDOA 4X3RA 1YW6A 2Z3PA 4TNUA 2PJ3A 2Y0MA 1MK4A 1BLLE 3FNCA 3FMCA 2HC9A 3B8GA 1IYKA 2V8DA 3F5BA 5AG4A 4AXVA 4CAEA 5HXDA 2J9AA 3DSBA 3GKRA 5JGFA 2NMTA 1CG2A 1M4GA 2G0BA 2P6FA 3CXPA 5AG5A 5I0CA 5HVHA 4CAFA 4P4JA 2I00A 1BPNA 2ZOFA 5DS0A 1WWZA 1Y9WA 5ELYA 3IEHA 3CDXA 3D67A 4UBRA 4I49A 4ZY2A 4ZGYB 1LFWA 1OZPA 1Y0RA 2YNCA 4M6HA 4HNXB 1XRYA 1S7NA 4KOXA 1Z5RA 2AFMA 2PR8A 2XEJA 4M85A 4YFJA 4B11A 4LX9A 2ZOGA 3B3WA 2IMOA 4FWUA 1CP7A 3WABA 1P4NA 2AFZA 2ZEDA 2FS5A 4OADA 3FECA 4OIDA 4B13A 3PEIA 5HMNA 1XOVA 4FD6A 3BJ8A 4MHYA 4MMOA 5IB9A 4AG7A 1TF9A 4PXCA 1Z8LA 4RUHA 4Y49C 2PJBA 2ZPAA 2VBQA 1Z8WA 1XE4A 3FVLA 5KTCA 8CPAA 3DGVA 3PFEA 4NGPA 3R96A 5F48A 1X12A 3H8GA 4PSWA 3LWUA 3FBUA 3KHZA 4C68A 2CTBA 5A27A 2WSAA 4KLWA 4OC0A 2Q51A 2YNEA 3V38A 4KOUA 2GLJA 2AFSA 4CAXA 4CAWA 2C1CA 4CYNA 2B4DB 2AJ6A 1QSMA 4NGRA 4OC5A 3EO4A 4P44A 3FEEA 4R6TA 5F49A 3LMSA 4B12A 4PV6A 3GY9A 5AG7A 4OP4A 1A2ZA 2P6EA 3S6GA 3G8WA 2ABZA 3IGRA 2JDCA 2ZEPA 3VARA 4OAEA 1VHSA 5E96A 4R3LA 1CPXA 1GYTA 5A28A 3SJXA 4FAIA 2ZEFA 3NA6A 2D4PA 1M4IA 2R98A 3D3SA 1PU9A 3T90A 3W6XA 5ISVA 3IC1A 2POKA 4OKOA 4YGOA 3S6KA 2Q04A 1HEEA 3BXMA 1IICA 4NFRA 4DUKA 1ARMA 2GREA 2ZW5A 1XEBA 1S7LA 2PJ9A 2EK8A 1RO5A 4KS9A 1PCAA 2HUZA 4KSAA 2OZHA 4MCQA 1ZG8A 4OC3A 5K8PA 1Y0YA 2KCWA 4IF5A 2ZEOA 3R9EA 2G9DA 4JXRA 4M6GA 1Z4EA 4UFVA 3SI1A 3B3SA 3D66A 3FEDA 3TE4A 3KZWA 3C26A 4MFLA 2ZENA 1FY7A 4Q36A 5H84A 3P2FA 2D4OA 4WJBA 4K30A 1XJOA 4H2KA 4UIBA 2FT0A 4UIAA 2HB6A 4UCNA 5IX3A 2IJZA 1Z8XA 4CS0B 3FH4A 5JH9A 3FRMA 1M4DA 4KVME 4MCRA 2FIWA 3NH8A 1PUAA 1X10A 5CBMA 2G3TA 1Z4RA 5F46A 2VEZA 2X7BA 1VHOA 4QUSA 4U9YA 2PRBA 2CF4A 3ZJ0A 3P2HA 4EFDA 3QAHA 3VWDA 3K9TA 2ZW7A 3QAYA 4MHPA 3TCVA 3I9SA 1SQHA 2QJ8A 4HPSA 1QSRA 3IWWA 2B3UA 2R7HA 2Z3OA 4FD7A 3KI9A 5G20A 1TKHA 3PB8X 2K5TA 3FXTA 3B3TA 1LRZA 4R87A 4MI4A 3FF3A 4BD9A 3EFAA 3PB6X 2O28A 3B3VA 4KSFA 4F0YA 3TOBA 5LYLA 4MY0A 2P0WA 2VXKA 4NGTA 4QB9A 3I3GA 3TO6A 3N5FA 4F9VA 4FBEA 2PJ5A 2EUIA 2P6GA 2ATRA 1MJ9A 5LRGA 1OBRA 3SJGA 3NFZA 1VHEA 5K8NA 2BOAA 1NE9A 2Q4VA 3NH5A 3S9LA 3L2NA 1Z8TA 2J8MA 1TF8A 4AVBA 2PJCA 2YGWA 2OR4A 5AGEA 2WPXA 3GLJA 3E0KA 1S7KA 1ELLP 1LOKA 4XPKA 1MJAA 2JLMA 3PP9A 4EVYA 4FD5A 4FD4A 1KUXA 1N71A 4KVOE 1YVKA 2OU2A 3PGPA 3A9LA 4PPZA 4CGMA 1KUVA 4Z65A 4Q38A 5D29A 2R8VA 2J8RA 3TC8A 4CGNA 3BHXA 1Y7EA 4CRZB 3F0AA 4C2YA 2Q0YA 3KQXA 1NSAA 2WPWA 1IYLA 1HDUA 3I1UA 1YREA 3B2YA 4PXBA 4MFKA 3IWGA 4CGPA 1EE3P 2PIYA 4KOSA 3WR7A 2Z11A 3CXSA 1GHEA 3S9NA 2ZW4A 2ZEEA 2PJ1A 1YW4A 3WT4A 1IGBA 2FL4A 4LQ6A 4EWTA 4A31A 5DWNA 3PRTA 4JZ0A 4NGQA 4CPAA 5C82A 3FIXA 4AVAA 4BINA 1L0CA 4JLYA 4NGSA 1LCPA 1KWMA 3KHXA 4XNHB 2REEA 1K4JA 3D7HA 4H6UA 4PK3A 2AFOA 3VWEA 4ZI6A 2QVPA 4KOWA 2V8VA 2B5GB 2OZUA 1VGYA 2PSWA 1JWQA 2RC4A 2HQYA 3KASA 1M4LA 4NSQA 4B5PB 2BSWA 1M1DA 2AFUA 1J4JA 1S60A 1Z2LA 2PJ8A 2DXQA 3KR4A 4P4IA 4E2AA 3ISZA 2Q7BA 5C88A 1BPMA 2PRQA 5K8OA 4CGOA 3D7GA 1IB1E 1CBXA 1JQGA 4O23A 3IJ3A 2PVVA 4HKFA 4NF1A 4R8FA 3R9GA 3F8KA 4B5OA 3SXNA 1ELMP 4AB7A 2BUEA 2I3CA 3LODA 3SJEA 1XBUA 4PXEA 4ONWA 3TX8A 5LYDA 1CP6A 4NGMA 2XEFA 4OC2A 3EC4A 2Q4ZA 4KOTA 2F7VA 1S5KA 3PBBA 3SI2A 2B58A 2O4HA 2C6CA 1HDQA 3EXNA 4WWVA 1WK4A 2RB7A 2H5MA 2QYVA 2CY2A 3FJUA 5EC4A 3HUVA 1LANA 2CNSA 1XMBA 4U5YA 3GYAA 3QNVA 3VH9A 2OB0A 1UFHA 4GM5A 4C2XA 2YNDA 2OH1A 1F2PA 1KUYA 1XMTA 3KKWA 3PB4X 4QC6A 4F6AA 1R3NA 1Q2DA 3B3CA 1AUGA 1S3ZA 4R7MA 5G22A 4A38A 4A39A 7CPAA 4A33A 3N7ZA 3H5ZA 3DNSA 4PQAA 4UWJA 2JDDA 3KL9A 4KVXA 2Z3MA 3EY5A 4KLVA 3D68A 4ZBGA 1VIXA 5JM6A 5F47A 3JUWA 3PBEA 4NJRA 4E0AA 4A2ZA 4C2ZA 5GCNA 2V8HA 1CJWA 3LD2A 5LYFA 2PIZA 4YRHA 3SXOA 4UCMA 3JRUA 2JEVA 2ZELA 2Q4YA 3R1KA 5LRKA 2PJ0A 1F2OA 4DYOA 1TXRA 1IIDA 4JJXA 4B14A 4MHDA 3LACA 4F9UA 4MCSA 4UEFA 4CYOA 4Y49B 3T8WA 4MHZA 1CPSA 1I12A 2VL1A 4OLLA 4UF4A 1TKJA 3V7ZA 1YR0A 3IIBA 2V77A 4AG9A 3MRUA 2BO9A 3BI1A 1QMUA 2AE6A 1IU8A 3W91A 1QSTA 3TFYA 4ZX9A 2B3VA 4BMHA 1Q7LA 4G1PA 4J3GA 5AG6A 2GLFA 3PB9X 4CGLA 3KR5A 4RI1A 4MBUA 4UEZA 3VATA 4OMEA 3D2PA 4M6IA 1P0HA 2JBKA 1FT7A 3H4QA 3H8FA 1AYEA 4RS2A 4F8ZA 4CYQA 2BCOA 1R43A 4C7IA 1CX8A 3R9FA 1PYTB 1YVOA 3S6FA 3WC6A 2VZYA 3V8IA 3BJ7A 4A32A 4XPDB 3KQZA 4B6ZA 4X2TA 3DLJA 2CIJA 2Z3LA 2ZW6A 3FX6A 4MFZA 1YK3A 2REFA 3W6SA 5K8MA 2PC1A 2PJ2A 2Z3NA 4LUAA 4UWIA 4KOYA 1TKFA 3IO1A 1Z9UA 4L89A 4X8IA 5HH1A 1BOBA 1CM0A 1DTDA 3TT2A 2GE3A 4NXYA 4KORA 4PSXA 2EO8A 3K9UA 4R3KA 4KUBA 4RN7A 5THWA 2ZXVA 6CPAA 5KTAA 4ONUA 1F57A 1VKCA 1YLEA 3MGDA 4JD6A 4C7HA 4MCPA 2EBJA 5CNPA 1S7FA 4ZYQA 3NH4A 4XPLA 4TWEA 3RAMA 1ZO0A 4P4DA 1AMPA 1ZG7A 4UFXA 1I21A 4UCPA 4L8AA 3PZJA 3KGQA 2GIVA 4IUSA 2OZGA 2VI7A 1YSJA 3PB7X 4P10A 2B4BA 4P45A 3CPAA 3TTHA 1XIXA 4AVCA 2GANA 3D7FA 1B6BA 2ZEGA 1FNOA 3SI0A 1Q2YA 2XEIA 1NMTA 1QQ9A 1YX0A 4A30A 1NSLA 3RO0A 2Z3KA 2F5IA 2FIAA 1Y7RA 4MRIA 4F0XA 4M3SA 1XFOA 3RBUA 3RNZA 4KOVA 2C27A 4B10A 3IU1A 3WC5A 4LQGA 2VQYA 3UY5A 4UA3A 1IOFA 4ZX8A 2C6PA 4H89A 3GB0A 1XF8A 4NJQA 1QSOA 2B5GA 2G3AA 5IV0A 2B4DA 2ANPA 4B5PA 4ZY0A 4KSIA 2JBJA 2CTCA 5G1ZA 2EK9A 1IOIA 2PJAA 2PJ7A 2Q44A 2PE3A 2EWBA 4XPDC 2VZZA 3SJFA 3MN8A 1MJBA 3DDDA 4JXQA 1LAMA 4MFPA 3BI0A 3GUXA 4R9MA 1LAPA 2R1IA 3GIUA 4OC1A 4NCZA 1H8LA 1M44A 1YLOA 2Q7SA 2FVGA 4P4BA 4EMEA 4GXHA 4CAVA 2RFHA 2PJ6A 4JWPA 4MFJA 4U9ZA 1B87A 4KUAA 5G21A 3D2MA 1YGHA 1QSNA 2ODFA 3FYNA 4Q7AA 4ORFA 2ARHA 2V8GA 5DWMA 2J8NA 2NSMA 3RZAA 5LRJA 2BEIA 1ZG9A 4R76A 2C6GA 3S9MA 5EBVA 4KZTA 3CZXA 4NEXA 5J1QA 5BWAB 3HLPA 2JEWA 2QECA 4YU9A 2DF5A 4MJ8A 4DNCA 5IB0A 1R57A 3DR6A 4MXUA 3S6HA 2YNCC 2IQ6A 1V0CA 2EVNA 2PQ8A 3IWEA 2OOTA 2Q43A 5F09A 4OC4A 4K3NA 3RYOA 4QBJA 3SHPA 1BAVA 4UFWA 5CPAA 5LYIA 3TOAA 2A4NA 4FUUA 2AFWA 2ZEHA 4XNHC 1ZLHA 2FXFA 2DPTA 2PVWA 4UEEA 1I1DA 5JPHA 5KTDA 1YMEA 4IAVA 4X5KA 2GFQA 1IY7A 4MHNA 1BO4A 3G3SA 2GU2A 2DEAA 3JVNA 4A95A 2CXAA 3JTKA 4HNYB 2WUUA 2QIRA 3OWCA 3NE8A 1ON0A 1UWYA 1Y9KA 3IFEA 4CRYB 4HNWB 4CYPA 4P6YA 4II9A 4NGNA 2CNMA 4P4EA 4H6ZA 2Z0ZA 4PK2A 3DR8A 3ISXA 1Q2CA
chains in the Genus database with same CATH topology
2FCKA 3T9YA 4MFQA 2QMLA 4QVTA 5J8FA 2I79A 1U6MA 1TIQA 3BLNA 2IL4A 3QB8A 3R95A 3CXQA 5JQ4A 4E8OA 1KZFA 2BL1A 2DPSA 2FE7A 3NE7A 3FB3A 2Z10A 3IU2A 3D8PA 3ZZIA 3TO7A 4GS4A 5J8CA 2CNTA 4MY3A 1RXTA 2HV2A 4R57A 4BBHA 5FVJA 3TO9A 2PR1A 2FSRA 5H86A 2PDOA 2Z3PA 3FNCA 2Y0MA 1MK4A 3B8GA 1IYKA 3F5BA 5AG4A 4CAEA 3DSBA 3GKRA 2NMTA 1M4GA 2G0BA 2P6FA 3CXPA 5AG5A 5I0CA 4CAFA 2I00A 1Y9WA 1WWZA 4UBRA 4I49A 4ZGYB 1OZPA 2YNCA 4HNXB 4KOXA 1S7NA 2PR8A 4M85A 4YFJA 4B11A 4LX9A 1P4NA 2FS5A 4OADA 4B13A 5HMNA 4FD6A 3BJ8A 4AG7A 4Y49C 2ZPAA 2VBQA 1XE4A 5KTCA 3R96A 5F48A 4PSWA 3FBUA 4C68A 5A27A 2WSAA 4KLWA 2YNEA 4KOUA 4CAXA 4CAWA 4CYNA 2B4DB 2AJ6A 1QSMA 3EO4A 5F49A 4B12A 4PV6A 3GY9A 5AG7A 3S6GA 2P6EA 3G8WA 3IGRA 2JDCA 4OAEA 1VHSA 5E96A 4R3LA 5A28A 2D4PA 1M4IA 2R98A 3D3SA 1PU9A 3T90A 3W6XA 5ISVA 4YGOA 3S6KA 2Q04A 1IICA 2ZW5A 1XEBA 1S7LA 1RO5A 4KS9A 2HUZA 4KSAA 2OZHA 2KCWA 4IF5A 3R9EA 4JXRA 1Z4EA 4UFVA 3TE4A 3C26A 4MFLA 1FY7A 4Q36A 5H84A 3P2FA 2D4OA 4K30A 2FT0A 4UCNA 5IX3A 4CS0B 3FRMA 1M4DA 4KVME 2FIWA 1PUAA 2G3TA 1Z4RA 5F46A 2VEZA 2X7BA 4QUSA 4U9YA 2PRBA 3ZJ0A 3P2HA 3QAHA 3VWDA 2ZW7A 3TCVA 3I9SA 1SQHA 1QSRA 2B3UA 2R7HA 2Z3OA 4FD7A 5G20A 2K5TA 3FXTA 1LRZA 4R87A 4MI4A 3EFAA 4KSFA 2O28A 4F0YA 3TOBA 4MY0A 2P0WA 2VXKA 4QB9A 3I3GA 3TO6A 2EUIA 2P6GA 2ATRA 1MJ9A 1NE9A 2Q4VA 4AVBA 2J8MA 2YGWA 5AGEA 2WPXA 3E0KA 1S7KA 4XPKA 1MJAA 2JLMA 3PP9A 4EVYA 4FD5A 4FD4A 1KUXA 1N71A 4KVOE 1YVKA 2OU2A 3PGPA 3A9LA 4CGMA 1KUVA 4Q38A 2R8VA 2J8RA 4CGNA 4CRZB 3F0AA 4C2YA 2Q0YA 2WPWA 1IYLA 1YREA 4MFKA 3IWGA 4CGPA 4KOSA 3WR7A 2Z11A 3CXSA 1GHEA 2ZW4A 2FL4A 4A31A 5DWNA 5C82A 3FIXA 4AVAA 1L0CA 4JLYA 4XNHB 2REEA 1K4JA 4H6UA 4PK3A 3VWEA 4KOWA 2B5GB 2OZUA 2PSWA 2RC4A 4B5PB 2HQYA 4NSQA 2BSWA 1M1DA 1J4JA 1S60A 2DXQA 4E2AA 2Q7BA 5C88A 4CGOA 1IB1E 4HKFA 4NF1A 3R9GA 4B5OA 3F8KA 3SXNA 4AB7A 2BUEA 3LODA 3EC4A 4KOTA 1S5KA 2B58A 3EXNA 1WK4A 2H5MA 5EC4A 2CY2A 2CNSA 4U5YA 3GYAA 2OB0A 1UFHA 4C2XA 2YNDA 2OH1A 1KUYA 3KKWA 1XMTA 4F6AA 4QC6A 1Q2DA 5G22A 1S3ZA 4A33A 3N7ZA 3H5ZA 3DNSA 4UWJA 2JDDA 4KVXA 2Z3MA 3EY5A 4KLVA 4ZBGA 5F47A 3JUWA 4E0AA 4A2ZA 4C2ZA 5GCNA 1CJWA 3LD2A 3SXOA 4YRHA 4UCMA 2JEVA 2Q4YA 3R1KA 1IIDA 4JJXA 4B14A 4MHDA 4CYOA 1I12A 4OLLA 1YR0A 4AG9A 2AE6A 3W91A 1QSTA 3TFYA 2B3VA 4BMHA 4J3GA 5AG6A 4CGLA 4RI1A 4MBUA 3D2PA 1P0HA 3H4QA 4RS2A 4CYQA 4C7IA 3R9FA 1YVOA 3S6FA 2VZYA 3V8IA 3BJ7A 4A32A 4XPDB 2Z3LA 2ZW6A 4MFZA 1YK3A 2REFA 3W6SA 2PC1A 2Z3NA 4LUAA 4UWIA 4KOYA 1Z9UA 4L89A 5HH1A 1BOBA 1CM0A 3TT2A 2GE3A 4NXYA 4KORA 4PSXA 3K9UA 4R3KA 4KUBA 2ZXVA 5KTAA 4ONUA 1VKCA 1YLEA 3MGDA 4JD6A 4C7HA 5CNPA 1S7FA 4XPLA 1ZO0A 4UFXA 1I21A 4UCPA 4L8AA 3PZJA 2GIVA 4IUSA 2OZGA 2VI7A 2B4BA 3TTHA 1XIXA 4AVCA 2GANA 1B6BA 1Q2YA 1NMTA 1YX0A 4A30A 1NSLA 2Z3KA 2F5IA 2FIAA 1Y7RA 4F0XA 4M3SA 4KOVA 2C27A 4B10A 3IU1A 2VQYA 3UY5A 4UA3A 4H89A 1XF8A 1QSOA 2B5GA 2G3AA 5IV0A 2B4DA 4B5PA 5G1ZA 2Q44A 4XPDC 2VZZA 1MJBA 3DDDA 4JXQA 4MFPA 4R9MA 2R1IA 4NCZA 1M44A 4CAVA 4JWPA 4MFJA 4U9ZA 1B87A 4KUAA 5G21A 3D2MA 1YGHA 1QSNA 3FYNA 5DWMA 4ORFA 2ARHA 2J8NA 2BEIA 5EBVA 4KZTA 4NEXA 5BWAB 4DNCA 2QECA 5IB0A 4MJ8A 1R57A 3DR6A 3S6HA 2YNCC 1V0CA 2EVNA 2PQ8A 3IWEA 3RYOA 4QBJA 3SHPA 4UFWA 3TOAA 2A4NA 4XNHC 2FXFA 2DPTA 5JPHA 1I1DA 5KTDA 4X5KA 1BO4A 3G3SA 3JVNA 4A95A 2CXAA 3JTKA 4HNYB 2WUUA 2QIRA 3OWCA 4CRYB 1ON0A 1Y9KA 4HNWB 4CYPA 4II9A 2CNMA 4H6ZA 2Z0ZA 4PK2A 3DR8A 4Y49B 1Q2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCK A;  3T9Y A;  2QML A;  4QVT A;  5J8F A;  2I79 A;  1U6M A;  1TIQ A;  3BLN A;  2IL4 A;  3QB8 A;  3R95 A;  3CXQ A;  5JQ4 A;  4E8O A;  1KZF A;  2BL1 A;  2FE7 A;  3NE7 A;  3FB3 A;  2Z10 A;  3D8P A;  3ZZI A;  3TO7 A;  4GS4 A;  5J8C A;  2CNT A;  4MY3 A;  1RXT A;  2HV2 A;  4R57 A;  5FVJ A;  3TO9 A;  2PR1 A;  2FSR A;  5H86 A;  2PDO A;  3FNC A;  2Y0M A;  1MK4 A;  3B8G A;  1IYK A;  3F5B A;  3DSB A;  3GKR A;  2NMT A;  1M4G A;  2G0B A;  2P6F A;  3CXP A;  5I0C A;  2I00 A;  1Y9W A;  1WWZ A;  4UBR A;  4I49 A;  1OZP A;  4HNX B;  4KOX A;  1S7N A;  2PR8 A;  4M85 A;  4YFJ A;  4LX9 A;  1P4N A;  2FS5 A;  4OAD A;  5HMN A;  4FD6 A;  3BJ8 A;  4AG7 A;  4Y49 C;  2ZPA A;  2VBQ A;  1XE4 A;  5KTC A;  3R96 A;  5F48 A;  4PSW A;  3FBU A;  4KLW A;  4KOU A;  4CAX A;  4CAW A;  2B4D B;  2AJ6 A;  1QSM A;  3EO4 A;  5F49 A;  4PV6 A;  3GY9 A;  3S6G A;  2P6E A;  3G8W A;  3IGR A;  2JDC A;  4OAE A;  1VHS A;  5E96 A;  4R3L A;  2D4P A;  1M4I A;  2R98 A;  3D3S A;  1PU9 A;  3T90 A;  3W6X A;  5ISV A;  4YGO A;  3S6K A;  2Q04 A;  1IIC A;  2ZW5 A;  1XEB A;  1S7L A;  1RO5 A;  2HUZ A;  2OZH A;  2KCW A;  4IF5 A;  3R9E A;  4JXR A;  1Z4E A;  3TE4 A;  3C26 A;  1FY7 A;  5H84 A;  3P2F A;  2D4O A;  4K30 A;  2FT0 A;  5IX3 A;  4CS0 B;  3FRM A;  1M4D A;  4KVM E;  2FIW A;  1PUA A;  2G3T A;  1Z4R A;  5F46 A;  2VEZ A;  2X7B A;  4QUS A;  4U9Y A;  2PRB A;  3ZJ0 A;  3P2H A;  3QAH A;  3VWD A;  2ZW7 A;  3TCV A;  3I9S A;  1SQH A;  1QSR A;  2B3U A;  2R7H A;  4FD7 A;  2K5T A;  3FXT A;  1LRZ A;  4R87 A;  4MI4 A;  3EFA A;  2O28 A;  4F0Y A;  3TOB A;  4MY0 A;  2P0W A;  2VXK A;  4QB9 A;  3I3G A;  3TO6 A;  2EUI A;  2P6G A;  2ATR A;  1MJ9 A;  1NE9 A;  2Q4V A;  4AVB A;  2J8M A;  2WPX A;  3E0K A;  1S7K A;  4XPK A;  1MJA A;  2JLM A;  3PP9 A;  4EVY A;  4FD5 A;  4FD4 A;  1KUX A;  1N71 A;  4KVO E;  1YVK A;  2OU2 A;  3PGP A;  1KUV A;  2R8V A;  2J8R A;  4CRZ B;  3F0A A;  2Q0Y A;  2WPW A;  1IYL A;  1YRE A;  3IWG A;  4KOS A;  3WR7 A;  2Z11 A;  3CXS A;  1GHE A;  2ZW4 A;  2FL4 A;  5DWN A;  5C82 A;  3FIX A;  4AVA A;  1L0C A;  4JLY A;  4XNH B;  2REE A;  1K4J A;  4H6U A;  4PK3 A;  3VWE A;  4KOW A;  2B5G B;  2OZU A;  2PSW A;  2RC4 A;  4B5P B;  2HQY A;  4NSQ A;  2BSW A;  1M1D A;  1J4J A;  1S60 A;  2DXQ A;  4E2A A;  2Q7B A;  5C88 A;  1IB1 E;  4HKF A;  4NF1 A;  3R9G A;  4B5O A;  3F8K A;  3SXN A;  4AB7 A;  2BUE A;  3LOD A;  3EC4 A;  4KOT A;  1S5K A;  2B58 A;  3EXN A;  1WK4 A;  2H5M A;  5EC4 A;  2CY2 A;  2CNS A;  4U5Y A;  3GYA A;  2OB0 A;  1UFH A;  2OH1 A;  1KUY A;  3KKW A;  1XMT A;  4F6A A;  4QC6 A;  1Q2D A;  1S3Z A;  3N7Z A;  3DNS A;  4UWJ A;  2JDD A;  4KVX A;  3EY5 A;  4KLV A;  4ZBG A;  5F47 A;  3JUW A;  4E0A A;  5GCN A;  1CJW A;  3LD2 A;  3SXO A;  4YRH A;  2JEV A;  2Q4Y A;  3R1K A;  1IID A;  4JJX A;  4MHD A;  1I12 A;  4OLL A;  1YR0 A;  4AG9 A;  2AE6 A;  3W91 A;  1QST A;  3TFY A;  2B3V A;  4BMH A;  4J3G A;  4RI1 A;  4MBU A;  3D2P A;  1P0H A;  3H4Q A;  4RS2 A;  3R9F A;  1YVO A;  3S6F A;  2VZY A;  3V8I A;  3BJ7 A;  4XPD B;  2ZW6 A;  1YK3 A;  2REF A;  3W6S A;  2PC1 A;  4LUA A;  4UWI A;  4KOY A;  1Z9U A;  4L89 A;  5HH1 A;  1BOB A;  1CM0 A;  3TT2 A;  2GE3 A;  4NXY A;  4KOR A;  4PSX A;  3K9U A;  4R3K A;  4KUB A;  2ZXV A;  5KTA A;  4ONU A;  1VKC A;  1YLE A;  3MGD A;  4JD6 A;  5CNP A;  1S7F A;  4XPL A;  1I21 A;  4L8A A;  3PZJ A;  2GIV A;  4IUS A;  2OZG A;  2VI7 A;  2B4B A;  3TTH A;  1XIX A;  4AVC A;  2GAN A;  1B6B A;  1Q2Y A;  1NMT A;  1YX0 A;  1NSL A;  2F5I A;  2FIA A;  1Y7R A;  4M3S A;  4KOV A;  2C27 A;  2VQY A;  3UY5 A;  4UA3 A;  4H89 A;  1XF8 A;  1QSO A;  2B5G A;  2G3A A;  5IV0 A;  2B4D A;  4B5P A;  2Q44 A;  4XPD C;  2VZZ A;  1MJB A;  3DDD A;  4JXQ A;  4R9M A;  2R1I A;  4NCZ A;  1M44 A;  4CAV A;  4JWP A;  4U9Z A;  1B87 A;  4KUA A;  3D2M A;  1YGH A;  1QSN A;  3FYN A;  5DWM A;  4ORF A;  2ARH A;  2J8N A;  2BEI A;  5EBV A;  4KZT A;  4NEX A;  4DNC A;  2QEC A;  5IB0 A;  4MJ8 A;  1R57 A;  3DR6 A;  3S6H A;  1V0C A;  2EVN A;  2PQ8 A;  3RYO A;  4QBJ A;  3SHP A;  3TOA A;  2A4N A;  4XNH C;  2FXF A;  5JPH A;  1I1D A;  5KTD A;  4X5K A;  1BO4 A;  3G3S A;  3JVN A;  4HNY B;  2QIR A;  3OWC A;  4CRY B;  1ON0 A;  1Y9K A;  4HNW B;  4II9 A;  2CNM A;  4H6Z A;  2Z0Z A;  4PK2 A;  3DR8 A;  4Y49 B;  1Q2C A; 
#chains in the Genus database with same CATH topology
 2O53 A;  2FCK A;  3T9Y A;  4MFQ A;  2QML A;  2PCU A;  3CT9 A;  2ZEM A;  4QVT A;  5J8F A;  2I79 A;  1U6M A;  2XEG A;  4OIW A;  3PFO A;  1TIQ A;  3BLN A;  2PJ4 A;  2AFX A;  4IHM A;  2IL4 A;  2WYR A;  2WZN A;  1ARL A;  5I4M A;  3H8E A;  3QB8 A;  3D7D A;  3R95 A;  2F8H A;  3CXQ A;  3B7I A;  5HVG A;  5JQ4 A;  1ZLI A;  2NYQ A;  1KZF A;  2BL1 A;  4IK2 A;  4E8O A;  2DPS A;  3D4U A;  4PXD A;  2FE7 A;  5EMI A;  3NE7 A;  4ZY1 A;  3FB3 A;  5D8N A;  3K2K A;  4A37 A;  4YWY A;  2Z10 A;  3CPX A;  4A94 A;  4JYW A;  3IU2 A;  3D8P A;  3ZZI A;  3TO7 A;  3B35 A;  4GS4 A;  5J8C A;  4DJL A;  2CNT A;  4MY3 A;  1RXT A;  4P4F A;  5HVF A;  3WC7 A;  2HV2 A;  1YQE A;  4R57 A;  4BBH A;  1DE4 C;  5FVJ A;  3TO9 A;  1RTQ A;  2PR1 A;  4W9Y A;  2FSR A;  5H86 A;  2PDO A;  4X3R A;  1YW6 A;  2Z3P A;  4TNU A;  2PJ3 A;  2Y0M A;  1MK4 A;  1BLL E;  3FNC A;  3FMC A;  2HC9 A;  3B8G A;  1IYK A;  2V8D A;  3F5B A;  5AG4 A;  4AXV A;  4CAE A;  5HXD A;  2J9A A;  3DSB A;  3GKR A;  5JGF A;  2NMT A;  1CG2 A;  1M4G A;  2G0B A;  2P6F A;  3CXP A;  5AG5 A;  5I0C A;  5HVH A;  4CAF A;  4P4J A;  2I00 A;  1BPN A;  2ZOF A;  5DS0 A;  1WWZ A;  1Y9W A;  5ELY A;  3IEH A;  3CDX A;  3D67 A;  4UBR A;  4I49 A;  4ZY2 A;  4ZGY B;  1LFW A;  1OZP A;  1Y0R A;  2YNC A;  4M6H A;  4HNX B;  1XRY A;  1S7N A;  4KOX A;  1Z5R A;  2AFM A;  2PR8 A;  2XEJ A;  4M85 A;  4YFJ A;  4B11 A;  4LX9 A;  2ZOG A;  3B3W A;  2IMO A;  4FWU A;  1CP7 A;  3WAB A;  1P4N A;  2AFZ A;  2ZED A;  2FS5 A;  4OAD A;  3FEC A;  4OID A;  4B13 A;  3PEI A;  5HMN A;  1XOV A;  4FD6 A;  3BJ8 A;  4MHY A;  4MMO A;  5IB9 A;  4AG7 A;  1TF9 A;  4PXC A;  1Z8L A;  4RUH A;  4Y49 C;  2PJB A;  2ZPA A;  2VBQ A;  1Z8W A;  1XE4 A;  3FVL A;  5KTC A;  8CPA A;  3DGV A;  3PFE A;  4NGP A;  3R96 A;  5F48 A;  1X12 A;  3H8G A;  4PSW A;  3LWU A;  3FBU A;  3KHZ A;  4C68 A;  2CTB A;  5A27 A;  2WSA A;  4KLW A;  4OC0 A;  2Q51 A;  2YNE A;  3V38 A;  4KOU A;  2GLJ A;  2AFS A;  4CAX A;  4CAW A;  2C1C A;  4CYN A;  2B4D B;  2AJ6 A;  1QSM A;  4NGR A;  4OC5 A;  3EO4 A;  4P44 A;  3FEE A;  4R6T A;  5F49 A;  3LMS A;  4B12 A;  4PV6 A;  3GY9 A;  5AG7 A;  4OP4 A;  1A2Z A;  2P6E A;  3S6G A;  3G8W A;  2ABZ A;  3IGR A;  2JDC A;  2ZEP A;  3VAR A;  4OAE A;  1VHS A;  5E96 A;  4R3L A;  1CPX A;  1GYT A;  5A28 A;  3SJX A;  4FAI A;  2ZEF A;  3NA6 A;  2D4P A;  1M4I A;  2R98 A;  3D3S A;  1PU9 A;  3T90 A;  3W6X A;  5ISV A;  3IC1 A;  2POK A;  4OKO A;  4YGO A;  3S6K A;  2Q04 A;  1HEE A;  3BXM A;  1IIC A;  4NFR A;  4DUK A;  1ARM A;  2GRE A;  2ZW5 A;  1XEB A;  1S7L A;  2PJ9 A;  2EK8 A;  1RO5 A;  4KS9 A;  1PCA A;  2HUZ A;  4KSA A;  2OZH A;  4MCQ A;  1ZG8 A;  4OC3 A;  5K8P A;  1Y0Y A;  2KCW A;  4IF5 A;  2ZEO A;  3R9E A;  2G9D A;  4JXR A;  4M6G A;  1Z4E A;  4UFV A;  3SI1 A;  3B3S A;  3D66 A;  3FED A;  3TE4 A;  3KZW A;  3C26 A;  4MFL A;  2ZEN A;  1FY7 A;  4Q36 A;  5H84 A;  3P2F A;  2D4O A;  4WJB A;  4K30 A;  1XJO A;  4H2K A;  4UIB A;  2FT0 A;  4UIA A;  2HB6 A;  4UCN A;  5IX3 A;  2IJZ A;  1Z8X A;  4CS0 B;  3FH4 A;  5JH9 A;  3FRM A;  1M4D A;  4KVM E;  4MCR A;  2FIW A;  3NH8 A;  1PUA A;  1X10 A;  5CBM A;  2G3T A;  1Z4R A;  5F46 A;  2VEZ A;  2X7B A;  1VHO A;  4QUS A;  4U9Y A;  2PRB A;  2CF4 A;  3ZJ0 A;  3P2H A;  4EFD A;  3QAH A;  3VWD A;  3K9T A;  2ZW7 A;  3QAY A;  4MHP A;  3TCV A;  3I9S A;  1SQH A;  2QJ8 A;  4HPS A;  1QSR A;  3IWW A;  2B3U A;  2R7H A;  2Z3O A;  4FD7 A;  3KI9 A;  5G20 A;  1TKH A;  3PB8 X;  2K5T A;  3FXT A;  3B3T A;  1LRZ A;  4R87 A;  4MI4 A;  3FF3 A;  4BD9 A;  3EFA A;  3PB6 X;  2O28 A;  3B3V A;  4KSF A;  4F0Y A;  3TOB A;  5LYL A;  4MY0 A;  2P0W A;  2VXK A;  4NGT A;  4QB9 A;  3I3G A;  3TO6 A;  3N5F A;  4F9V A;  4FBE A;  2PJ5 A;  2EUI A;  2P6G A;  2ATR A;  1MJ9 A;  5LRG A;  1OBR A;  3SJG A;  3NFZ A;  1VHE A;  5K8N A;  2BOA A;  1NE9 A;  2Q4V A;  3NH5 A;  3S9L A;  3L2N A;  1Z8T A;  2J8M A;  1TF8 A;  4AVB A;  2PJC A;  2YGW A;  2OR4 A;  5AGE A;  2WPX A;  3GLJ A;  3E0K A;  1S7K A;  1ELL P;  1LOK A;  4XPK A;  1MJA A;  2JLM A;  3PP9 A;  4EVY A;  4FD5 A;  4FD4 A;  1KUX A;  1N71 A;  4KVO E;  1YVK A;  2OU2 A;  3PGP A;  3A9L A;  4PPZ A;  4CGM A;  1KUV A;  4Z65 A;  4Q38 A;  5D29 A;  2R8V A;  2J8R A;  3TC8 A;  4CGN A;  3BHX A;  1Y7E A;  4CRZ B;  3F0A A;  4C2Y A;  2Q0Y A;  3KQX A;  1NSA A;  2WPW A;  1IYL A;  1HDU A;  3I1U A;  1YRE A;  3B2Y A;  4PXB A;  4MFK A;  3IWG A;  4CGP A;  1EE3 P;  2PIY A;  4KOS A;  3WR7 A;  2Z11 A;  3CXS A;  1GHE A;  3S9N A;  2ZW4 A;  2ZEE A;  2PJ1 A;  1YW4 A;  3WT4 A;  1IGB A;  2FL4 A;  4LQ6 A;  4EWT A;  4A31 A;  5DWN A;  3PRT A;  4JZ0 A;  4NGQ A;  4CPA A;  5C82 A;  3FIX A;  4AVA A;  4BIN A;  1L0C A;  4JLY A;  4NGS A;  1LCP A;  1KWM A;  3KHX A;  4XNH B;  2REE A;  1K4J A;  3D7H A;  4H6U A;  4PK3 A;  2AFO A;  3VWE A;  4ZI6 A;  2QVP A;  4KOW A;  2V8V A;  2B5G B;  2OZU A;  1VGY A;  2PSW A;  1JWQ A;  2RC4 A;  2HQY A;  3KAS A;  1M4L A;  4NSQ A;  4B5P B;  2BSW A;  1M1D A;  2AFU A;  1J4J A;  1S60 A;  1Z2L A;  2PJ8 A;  2DXQ A;  3KR4 A;  4P4I A;  4E2A A;  3ISZ A;  2Q7B A;  5C88 A;  1BPM A;  2PRQ A;  5K8O A;  4CGO A;  3D7G A;  1IB1 E;  1CBX A;  1JQG A;  4O23 A;  3IJ3 A;  2PVV A;  4HKF A;  4NF1 A;  4R8F A;  3R9G A;  3F8K A;  4B5O A;  3SXN A;  1ELM P;  4AB7 A;  2BUE A;  2I3C A;  3LOD A;  3SJE A;  1XBU A;  4PXE A;  4ONW A;  3TX8 A;  5LYD A;  1CP6 A;  4NGM A;  2XEF A;  4OC2 A;  3EC4 A;  2Q4Z A;  4KOT A;  2F7V A;  1S5K A;  3PBB A;  3SI2 A;  2B58 A;  2O4H A;  2C6C A;  1HDQ A;  3EXN A;  4WWV A;  1WK4 A;  2RB7 A;  2H5M A;  2QYV A;  2CY2 A;  3FJU A;  5EC4 A;  3HUV A;  1LAN A;  2CNS A;  1XMB A;  4U5Y A;  3GYA A;  3QNV A;  3VH9 A;  2OB0 A;  1UFH A;  4GM5 A;  4C2X A;  2YND A;  2OH1 A;  1F2P A;  1KUY A;  1XMT A;  3KKW A;  3PB4 X;  4QC6 A;  4F6A A;  1R3N A;  1Q2D A;  3B3C A;  1AUG A;  1S3Z A;  4R7M A;  5G22 A;  4A38 A;  4A39 A;  7CPA A;  4A33 A;  3N7Z A;  3H5Z A;  3DNS A;  4PQA A;  4UWJ A;  2JDD A;  3KL9 A;  4KVX A;  2Z3M A;  3EY5 A;  4KLV A;  3D68 A;  4ZBG A;  1VIX A;  5JM6 A;  5F47 A;  3JUW A;  3PBE A;  4NJR A;  4E0A A;  4A2Z A;  4C2Z A;  5GCN A;  2V8H A;  1CJW A;  3LD2 A;  5LYF A;  2PIZ A;  4YRH A;  3SXO A;  4UCM A;  3JRU A;  2JEV A;  2ZEL A;  2Q4Y A;  3R1K A;  5LRK A;  2PJ0 A;  1F2O A;  4DYO A;  1TXR A;  1IID A;  4JJX A;  4B14 A;  4MHD A;  3LAC A;  4F9U A;  4MCS A;  4UEF A;  4CYO A;  4Y49 B;  3T8W A;  4MHZ A;  1CPS A;  1I12 A;  2VL1 A;  4OLL A;  4UF4 A;  1TKJ A;  3V7Z A;  1YR0 A;  3IIB A;  2V77 A;  4AG9 A;  3MRU A;  2BO9 A;  3BI1 A;  1QMU A;  2AE6 A;  1IU8 A;  3W91 A;  1QST A;  3TFY A;  4ZX9 A;  2B3V A;  4BMH A;  1Q7L A;  4G1P A;  4J3G A;  5AG6 A;  2GLF A;  3PB9 X;  4CGL A;  3KR5 A;  4RI1 A;  4MBU A;  4UEZ A;  3VAT A;  4OME A;  3D2P A;  4M6I A;  1P0H A;  2JBK A;  1FT7 A;  3H4Q A;  3H8F A;  1AYE A;  4RS2 A;  4F8Z A;  4CYQ A;  2BCO A;  1R43 A;  4C7I A;  1CX8 A;  3R9F A;  1PYT B;  1YVO A;  3S6F A;  3WC6 A;  2VZY A;  3V8I A;  3BJ7 A;  4A32 A;  4XPD B;  3KQZ A;  4B6Z A;  4X2T A;  3DLJ A;  2CIJ A;  2Z3L A;  2ZW6 A;  3FX6 A;  4MFZ A;  1YK3 A;  2REF A;  3W6S A;  5K8M A;  2PC1 A;  2PJ2 A;  2Z3N A;  4LUA A;  4UWI A;  4KOY A;  1TKF A;  3IO1 A;  1Z9U A;  4L89 A;  4X8I A;  5HH1 A;  1BOB A;  1CM0 A;  1DTD A;  3TT2 A;  2GE3 A;  4NXY A;  4KOR A;  4PSX A;  2EO8 A;  3K9U A;  4R3K A;  4KUB A;  4RN7 A;  5THW A;  2ZXV A;  6CPA A;  5KTA A;  4ONU A;  1F57 A;  1VKC A;  1YLE A;  3MGD A;  4JD6 A;  4C7H A;  4MCP A;  2EBJ A;  5CNP A;  1S7F A;  4ZYQ A;  3NH4 A;  4XPL A;  4TWE A;  3RAM A;  1ZO0 A;  4P4D A;  1AMP A;  1ZG7 A;  4UFX A;  1I21 A;  4UCP A;  4L8A A;  3PZJ A;  3KGQ A;  2GIV A;  4IUS A;  2OZG A;  2VI7 A;  1YSJ A;  3PB7 X;  4P10 A;  2B4B A;  4P45 A;  3CPA A;  3TTH A;  1XIX A;  4AVC A;  2GAN A;  3D7F A;  1B6B A;  2ZEG A;  1FNO A;  3SI0 A;  1Q2Y A;  2XEI A;  1NMT A;  1QQ9 A;  1YX0 A;  4A30 A;  1NSL A;  3RO0 A;  2Z3K A;  2F5I A;  2FIA A;  1Y7R A;  4MRI A;  4F0X A;  4M3S A;  1XFO A;  3RBU A;  3RNZ A;  4KOV A;  2C27 A;  4B10 A;  3IU1 A;  3WC5 A;  4LQG A;  2VQY A;  3UY5 A;  4UA3 A;  1IOF A;  4ZX8 A;  2C6P A;  4H89 A;  3GB0 A;  1XF8 A;  4NJQ A;  1QSO A;  2B5G A;  2G3A A;  5IV0 A;  2B4D A;  2ANP A;  4B5P A;  4ZY0 A;  4KSI A;  2JBJ A;  2CTC A;  5G1Z A;  2EK9 A;  1IOI A;  2PJA A;  2PJ7 A;  2Q44 A;  2PE3 A;  2EWB A;  4XPD C;  2VZZ A;  3SJF A;  3MN8 A;  1MJB A;  3DDD A;  4JXQ A;  1LAM A;  4MFP A;  3BI0 A;  3GUX A;  4R9M A;  1LAP A;  2R1I A;  3GIU A;  4OC1 A;  4NCZ A;  1H8L A;  1M44 A;  1YLO A;  2Q7S A;  2FVG A;  4P4B A;  4EME A;  4GXH A;  4CAV A;  2RFH A;  2PJ6 A;  4JWP A;  4MFJ A;  4U9Z A;  1B87 A;  4KUA A;  5G21 A;  3D2M A;  1YGH A;  1QSN A;  2ODF A;  3FYN A;  4Q7A A;  4ORF A;  2ARH A;  2V8G A;  5DWM A;  2J8N A;  2NSM A;  3RZA A;  5LRJ A;  2BEI A;  1ZG9 A;  4R76 A;  2C6G A;  3S9M A;  5EBV A;  4KZT A;  3CZX A;  4NEX A;  5J1Q A;  5BWA B;  3HLP A;  2JEW A;  2QEC A;  4YU9 A;  2DF5 A;  4MJ8 A;  4DNC A;  5IB0 A;  1R57 A;  3DR6 A;  4MXU A;  3S6H A;  2YNC C;  2IQ6 A;  1V0C A;  2EVN A;  2PQ8 A;  3IWE A;  2OOT A;  2Q43 A;  5F09 A;  4OC4 A;  4K3N A;  3RYO A;  4QBJ A;  3SHP A;  1BAV A;  4UFW A;  5CPA A;  5LYI A;  3TOA A;  2A4N A;  4FUU A;  2AFW A;  2ZEH A;  4XNH C;  1ZLH A;  2FXF A;  2DPT A;  2PVW A;  4UEE A;  1I1D A;  5JPH A;  5KTD A;  1YME A;  4IAV A;  4X5K A;  2GFQ A;  1IY7 A;  4MHN A;  1BO4 A;  3G3S A;  2GU2 A;  2DEA A;  3JVN A;  4A95 A;  2CXA A;  3JTK A;  4HNY B;  2WUU A;  2QIR A;  3OWC A;  3NE8 A;  1ON0 A;  1UWY A;  1Y9K A;  3IFE A;  4CRY B;  4HNW B;  4CYP A;  4P6Y A;  4II9 A;  4NGN A;  2CNM A;  4P4E A;  4H6Z A;  2Z0Z A;  4PK2 A;  3DR8 A;  3ISX A;  1Q2C A; 
#chains in the Genus database with same CATH homology
 2FCK A;  3T9Y A;  4MFQ A;  2QML A;  4QVT A;  5J8F A;  2I79 A;  1U6M A;  1TIQ A;  3BLN A;  2IL4 A;  3QB8 A;  3R95 A;  3CXQ A;  5JQ4 A;  4E8O A;  1KZF A;  2BL1 A;  2DPS A;  2FE7 A;  3NE7 A;  3FB3 A;  2Z10 A;  3IU2 A;  3D8P A;  3ZZI A;  3TO7 A;  4GS4 A;  5J8C A;  2CNT A;  4MY3 A;  1RXT A;  2HV2 A;  4R57 A;  4BBH A;  5FVJ A;  3TO9 A;  2PR1 A;  2FSR A;  5H86 A;  2PDO A;  2Z3P A;  3FNC A;  2Y0M A;  1MK4 A;  3B8G A;  1IYK A;  3F5B A;  5AG4 A;  4CAE A;  3DSB A;  3GKR A;  2NMT A;  1M4G A;  2G0B A;  2P6F A;  3CXP A;  5AG5 A;  5I0C A;  4CAF A;  2I00 A;  1Y9W A;  1WWZ A;  4UBR A;  4I49 A;  4ZGY B;  1OZP A;  2YNC A;  4HNX B;  4KOX A;  1S7N A;  2PR8 A;  4M85 A;  4YFJ A;  4B11 A;  4LX9 A;  1P4N A;  2FS5 A;  4OAD A;  4B13 A;  5HMN A;  4FD6 A;  3BJ8 A;  4AG7 A;  4Y49 C;  2ZPA A;  2VBQ A;  1XE4 A;  5KTC A;  3R96 A;  5F48 A;  4PSW A;  3FBU A;  4C68 A;  5A27 A;  2WSA A;  4KLW A;  2YNE A;  4KOU A;  4CAX A;  4CAW A;  4CYN A;  2B4D B;  2AJ6 A;  1QSM A;  3EO4 A;  5F49 A;  4B12 A;  4PV6 A;  3GY9 A;  5AG7 A;  3S6G A;  2P6E A;  3G8W A;  3IGR A;  2JDC A;  4OAE A;  1VHS A;  5E96 A;  4R3L A;  5A28 A;  2D4P A;  1M4I A;  2R98 A;  3D3S A;  1PU9 A;  3T90 A;  3W6X A;  5ISV A;  4YGO A;  3S6K A;  2Q04 A;  1IIC A;  2ZW5 A;  1XEB A;  1S7L A;  1RO5 A;  4KS9 A;  2HUZ A;  4KSA A;  2OZH A;  2KCW A;  4IF5 A;  3R9E A;  4JXR A;  1Z4E A;  4UFV A;  3TE4 A;  3C26 A;  4MFL A;  1FY7 A;  4Q36 A;  5H84 A;  3P2F A;  2D4O A;  4K30 A;  2FT0 A;  4UCN A;  5IX3 A;  4CS0 B;  3FRM A;  1M4D A;  4KVM E;  2FIW A;  1PUA A;  2G3T A;  1Z4R A;  5F46 A;  2VEZ A;  2X7B A;  4QUS A;  4U9Y A;  2PRB A;  3ZJ0 A;  3P2H A;  3QAH A;  3VWD A;  2ZW7 A;  3TCV A;  3I9S A;  1SQH A;  1QSR A;  2B3U A;  2R7H A;  2Z3O A;  4FD7 A;  5G20 A;  2K5T A;  3FXT A;  1LRZ A;  4R87 A;  4MI4 A;  3EFA A;  4KSF A;  2O28 A;  4F0Y A;  3TOB A;  4MY0 A;  2P0W A;  2VXK A;  4QB9 A;  3I3G A;  3TO6 A;  2EUI A;  2P6G A;  2ATR A;  1MJ9 A;  1NE9 A;  2Q4V A;  4AVB A;  2J8M A;  2YGW A;  5AGE A;  2WPX A;  3E0K A;  1S7K A;  4XPK A;  1MJA A;  2JLM A;  3PP9 A;  4EVY A;  4FD5 A;  4FD4 A;  1KUX A;  1N71 A;  4KVO E;  1YVK A;  2OU2 A;  3PGP A;  3A9L A;  4CGM A;  1KUV A;  4Q38 A;  2R8V A;  2J8R A;  4CGN A;  4CRZ B;  3F0A A;  4C2Y A;  2Q0Y A;  2WPW A;  1IYL A;  1YRE A;  4MFK A;  3IWG A;  4CGP A;  4KOS A;  3WR7 A;  2Z11 A;  3CXS A;  1GHE A;  2ZW4 A;  2FL4 A;  4A31 A;  5DWN A;  5C82 A;  3FIX A;  4AVA A;  1L0C A;  4JLY A;  4XNH B;  2REE A;  1K4J A;  4H6U A;  4PK3 A;  3VWE A;  4KOW A;  2B5G B;  2OZU A;  2PSW A;  2RC4 A;  4B5P B;  2HQY A;  4NSQ A;  2BSW A;  1M1D A;  1J4J A;  1S60 A;  2DXQ A;  4E2A A;  2Q7B A;  5C88 A;  4CGO A;  1IB1 E;  4HKF A;  4NF1 A;  3R9G A;  4B5O A;  3F8K A;  3SXN A;  4AB7 A;  2BUE A;  3LOD A;  3EC4 A;  4KOT A;  1S5K A;  2B58 A;  3EXN A;  1WK4 A;  2H5M A;  5EC4 A;  2CY2 A;  2CNS A;  4U5Y A;  3GYA A;  2OB0 A;  1UFH A;  4C2X A;  2YND A;  2OH1 A;  1KUY A;  3KKW A;  1XMT A;  4F6A A;  4QC6 A;  1Q2D A;  5G22 A;  1S3Z A;  4A33 A;  3N7Z A;  3H5Z A;  3DNS A;  4UWJ A;  2JDD A;  4KVX A;  2Z3M A;  3EY5 A;  4KLV A;  4ZBG A;  5F47 A;  3JUW A;  4E0A A;  4A2Z A;  4C2Z A;  5GCN A;  1CJW A;  3LD2 A;  3SXO A;  4YRH A;  4UCM A;  2JEV A;  2Q4Y A;  3R1K A;  1IID A;  4JJX A;  4B14 A;  4MHD A;  4CYO A;  1I12 A;  4OLL A;  1YR0 A;  4AG9 A;  2AE6 A;  3W91 A;  1QST A;  3TFY A;  2B3V A;  4BMH A;  4J3G A;  5AG6 A;  4CGL A;  4RI1 A;  4MBU A;  3D2P A;  1P0H A;  3H4Q A;  4RS2 A;  4CYQ A;  4C7I A;  3R9F A;  1YVO A;  3S6F A;  2VZY A;  3V8I A;  3BJ7 A;  4A32 A;  4XPD B;  2Z3L A;  2ZW6 A;  4MFZ A;  1YK3 A;  2REF A;  3W6S A;  2PC1 A;  2Z3N A;  4LUA A;  4UWI A;  4KOY A;  1Z9U A;  4L89 A;  5HH1 A;  1BOB A;  1CM0 A;  3TT2 A;  2GE3 A;  4NXY A;  4KOR A;  4PSX A;  3K9U A;  4R3K A;  4KUB A;  2ZXV A;  5KTA A;  4ONU A;  1VKC A;  1YLE A;  3MGD A;  4JD6 A;  4C7H A;  5CNP A;  1S7F A;  4XPL A;  1ZO0 A;  4UFX A;  1I21 A;  4UCP A;  4L8A A;  3PZJ A;  2GIV A;  4IUS A;  2OZG A;  2VI7 A;  2B4B A;  3TTH A;  1XIX A;  4AVC A;  2GAN A;  1B6B A;  1Q2Y A;  1NMT A;  1YX0 A;  4A30 A;  1NSL A;  2Z3K A;  2F5I A;  2FIA A;  1Y7R A;  4F0X A;  4M3S A;  4KOV A;  2C27 A;  4B10 A;  3IU1 A;  2VQY A;  3UY5 A;  4UA3 A;  4H89 A;  1XF8 A;  1QSO A;  2B5G A;  2G3A A;  5IV0 A;  2B4D A;  4B5P A;  5G1Z A;  2Q44 A;  4XPD C;  2VZZ A;  1MJB A;  3DDD A;  4JXQ A;  4MFP A;  4R9M A;  2R1I A;  4NCZ A;  1M44 A;  4CAV A;  4JWP A;  4MFJ A;  4U9Z A;  1B87 A;  4KUA A;  5G21 A;  3D2M A;  1YGH A;  1QSN A;  3FYN A;  5DWM A;  4ORF A;  2ARH A;  2J8N A;  2BEI A;  5EBV A;  4KZT A;  4NEX A;  5BWA B;  4DNC A;  2QEC A;  5IB0 A;  4MJ8 A;  1R57 A;  3DR6 A;  3S6H A;  2YNC C;  1V0C A;  2EVN A;  2PQ8 A;  3IWE A;  3RYO A;  4QBJ A;  3SHP A;  4UFW A;  3TOA A;  2A4N A;  4XNH C;  2FXF A;  2DPT A;  5JPH A;  1I1D A;  5KTD A;  4X5K A;  1BO4 A;  3G3S A;  3JVN A;  4A95 A;  2CXA A;  3JTK A;  4HNY B;  2WUU A;  2QIR A;  3OWC A;  4CRY B;  1ON0 A;  1Y9K A;  4HNW B;  4CYP A;  4II9 A;  2CNM A;  4H6Z A;  2Z0Z A;  4PK2 A;  3DR8 A;  4Y49 B;  1Q2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...