1IITA

Glur0 ligand binding core complex with l-serine
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
226
structure length
221
Chain Sequence
GSAMALKVGVVGNPPFVFYGAFTGISLDVWRAVAESQKWNSEYVRQNSISAGITAVAEGELDILIGPISVTPERAAIEGITFTQPYFSSGIGLLIPGTATPLFRSVGDLKNKEVAVVRDTTAVDWANFYQADVRETNNLTAAITLLQKKQVEAVMFDRPALIYYTRQNPNLNLEVTEIRVSLEPYGFVLKENSPLQKTINVEMLNLLYSRVIAEFTERWLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms for ligand binding to GluR0 ion channels: crystal structures of the glutamate and serine complexes and a closed apo state.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Membrane protein
molecule keywords Slr1257 protein
total genus 69
structure length 221
sequence length 226
ec nomenclature
pdb deposition date 2001-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iitA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iitA02
4GL8A 3PD9A 1UTBA 4F2OA 1NNFA 1POY1 1DTGA 1AOVA 2Y7KA 3C33A 4FE8A 3EN3A 4NF4B 4XKRA 1Y9UA 3T9UA 2HZKA 3VE1B 2ALUA 3VLUA 4NF6A 2E0SA 1MRPA 5AA2A 4G8NA 1H76A 1P1OA 1M5BA 2DWJA 2Q89A 3B6WA 4I1DA 2XXXA 1Y1MA 2OLBA 1NMUA 3I3VA 5DVJA 4IB2A 3JV9A 1D9YA 4BDOA 5A5XA 1ZU0A 3MVZA 3FGSA 4U2RA 3KOSA 1UIVA 3K01A 4NWCA 3UA8A 3UK4A 3TTKA 1A7LA 3H3GA 3OSQA 1MQJA 2RC8A 4IO7A 3EHSA 5JEIA 1IQ7A 1FTLA 1QW0A 3ONMA 3QK6A 3O66A 4WXJA 4U4XA 1I6AA 1P1QA 3LSFB 2OZZA 3PD8A 4JSOA 5I84A 2B3FA 2V3UA 4O3CA 1A40A 3KN3A 1MH3A 3TTNA 4YB5A 5H8FB 1IIWA 4NF8B 3CFZA 4KYEA 2DXYA 4RK9A 1QULA 4QF9A 1JEVA 1ZMGA 4PFWA 1B5JA 1VR5A 3OD7A 4R2BA 4RNSA 2QS4A 5AA2B 5BWJA 4POWA 2UYFA 2XD2A 1HSJA 3FVNA 3TDJA 3VXBA 2A5TA 3FV2A 1Y1ZA 3OEKA 3K6XA 5KCJB 1MPCA 2GFEA 4G68A 4YB6A 1AMFA 1ZKBA 4QSCA 4G4PA 4OEUA 3K0VA 1Z7NE 3IK6B 4KD5A 4QFNA 4OFLA 4QFOA 4ESWA 2UYEA 4POXA 3A3UA 4JWOA 3C4MA 4YB7A 5EHSA 4IGRA 1R9LA 4N07A 4N13A 4YKPA 3SEWA 4XKQA 4F22A 2VD3A 4NE4A 2OWSA 3FV1A 3FASA 1TXFA 3N94A 3SEXA 1ZTYA 5TP9A 4RK2A 3Q25A 5TPAA 4GIZA 3TTLA 3O6GA 1DSNA 3ZKKA 2VGQA 3U1OA 2OK2A 3PMXA 1Y3NA 1I6QA 1QJMA 1R1NA 1A54A 1SW5A 2UVIA 3E13X 3H06B 3IO6A 1VFEA 4H0WA 1MXYA 4DIGA 2I0BA 1SBPA 1ZLQA 5H8QB 3CIJA 1TFDA 3H4ZA 4OMBA 2R6GE 3BFUA 2V3QA 1A8FA 3C36A 3LSXA 4GXAA 5CC2A 5DT6A 3KOTA 3TELA 3TKDA 2I58A 5TU0A 1VE4A 5LOMA 3IO4A 2X7QA 1JVYA 1QVSA 2DOJA 3IOUA 3CG3A 5FHOA 4NF8A 5TPAB 5EHMA 1BTJA 4H5FA 2ZYOA 3SEUA 4LZ7A 1IXCA 1N7XA 3S9MC 4DXCA 2QS3A 1NFTA 5CRYA 2ESNA 3FVGA 1D9VA 3JZJA 4KI0E 3R6UA 4XKNA 4ZEFA 4E0XA 4EQ9A 2YPNA 4N6PA 4M1VA 4OYVA 1PBPA 3UIFA 2UXAA 4U22A 2XXQA 4ZS9A 1BLFA 2YJPA 4MH5A 3G3GA 4THIA 5HPQA 1MXUA 3S9EA 1M5FA 1XS5A 4IO4A 3RUMA 4EF1A 1ATGA 1S7YA 3BFTA 1O64A 3KEIA 1YTVA 4QSDA 4UA8A 1DOTA 3WAFA 2XX7A 2GHBA 1LLSA 5ICTA 2R71A 4WEPA 1QKAA 5K2XA 2H98A 4G8HA 1B46A 3PUYE 4EF2A 2ZYNA 4C1UA 2V93A 5L8DA 3SDFA 4ELRA 3N26A 4IY6A 4PE5B 5J1DA 1JW4A 3G7WA 5I58A 3MVYA 1WVJA 1URDA 1FCKA 3C32A 4R6YA 3FJ7A 2OWTA 4DDDA 2ONKE 2DSFA 3E3KA 5CMCA 4F3PA 1OQHA 3OO9A 3ZS6A 3VVDA 3K6WA 5BUUA 5IAIA 1LGBC 4R75A 3G3IA 1BIYA 3S4UA 4EQBA 3SEVA 3QUFA 4ISUA 3K4UA 4WKMA 3OSRA 1FTMA 5I2KB 4YZZA 3U94A 3DP6A 5I2NB 3AXFA 3Q28A 3CSBA 1SI0A 3RNNA 3W9WA 3PMVA 2Q2AA 2FA7A 2W7YA 1N7WA 5H8SA 1GGGA 4X1BA 3IB1A 4DZ1A 4ECFA 1NH7A 2QRYA 3T96B 3TYHA 1XT8A 1RYXA 3K1MA 3U93A 1JETA 3HSTA 4JBZA 2H99A 2F34A 2PBWA 3FATA 4RA1A 3DELB 3A09A 2ZMBA 1Y4TA 4R9FA 3O28A 3ILUB 1GTKA 2F8DA 1GR2A 3C9HA 2Q2CA 2ZYKA 3KJ7A 4OEVA 4RY1A 5TP9B 1IXGA 3TPAA 3KN7A 1B4HA 4ELPA 5A5XB 5KZTA 5L9SA 2F35A 3OXNA 2NXOA 1XHYA 3KBRA 4XTCQ 1USYH 5FHNA 4F3BA 3OENA 3V89B 2HXWA 4OFOA 4KYSA 3MPKA 3MQ9A 3PGFA 4FEBA 4NF4A 5CMBA 4DCXA 4ELOA 1NKXA 3G3KA 1XVXA 2OCUA 3THIA 1J1NA 4KCCA 2BJJX 3Q26A 4ZEKA 1OMPA 1UTBB 3PPRA 3GBAA 4PQJA 1B9JA 3ODBA 3B6TA 3C34A 4M4GA 5H8HB 4FATA 1O63A 2Z22A 1AH5A 4JWYA 4K3FA 4OVJA 2Q8JA 2ONRA 2NVUB 3VVFA 1MY2A 2P0SA 3T9VA 3B6QA 4X9TA 4MFIA 3OO7A 3RT8A 4PFUA 3TZAA 2Z23A 5DEXA 4JB7A 1ZJLA 3T93B 4ELQA 1TWYA 5AA4B 2RINA 3CFXA 2IEEA 3K02A 1A8EA 3FXQA 3K6VA 3HPIA 4KYDA 2A5SA 4RXLA 3U92A 2Y7IA 2H5YA 2F7AA 5K2YA 4KCDA 4NTLA 1SI1A 1CE2A 2CZLA 3VLVA 3M8UA 4G2ZA 4F1VA 1DMBA 1NNKA 2Y84A 2I3VA 3RTFB 1QUKA 1US5A 3TQLA 5HM4B 1PB8A 2DWAA 1LCTA 3M3KA 4H1XA 4PP0A 5L9MA 3D4GA 3KG2A 1AIVA 2O69A 3OOAA 3OELA 3CVGA 3OEMA 4I62A 3T9HB 4BLAA 4DXUA 3EQ1A 4NF5B 1LFIA 3VDFA 2P2AA 4QFLA 2AIXA 2KLFA 2X26A 3H6VA 4GF8A 1N3WA 3HHGA 4KHZE 3O2AA 5CBRA 2HAUA 4Q30B 1A99A 4X48A 1FTJA 1IXIA 2HZLA 3PPNA 5ICQA 2DXRA 3RLFE 4ZE9A 3TAJA 1B5IA 3PPOA 4F1UA 2I48A 3MJNA 5CI5A 1MPDA 3O6IA 4GRKA 5ITPA 2B65A 4GXSB 4LZ8A 4AB5A 5AE4A 3DP8A 1LFGA 1LBBA 4YICA 4LVQA 3PPQA 4KQPA 3D4CA 1UTHB 3M3FA 4PFYA 5ISUA 2HQ0A 4GL0A 3FVKA 1IITA 1PB7A 2VP1A 3MW0A 3O9PA 4OESA 2I0CA 1B05A 3RTWB 3U72A 1Y4CA 3U8QA 1ZIUA 2PMSA 3SKPA 4H67A 2O84X 3R26A 4IO3A 1Y20A 4OZ9A 3UGWA 2QJEA 2RC9A 3IOTA 5JK4A 4ZEDA 3TTRA 1LFHA 1FTKA 1B7ZA 1BP5A 1B2HA 4FEDA 3K2DA 1JNFA 1L5TA 1OLAA 4R72A 1POTA 3UP9A 2PT2A 3KN8A 4QFKA 3PMWA 5I2NA 4F18A 1MH4A 2F78A 1CB6A 2XHDA 1B1HA 3HV1A 3IAZA 3H7MA 1VFDA 2F7BA 4OERA 1BKAA 3TCGA 1ANFA 5CMKA 2ZYMA 2YLNA 3GLBA 5AA2D 4H5GA 2DWHA 1B3LA 1SW4A 1MDQA 4TOZA 1B4ZA 3EHTA 1URSA 2GH9A 1MY4A 1OIBA 2ONSA 3CRBA 3PPPA 2PT1A 4I8CA 1XC1A 4QHQA 3N6UA 2RF1A 5CBSA 2D5WA 1SW1A 1OVTA 1JEUA 2Q88A 4ZE8A 1PBQA 3HN0A 4R73A 1XOCA 4E0WA 1NNTA 4LZ5A 2ZNUA 3KSXA 3RGYA 1HSLA 3MPLA 1FTOA 1D3KA 4KR5A 1I6BA 4O3AA 2F6GA 3O97A 4JSDA 4R74A 1MDP1 2XXRA 1F9BA 3IB0A 1ZBMA 3PU5A 3Q27A 4KFQA 2NOOA 4P0GA 3L6HA 1QKBA 5DEXB 1DTZA 1N84A 2AYSA 1Q35A 3CI8A 1SQYA 3KFMA 4I9DA 4R9GA 1SYHA 4R2FA 4BDMA 3S9NC 2XXIA 1UIUA 2Z8FA 4KPTA 4NMYA 4OXVA 5I59B 3ILTB 4OQOA 4EUOA 5H8NB 4GOTA 4LATA 1B0HA 1DPPA 2QL3A 3CG1A 3ZKLA 2Z8DA 1P1WA 4DE8A 3P7IA 1NL5A 2DYXA 4QSEA 5IKBA 3IOWA 5I2KA 4MBPA 1SW2A 2QMWA 2ZNTA 3MP6A 3TTMA 3VXCA 2E1SA 2XX8A 4FORA 1NNPA 1SD3A 1SVXB 4LONB 3UORA 4NF5A 4FECA 1GVCA 2XXUA 4YMAA 2I4BA 4O3BA 3LC8A 3VVEA 4GD5A 1S9TA 3A3CA 5I59A 2O51A 4PETA 4TLMB 5FTIA 1B32A 4GVOA 4H65A 3FZVA 4ZDMA 3RY3A 3H6WA 4U21A 4C1TA 4F39A 3IJOB 3E4RA 2ZNSA 4MF3A 1N76A 2DE3A 4QRZA 3RPWA 3W9VA 4C0RA 1EZPA 4OTEA 2FNCA 4BDNA 5M2VA 1YPNA 2VD2A 4Q8RA 3B7DA 2DP8A 2G29A 5AA3A 3SESA 4ESXA 1US4A 2HAVA 1RYOA 2XXPA 1TFAA 3KZGA 1PEBA 2AL5A 3LBSA 3M3LA 3PV0E 4IY5A 4MLQA 3MWBA 4ONYA 5JTYB 4QFPA 1B5HA 2QS1A 3H6TA 4NEDA 1R9QA 4HW8A 2DQVA 3O29A 5H8FA 2D3IA 1II5A 1B0LA 2F7CA 3UN6A 4F31B 5KCJA 1LBCA 1H3DA 3LSLA 3JYRA 3Q29A 1I69A 2OJTA 4G8MA 1LAXA 2XXHA 5I58B 1H45A 3FJMA 3QSLA 4U1ZA 4AQ4A 1FQCA 4BDRA 3CSGA 1NH8A 2D21A 3HO7A 4G77A 4YKKA 1DPEA 1YCJA 2NWJA 1B6HA 4JWXA 3V8XB 4F2QA 1FQEA 1JVXA 5F7VA 1MY0A 3G3FA 3OO8A 4LA9A 3LR1A 5F1QA 3USDA 3WAEA 4IO2A 1UTHA 4HCYA 4EDPA 4U4SA 2I6EA 2P1SA 3PUXE 4H8JA 3S9LC 1B40A 1PB9A 2XX9A 3GZGA 3I6VA 4PFTA 2DS9A 2GRVA 4JDFA 3PUVE 1R6ZA 3T9XB 4F1YA 2DE4A 5H8QA 4L17A 1N04A 1MM7A 3C31A 1SDXA 4ND9A 2G93A 5EYFA 1EH3A 2Q9TA 3SERA 4Z7EA 2O6AA 1MQDA 3LSWA 1MS7A 3TFLA 1LB8A 1LAFE 2QMXA 1LAHE 1RKMA 2V25A 3HHFA 3T22A 5B7DA 3IL1B 2XXYA 3G3HA 3N6TA 4OWDA 3TEPA 1USYE 2XXVA 5AA4A 2F5XA 2H4IA 3KSJA 1B7HA 3K6UA 2QS2A 3OMBA 3I5OA 5CM6A 3OO6A 1N0TA 4OHNA 1WODA 4XXUA 1O7TA 3BKIB 3IR1A 2GHAA 1LCFA 3FUZA 3H6UA 3O6HA 4FJPA 4YMBA 1MQIA 2RC7A 1B58A 5AA1A 1IXHA 3MZBA 1LAGE 2X7PA 1JQFA 4Z0IA 3V83A 4LP2B 3EHUA 2R9JA 3VLWA 4LQ2A 3IB2A 1MQGA 4GWOA 2F97A 4R6KA 3F11A 1H43A 1M5CA 3FXUA 1QUJA 2LAOA 5HBCA 5DVIA 1AL3A 2F6PA 3FJGA 3MUQA 4NWDA 2AL4A 4RYAA 4UACA 3IOVA 3SEYA 1MM6A 3FVOA 4AB6A 2XXWA 4BDLA 5CMMA 2DE2A 1D4NA 3DLNA 3ECRA 3FXRA 3MBPA 3LUYA 5L9OA 2RCBA 4RJZA 5FTHA 3QXMA 1Q1KA 2NUVA 3W15C 4DLDA 1EU8A 4HTGA 1OVBA 1P99A 2UVGA 2ZXTA 4Q0CA 1MXVA 1JW1A 4XIGQ 1B1XA 5DVFA 1WDNA 1UQWA 3QIMA 3TUSA 5DTBA 4H6DA 4ZZEA 1P1UA 4F29A 1MPBA 3N5LA 3S2VA 1MXWA 3GXAA 3KJTA 3G3JA 1B3EA 4DCYA 2V84A 4F3GA 1M5DA 4RPOA 1XVYA 1FQDA 5JTYA 5KDTA 4RPNA 2H9BA 1B7UA 2UVJA 2O1LA 3IX1A 3CR9A 5ITOA 3TODA 5I56B 2REJA 2FYIA 2IA4A 3K00A 3MP1A 1GV8A 3VV5A 1MXZA 4F3SA 1LB9A 3IORA 2H25A 1TT1A 4TLLB 1MY3A 4YAHX 5B70A 1T0KA 5H8HA 4G68C 3H03A 2A5TB 4ZEBA 3C35A 1HSEA 2M8CA 2Y7PA 2XD3A 3L6GA 3MP8A 2CMOA 3QAXA 3FD3A 2I3WA 3KGCA 4FIMA 1JW5A 4P11A 4TQUQ 3FIRA 4H8IA 1Y3QA 2V3TA 3GBBA 4XKPA 5FHMA 1FQAA 3BBRA 2QPQA 4MLVA 3VFJA 1LSTA 1ELJA 4IO5A 4U23A 4YKIA 3EF7A 2WKYA 4ZEIA 1SYIA 4ZECA 3DP4A 4NF6B 2PYYA 4BDQA 3SETA 3MAMA 4HS7A 4P0IA 4X1DA 1MY1A 1M5EA 4YU0A 3K1PA 1OLCA 1FQFA 3CFLA 3DM0A 1B3FA 2DWIA 1Z7ME 3MC2A 2O7UA 1H44A 4R6HA 5H8NA 3T66A 4LUBA 4G68B 4EXKA 4FAJA 1PDAA 3HCQA 2HCAA 3ZSFA 4EXLA 5I57A 5I56A 2RCAA 1IEJA 4OENA 1Y3PA 1B52A 1MG1A 3MZ9A 3RN8A 2PVUA 1IUDA 4OFJA 5KDTB 3QYTA 4F19A 3PUWE 4HCWA 2F36A 4IGTA 2VOZA 4U1OA 4Q5TA 5DYHA 3R7XA 2I49A 3MZ1A 3RT6B 3TMGA 1VSOA 2HFBA 3E9XA 2PX1A 1URGA 2RKMA 2DVZA 1MQHA 4GLIA 3TCFA 2Y7WA 2OBGA 2I4CA 3EPEA 4DXBA 2VHAA 4GFRA 2ABHA 3MVXA 4GQOA 4OETA 2Z8EA 1B3GA 1FQBA 1MXXA 1EZ9A 4ZZAA 2ANJA 3QUJA 4WEDA 1PC3A 1YAEA 1S50A 2O7IA 2THIA 1OQGA 2XXTA 2B3BA 1KWHA 2HEUA 2DVCA 3TQWA 4IO6A 1IZ1A 1N3XA 5ELVA 1A55A 2QSXA 1FW0A 3MVWA 1B3HA 3IJXB 4LQ5A 2O68A 1QUIA 1EZOA 1B51A 3RQTA 4YKJA 2O1MA 1P1NA 2UVHA 2Y7RA 3PUZE 4EQ7A 4JXIA 3K1NA 2REGA 3V5AA 5I57B 3TCHA
chains in the Genus database with same CATH superfamily
1POY1 3FBPA 3IFAA 3EN3A 1Y9UA 3VE1B 4G8NA 1M5BA 3B6WA 1Y1MA 4HXVA 3I3VA 4PF8A 3K01A 3EHSA 1IQ7A 3ONMA 3O66A 3LSFB 2V4CA 4O3CA 5H8FB 4PCDA 1IIWA 4NF8B 1QULA 3TDJA 2A5TA 3FV2A 4JVIA 1AMFA 1Z7NE 4PF6A 4QFOA 2UYEA 4JWOA 3C4MA 4YB7A 3SEWA 1FRPA 4N13A 2OWSA 1EYIA 3O6GA 3ZKKA 2VGQA 3PMXA 3RLFE 1SW5A 4OMBA 1A8FA 3C36A 4GXAA 5CC2A 5DT6A 2I58A 2X7QA 1JVYA 3IOUA 1FBEA 5FHOA 2ZYOA 2FIXA 3B8BA 2QS3A 4U22A 4ZS9A 1BLFA 4MH5A 1M5FA 4XF5A 4IO4A 3WAFA 2R71A 1QKAA 2H98A 5EQ7A 5F24A 4PE5B 3G7WA 3MVYA 1FCKA 3C32A 4R6YA 3FJ7A 4NX1A 3E3KA 4F3PA 5IZ3B 1OQHA 5FBPA 1SI0A 2Q2AA 1N7WA 1QGXA 2QRYA 3T96B 1XT8A 3HSTA 2PBWA 3A09A 2ZMBA 1Y4TA 1CNQA 2F3DA 3O28A 4R9FA 3C9HA 3KJ7A 2Q2CA 5TP9B 3KN7A 4GBVA 1IMBA 2F35A 3OXNA 1RDZA 3OENA 3V89B 4UABA 2OCUA 4JVDA 2WYKA 1B9JA 4M4GA 4FATA 5H8HB 2Z22A 4OVJA 3VVFA 3T9VA 3B6QA 4MFIA 3RT8A 5T3JA 3TZAA 2Z23A 5DEXA 3T93B 4ELQA 1TWYA 3K02A 4PFRA 2H5YA 4KCDA 3NOHA 1CE2A 1FBPA 3TQLA 3A29A 2I3VA 4GWXA 1QUKA 1AIVA 4PFIA 1NV4A 3CVGA 3T9HB 2P2AA 4GF8A 2KLFA 2QVVA 2HZLA 5ICQA 2DXRA 3MSTA 3PPOA 4F1UA 3MJNA 2B65A 4GXSB 4AB5A 5AE4A 1LBBA 5ET8A 3PPQA 3D4CA 3M3FA 4PFYA 4GL0A 4DI4B 1IITA 1PB7A 2PMSA 4H67A 2O84X 2RC9A 3TTRA 1FTKA 1L5TA 2PT2A 3KN8A 3IAZA 1B1HA 4OERA 1BKAA 2DWHA 1B3LA 4MMPA 1B4ZA 1MY4A 2PT1A 2D5WA 2Q88A 1JEUA 4ZE8A 2VPOA 4I40A 3RGYA 1HSLA 3MPLA 4R74A 3IB0A 3Q27A 2HXRA 4P0GA 3L6HA 1QKBA 4R9GA 3CI8A 1SQYA 1SYHA 2ZZVA 4KPTA 1B0HA 2QL3A 1P1WA 3P7IA 5I2KA 3TTMA 3VXCA 2VT5A 4LONB 1GVCA 1RDXA 1LBXA 3VVEA 1KZ8A 4GVOA 4H65A 3H6WA 4PE3A 4U21A 5ET5A 3E4RA 4C0RA 1EZPA 4OTEA 1YPNA 2G29A 3SESA 2XXPA 2AL5A 3MWBA 1B5HA 2DQVA 3O29A 2ZZXA 4F31B 5KCJA 4PGPA 2OJTA 3FJMA 1FQCA 4BDRA 3CSGA 2D21A 4YKKA 4F2QA 1DPEA 1YCJA 1B6HA 3LR1A 3S9LC 2P1SA 3PUXE 4H8JA 1B40A 3I6VA 2DS9A 4F1YA 4N15A 2XWVA 2DE4A 2MKZA 1NI9A 1SDXA 4ND9A 2G93A 3SERA 1MQDA 4MJOA 1MS7A 3HHFA 2V25A 3T22A 3N6TA 4OWDA 3KSJA 2H4IA 1B7HA 3K6UA 2QS2A 4O8MA 1O7TA 3BKIB 2L5VA 3H6UA 2RC7A 3MZBA 2XXKA 1LAGE 5EQAA 4LQ2A 3F11A 3FXUA 1QUJA 3IFCA 4UACA 3IOVA 3SEYA 3FVOA 2XXWA 1FBGA 2QFLA 4DLDA 1EU8A 1P99A 2UVGA 1JW1A 1B1XA 5DVFA 4F29A 1MPBA 1B3EA 4DCYA 2V84A 4F3GA 1M5DA 2H9BA 4F3SA 1G0HA 4NF0A 2H25A 1TT1A 4TLLB 1MY3A 5H8HA 4G68C 2CZHA 2CMOA 1JW5A 4TQUQ 1Y3QA 3GBBA 4MLVA 1LSTA 4FBPA 4IO5A 2WKYA 1FJ6A 4ZEIA 1SYIA 4ZECA 3MAMA 4X1DA 1FQFA 4ZE9A 1B3FA 2DWIA 1Z7ME 4R6HA 2O7UA 1H44A 4G68B 3HCQA 4EXLA 1IEJA 3MZ9A 4F19A 4IGTA 4Q5TA 3RT6B 1VSOA 2HFBA 1URGA 1MQHA 2I4CA 2P3VA 4DXBA 5EQ9A 1MXXA 2ANJA 4PC9A 1OQGA 5ELVA 2QSXA 1SPIA 1FTAA 2O68A 1EZOA 4YKJA 4JXIA 3PD9A 1NNFA 2Y7KA 4XKRA 4GWUA 5J1DA 2ALUA 3VLUA 4NF6A 2Q89A 3JV9A 2KR0A 3UA8A 3OSQA 2CEXA 5JEIA 2XWOA 1QW0A 1FTLA 4I3EA 4U4XA 1I6AA 1P1QA 3PD8A 4P1EA 4I3YA 1IMCA 4YB5A 3CFZA 4KYEA 2DXYA 4QF9A 5BWJA 1NV0A 3OD7A 2QS4A 3VXBA 3OEKA 3K6XA 5IZ1A 2GFEA 4QSCA 4G4PA 1FSAA 3A3UA 1NUZA 4N07A 4XKQA 4RK2A 4GIZA 1DSNA 2OK2A 1I6QA 1QJMA 1R1NA 2UVIA 4H0WA 4DIGA 1FBCA 1MXYA 2I0BA 1ZLQA 2R6GE 2V3QA 3KOTA 1KA1A 1NV5A 4MNCA 5TPAB 4H5FA 4LZ7A 3D1RA 3FVGA 1FPBA 3JZJA 4XKNA 4E0XA 2YPNA 4N6PA 3RPLA 3UIFA 2YJPA 5ET7A 4EF1A 3RUMA 1S7YA 3BFTA 1O64A 3KEIA 1YTVA 5K2XA 1B46A 4EF2A 5DW8A 2V93A 3SDFA 4O7MA 1JW4A 3E78A 5I58A 1WVJA 1URDA 4LN5A 4PFBA 2OWTA 1K9ZA 2DSFA 2ONKE 5CMCA 3VVDA 3G3IA 4NG7A 3SEVA 3QUFA 3OSRA 1FTMA 2P3NA 3DP6A 3W9WA 4DZ1A 1GGGA 4X1BA 3K1MA 3U93A 2H99A 3DELB 5IGAA 2Y5LA 1GTKA 2F8DA 4RY1A 5LOMA 5I84A 2ZYKA 4ELPA 1B4HA 5KZTA 4F3BA 1XHYA 2HXWA 4KYSA 4NF4A 5CMBA 1J1NA 4KCCA 2BJJX 4OA4A 4ZEKA 3PPRA 3GBAA 4PQJA 3ROJA 3B6TA 3C34A 4GWSA 1O63A 1AH5A 1MY2A 2P0SA 4PBHA 3BIGA 5EQ8A 4R72A 5CI5A 4RXLA 3HPIA 4GBWA 1KA0A 1SI1A 3M8UA 4F1VA 3RTFB 1US5A 4JVCA 1PB8A 1LCTA 4H1XA 3OOAA 4BLAA 4DXUA 4NF5B 1LFIA 3VDFA 4QFLA 1RDYA 3O2AA 1A99A 4X48A 5ESYA 1B5IA 3O6IA 4MNPA 4GRKA 5ITPA 4NAPA 4N4UA 1B05A 1Y4CA 3R26A 4IO3A 3UGWA 1Y20A 2QJEA 3IOTA 4ZEDA 1LFHA 4NHBA 2F78A 1CB6A 2XHDA 2F7BA 4QXDA 5CMKA 3GLBA 5AA2D 4H5GA 1MDQA 3EHTA 1OIBA 4PTKA 3CRBA 4QFPA 5CBSA 1XC1A 3BIHA 1PBQA 4R73A 4MCOA 1FPJA 1I6BA 4O3AA 3O97A 4JSDA 4Q30B 2XXRA 1ZBMA 2NOOA 1DTZA 1N84A 2HPGA 4BDMA 4NMYA 4OXVA 5I59B 4OQOA 4LATA 1DPPA 3CG1A 2Z8DA 2DYXA 3IOWA 3SZPA 3UORA 4FECA 4YMAA 4GD5A 5I59A 4TLMB 5FTIA 3FZVA 4ZDMA 1K9YA 4PAKA 1FPGA 2VD2A 3B7DA 2DP8A 5AA3A 4ESXA 1US4A 2HAVA 3PV0E 3M3LA 1LEVA 2QS1A 4NEDA 1R9QA 4X8RA 2D3IA 1II5A 1B0LA 3UN6A 3LSLA 2XXHA 3QSLA 4U1ZA 4DE8A 1NH8A 1JVXA 2CZIA 4LA9A 5F1QA 3USDA 4IO2A 1UTHA 4HCYA 4EDPA 4PFTA 5H8QA 3T0JA 4XEQA 4Z7EA 2PCRA 1LAHE 2WX9A 2XXYA 1USYE 2XXVA 1LBVA 5CM6A 1WODA 4XXUA 1FJ9A 2GHAA 3O6HA 3FUZA 1MQIA 4PBQA 1JQFA 4Z0IA 3EHUA 3IB2A 4GWOA 1H43A 4G61A 5DVIA 4IR8A 2F6PA 4NWDA 1MM6A 4BDLA 2DE2A 3MBPA 3FXRA 5IZ3A 5FTHA 4HTGA 4XIGQ 3TUSA 4H6DA 2WBDA 1MXWA 4OVRA 5JTYA 1XVYA 4N6DA 4DI3D 5I56B 2FYIA 4P56A 1MXZA 1IMEA 4NN3A 5B70A 1T0KA 4YAHX 3H03A 4MEVA 2M8CA 3MP8A 2XD3A 3L6GA 3EF7A 4HS7A 4P0IA 2FBPA 1M5EA 3K1PA 3ZSFA 5I57A 4NQ8A 4NGUA 4OENA 1IUDA 5KDTB 3ISPA 3R7XA 3E9XA 3U94A 2OBGA 3MVXA 1B3GA 1EZ9A 4WEDA 2O7IA 1KWHA 2HEUA 3TQWA 1IZ1A 3IJXB 4LQ5A 1QUIA 1B51A 2Y7RA 3K1NA 2REGA 1BK4A 3V5AA 4GL8A 1UTBA 1DTGA 3C33A 4FE8A 2R8TA 4P3LA 3T9UA 2HZKA 1FPFA 2E0SA 1H76A 4I1DA 2XXXA 1NMUA 4IB2A 2BJIA 4BDOA 5A5XA 1ZU0A 3MVZA 4U2RA 3KOSA 1UIVA 3TTKA 1A7LA 3H3GA 1MQJA 2RC8A 4IO7A 4WXJA 2B3FA 1A40A 1MH3A 3TTNA 1JEVA 4PFWA 2XD2A 1HSJA 1NV7A 3FVNA 1DK4A 1FPEA 5KCJB 4G68A 1ZKBA 4OEUA 3K0VA 5ET6A 3IK6B 4KD5A 4QFNA 4OFLA 4ESWA 4POXA 1Q9DA 5EHSA 4IGRA 1R9LA 4YKPA 4NE4A 5A5LA 3FASA 1ZTYA 3Q25A 5TPAA 3U1OA 3E13X 3H06B 3SEXA 1A54A 3IO6A 4F22A 5H8QB 1SBPA 3CIJA 1TFDA 3H4ZA 3BFUA 3LSXA 5TU0A 3IO4A 1QVSA 2DOJA 5EHMA 1IXCA 3S9MC 1NFTA 1INPA 5CRYA 1G0IA 1D9VA 4AS4A 4EQ9A 2CZKA 1XI6A 4M1VA 4PAFA 3G3GA 3S9EA 1MXUA 1XS5A 1ATGA 4QSDA 2XX7A 2GHBA 1LLSA 4WEPA 4G8HA 2KQZA 4C1UA 3N26A 4IY6A 3K6WA 1D9QA 1LGBC 4EQBA 3S4UA 4ISUA 4WKMA 4YZZA 5I5PA 4N91A 5I2NB 3RNNA 2FA7A 5H8SA 3IB1A 2ZZWA 4ECFA 3TYHA 1RYXA 1JETA 1IMFA 4OEVA 5A5XB 4XTCQ 2NXOA 3KBRA 5FHNA 3MQ9A 4FEBA 5I3SA 3Q26A 1OMPA 1UTBB 3ODBA 4MX6A 4JWYA 4OVPA 4X9TA 3OO7A 4QBAA 1ZJLA 5LDZA 5AA4B 3CFXA 2IEEA 3K6VA 1A8EA 3FXQA 3U92A 4KYDA 2A5SA 2F7AA 4NTLA 3VLVA 1DMBA 1NNKA 4PP0A 2DWAA 1NUYA 3M3KA 4I62A 3OEMA 1NUWA 3E79A 5CBRA 4KHZE 1FTJA 4OANA 3PTYA 3PPNA 3TAJA 2I48A 3DP8A 1LFGA 4YICA 4LVQA 4KQPA 1UTHB 5ISUA 2HQ0A 2I0CA 3RTWB 3U72A 3U8QA 4GX6A 3KC1A 4OZ9A 1BP5A 1B2HA 4FEDA 3K2DA 4QFKA 5I2NA 1FPKA 4F18A 1MH4A 4ZEFA 3HV1A 3H7MA 1VFDA 2XWKA 4N6KA 3LV0A 2ZYMA 2YLNA 3KBZA 1SW4A 4TOZA 4XFEA 1URSA 2GH9A 2ONSA 4I8CA 3N6UA 2RF1A 1YXIA 3HN0A 4LZ5A 2ZNUA 4KR5A 2F6GA 4KFQA 4ZZEA 3KFMA 4I9DA 1Q35A 5IM2A 3S9NC 1UIUA 2Z8FA 3HFUA 3EKIA 5IKBA 4MBPA 3MP6A 2ZNTA 1NNPA 1SVXB 2XXUA 2I4BA 4P47A 4O3BA 3LC8A 2F3BA 3A3CA 1EYJA 2O51A 1B32A 4GWZA 3IJOB 2ZNSA 4MF3A 1N76A 3RPWA 4BDNA 2FNCA 5M2VA 3KZGA 4ONYA 4HW8A 1H3DA 3Q29A 1I69A 5I58B 1H45A 3HO7A 4JWXA 1FQEA 3WAEA 2I6EA 1PB9A 3GZGA 2GRVA 3PUVE 3T9XB 4L17A 1N04A 4P9KA 1EH3A 5EYFA 2O6AA 1LAFE 2QMXA 4N81A 3IL1B 3G3HA 2VPNA 2F5XA 1FBFA 3OMBA 3I5OA 3OO6A 1N0TA 4OHNA 3IR1A 1B58A 5AA1A 1IXHA 1DBZA 2X7PA 2FHYA 4LP2B 3VLWA 1MQGA 1M5CA 5HBCA 2LAOA 3FJGA 3MUQA 2AL4A 1FPLA 2PFZA 3DLNA 1D4NA 3QXMA 1Q1KA 2NUVA 3W15C 1JP4A 2QVRA 1OVBA 2WYPA 1UQWA 3QIMA 5DTBA 3KJTA 4RPOA 5KDTA 1FQDA 4RPNA 2UVJA 1B7UA 3IX1A 5ITOA 3CR9A 2REJA 1GV8A 3VV5A 2OWZA 2A5TB 3C35A 3QAXA 3FD3A 4FIMA 2FVZA 3FIRA 4H8IA 4XKPA 5FHMA 1FQAA 3BBRA 2QPQA 3VFJA 1ELJA 4U23A 4NF6B 2PYYA 1MY1A 1OLCA 3MC2A 4LUBA 4EXKA 4AS5A 1PDAA 5I56A 3RN8A 3KC0A 2GQ1A 4HCWA 1AWBA 2VOZA 3TMGA 5H8FA 2PX1A 4GLIA 3EPEA 2VHAA 4GFRA 2ABHA 4GQOA 4HE1A 4OETA 2CEYA 1FPDA 3QUJA 1PC3A 1YAEA 2THIA 2OX3A 2XXTA 1FW0A 3MVWA 4HE0A 2QVUA 4MAGA 2O1MA 3RYDA 3TCHA 4F2OA 1AOVA 4NF4B 1MRPA 1P1OA 2DWJA 1NV3A 2OLBA 5DVJA 1D9YA 3FGSA 4NWCA 1NV2A 3UK4A 3QK6A 4KXPA 4JSOA 2OZZA 5LTCA 2V3UA 4N8GA 3KN3A 4RK9A 1ZMGA 2WBBA 4R2BA 1B5JA 1VR5A 4RNSA 5AA2B 4POWA 2UYFA 1Y1ZA 1MPCA 4YB6A 4PAIA 2VD3A 3FV1A 1TXFA 3N94A 5TP9A 3TTLA 1Y3NA 1VFEA 2B4MA 1YYZA 3TELA 3TKDA 1VE4A 3CG3A 4NF8A 4HE2A 1BTJA 3SEUA 1N7XA 5IZZA 4DXCA 4MIJA 2ESNA 4KI0E 3R6UA 4OYVA 1PBPA 2UXAA 2XXQA 4THIA 5HPQA 1IMAA 1EYKA 4GWYA 4UA8A 1DOTA 3T1BA 3PUYE 2ZYNA 5L8DA 4OVTA 4ELRA 2Q74A 4DDDA 3OO9A 3ZS6A 5BUUA 4R75A 1BIYA 3K4UA 5I2KB 3AXFA 3Q28A 3CSBA 4H45A 3PMVA 2W7YA 3GYYA 4P8BA 1NH7A 4JBZA 2F34A 3FATA 4RA1A 1LBYA 3ILUB 1GR2A 1IXGA 2PFYA 3TPAA 5L9SA 1USYH 2Y5KA 4OFOA 4ELOA 3MPKA 3PGFA 4DCXA 2Q8MA 1FPIA 1NKXA 3G3KA 1XVXA 3THIA 1NV1A 5IAIA 3V83A 2Q8JA 2NVUB 4K3FA 2ONRA 4MHFA 4N8YA 4PFUA 4JB7A 2RINA 1LBWA 2Y7IA 5K2YA 3MYUA 2CZLA 3RPLB 4G2ZA 2Y84A 5HM4B 5L9MA 3D4GA 3KG2A 2O69A 3OELA 3EQ1A 2XWIA 2AIXA 3H6VA 2X26A 1N3WA 3HHGA 2HAUA 1IXIA 1MPDA 1IMDA 4LZ8A 3FVKA 2VP1A 3MW0A 3O9PA 4OESA 1YZ0A 1ZIUA 3SKPA 1B7ZA 1FBDA 1JNFA 1LBZA 1OLAA 1POTA 3UP9A 3PMWA 4O7IA 4GX4A 5ICTA 4GX3A 3TCGA 1ANFA 4QHQA 3PPPA 1SW1A 1OVTA 2WEFA 1XOCA 4E0WA 1NNTA 3KSXA 1FTOA 1D3KA 1MDP1 3PU5A 1F9BA 5JK4A 5DEXB 2AYSA 4R2FA 2XXIA 2B4LA 3ILTB 2FIEA 3B50A 4EUOA 5H8NB 4GOTA 3ZKLA 1NL5A 4QSEA 1SW2A 2QMWA 2E1SA 2XX8A 4FORA 1SD3A 4NF5A 1S9TA 5I7IA 4PETA 3RY3A 4F39A 4C1TA 2DE3A 4QRZA 3W9VA 4Q8RA 1RYOA 1TFAA 1PEBA 3LBSA 4IY5A 3QMFA 4MLQA 5JTYB 4PDDA 3H6TA 1DCUA 1FBHA 2F7CA 3CHGA 1LBCA 3JYRA 4G8MA 1LAXA 5AA2A 4AQ4A 4G77A 2NWJA 3V8XB 5F7VA 1MY0A 3G3FA 3OO8A 4U4SA 2XX9A 3FXBA 4JDFA 1R6ZA 5J16A 4P1LA 4PGNA 1MM7A 3C31A 4H46A 2Q9TA 2HHMA 5EYHA 2XA5A 3LSWA 3TFLA 1NV6A 1LB8A 1RKMA 5B7DA 3TEPA 5AA4A 4OVSA 1LCFA 4FJPA 4YMBA 2R9JA 2F97A 4O94A 4R6KA 1AL3A 4RYAA 4AB6A 2JJKA 5CMMA 5L9OA 3ECRA 3LUYA 2RCBA 4RJZA 4OVQA 3LUZA 2ZXTA 4Q0CA 1MXVA 5EYGA 1WDNA 1P1UA 4GWWA 3S2VA 3N5LA 3GXAA 3G3JA 2O1LA 3TODA 2IA4A 3K00A 3MP1A 4X04A 1LB9A 3IORA 4ZEBA 1HSEA 2Y7PA 2I3WA 3KGCA 4P11A 3U65A 2V3TA 4YKIA 4N17A 4PDHA 3DP4A 4BDQA 3SETA 4YU0A 3DM0A 3CFLA 3T66A 5H8NA 4FAJA 2HCAA 2RCAA 1Y3PA 1B52A 1MG1A 4MNIA 2PVUA 4OFJA 3QYTA 3PUWE 2F36A 2DDKA 4U1OA 5DYHA 2I49A 3MZ1A 2RKMA 2DVZA 3TCFA 2Y7WA 2Z8EA 1FQBA 4ZZAA 1S50A 2B3BA 2DVCA 4IO6A 1N3XA 1A55A 1B3HA 3RQTA 3PUZE 1P1NA 2UVHA 4EQ7A 1VDWA 5I57B 1NUXA
chains in the Genus database with same CATH topology
4GL8A 3PD9A 1UTBA 4F2OA 1NNFA 1POY1 1DTGA 1AOVA 2Y7KA 3C33A 4FE8A 3EN3A 4NF4B 4XKRA 1Y9UA 3T9UA 2HZKA 3VE1B 2ALUA 3VLUA 4NF6A 2E0SA 1MRPA 5AA2A 4G8NA 1H76A 1P1OA 1M5BA 2DWJA 2Q89A 3B6WA 4I1DA 2XXXA 1Y1MA 2OLBA 1NMUA 3I3VA 5DVJA 4IB2A 3JV9A 1D9YA 4BDOA 5A5XA 1ZU0A 3MVZA 3FGSA 4U2RA 3KOSA 1UIVA 3K01A 4NWCA 3UA8A 3UK4A 3TTKA 1A7LA 3H3GA 3OSQA 1MQJA 2RC8A 4IO7A 3EHSA 5JEIA 1IQ7A 1FTLA 1QW0A 3ONMA 3QK6A 3O66A 4WXJA 4U4XA 1I6AA 1P1QA 3LSFB 2OZZA 3PD8A 4JSOA 5I84A 2B3FA 2V3UA 4O3CA 1A40A 3KN3A 1MH3A 3TTNA 4YB5A 5H8FB 1IIWA 4NF8B 3CFZA 4KYEA 2DXYA 4RK9A 1QULA 4QF9A 1JEVA 1ZMGA 4PFWA 1B5JA 1VR5A 3OD7A 4R2BA 4RNSA 2QS4A 5AA2B 5BWJA 4POWA 2UYFA 2XD2A 1HSJA 3FVNA 3TDJA 3VXBA 2A5TA 3FV2A 1Y1ZA 3OEKA 3K6XA 5KCJB 1MPCA 2GFEA 4G68A 4YB6A 1AMFA 1ZKBA 4QSCA 4G4PA 4OEUA 3K0VA 1Z7NE 3IK6B 4KD5A 4QFNA 4OFLA 4QFOA 4ESWA 2UYEA 4POXA 3A3UA 4JWOA 3C4MA 4YB7A 5EHSA 4IGRA 1R9LA 4N07A 4N13A 4YKPA 3SEWA 4XKQA 4F22A 2VD3A 4NE4A 2OWSA 3FV1A 3FASA 1TXFA 3N94A 3SEXA 1ZTYA 5TP9A 4RK2A 3Q25A 5TPAA 4GIZA 3TTLA 3O6GA 1DSNA 3ZKKA 2VGQA 3U1OA 2OK2A 3PMXA 1Y3NA 1I6QA 1QJMA 1R1NA 1A54A 1SW5A 2UVIA 3E13X 3H06B 3IO6A 1VFEA 4H0WA 1MXYA 4DIGA 2I0BA 1SBPA 1ZLQA 5H8QB 3CIJA 1TFDA 3H4ZA 4OMBA 2R6GE 3BFUA 2V3QA 1A8FA 3C36A 3LSXA 4GXAA 5CC2A 5DT6A 3KOTA 3TELA 3TKDA 2I58A 5TU0A 1VE4A 5LOMA 3IO4A 2X7QA 1JVYA 1QVSA 2DOJA 3IOUA 3CG3A 5FHOA 4NF8A 5TPAB 5EHMA 1BTJA 4H5FA 2ZYOA 3SEUA 4LZ7A 1IXCA 1N7XA 3S9MC 4DXCA 2QS3A 1NFTA 5CRYA 2ESNA 3FVGA 1D9VA 3JZJA 4KI0E 3R6UA 4XKNA 4ZEFA 4E0XA 4EQ9A 2YPNA 4N6PA 4M1VA 4OYVA 1PBPA 3UIFA 2UXAA 4U22A 2XXQA 4ZS9A 1BLFA 2YJPA 4MH5A 3G3GA 4THIA 5HPQA 1MXUA 3S9EA 1M5FA 1XS5A 4IO4A 3RUMA 4EF1A 1ATGA 1S7YA 3BFTA 1O64A 3KEIA 1YTVA 4QSDA 4UA8A 1DOTA 3WAFA 2XX7A 2GHBA 1LLSA 5ICTA 2R71A 4WEPA 1QKAA 5K2XA 2H98A 4G8HA 1B46A 3PUYE 4EF2A 2ZYNA 4C1UA 2V93A 5L8DA 3SDFA 4ELRA 3N26A 4IY6A 4PE5B 5J1DA 1JW4A 3G7WA 5I58A 3MVYA 1WVJA 1URDA 1FCKA 3C32A 4R6YA 3FJ7A 2OWTA 4DDDA 2ONKE 2DSFA 3E3KA 5CMCA 4F3PA 1OQHA 3OO9A 3ZS6A 3VVDA 3K6WA 5BUUA 5IAIA 1LGBC 4R75A 3G3IA 1BIYA 3S4UA 4EQBA 3SEVA 3QUFA 4ISUA 3K4UA 4WKMA 3OSRA 1FTMA 5I2KB 4YZZA 3U94A 3DP6A 5I2NB 3AXFA 3Q28A 3CSBA 1SI0A 3RNNA 3W9WA 3PMVA 2Q2AA 2FA7A 2W7YA 1N7WA 5H8SA 1GGGA 4X1BA 3IB1A 4DZ1A 4ECFA 1NH7A 2QRYA 3T96B 3TYHA 1XT8A 1RYXA 3K1MA 3U93A 1JETA 3HSTA 4JBZA 2H99A 2F34A 2PBWA 3FATA 4RA1A 3DELB 3A09A 2ZMBA 1Y4TA 4R9FA 3O28A 3ILUB 1GTKA 2F8DA 1GR2A 3C9HA 2Q2CA 2ZYKA 3KJ7A 4OEVA 4RY1A 5TP9B 1IXGA 3TPAA 3KN7A 1B4HA 4ELPA 5A5XB 5KZTA 5L9SA 2F35A 3OXNA 2NXOA 1XHYA 3KBRA 4XTCQ 1USYH 5FHNA 4F3BA 3OENA 3V89B 2HXWA 4OFOA 4KYSA 3MPKA 3MQ9A 3PGFA 4FEBA 4NF4A 5CMBA 4DCXA 4ELOA 1NKXA 3G3KA 1XVXA 2OCUA 3THIA 1J1NA 4KCCA 2BJJX 3Q26A 4ZEKA 1OMPA 1UTBB 3PPRA 3GBAA 4PQJA 1B9JA 3ODBA 3B6TA 3C34A 4M4GA 5H8HB 4FATA 1O63A 2Z22A 1AH5A 4JWYA 4K3FA 4OVJA 2Q8JA 2ONRA 2NVUB 3VVFA 1MY2A 2P0SA 3T9VA 3B6QA 4X9TA 4MFIA 3OO7A 3RT8A 4PFUA 3TZAA 2Z23A 5DEXA 4JB7A 1ZJLA 3T93B 4ELQA 1TWYA 5AA4B 2RINA 3CFXA 2IEEA 3K02A 1A8EA 3FXQA 3K6VA 3HPIA 4KYDA 2A5SA 4RXLA 3U92A 2Y7IA 2H5YA 2F7AA 5K2YA 4KCDA 4NTLA 1SI1A 1CE2A 2CZLA 3VLVA 3M8UA 4G2ZA 4F1VA 1DMBA 1NNKA 2Y84A 2I3VA 3RTFB 1QUKA 1US5A 3TQLA 5HM4B 1PB8A 2DWAA 1LCTA 3M3KA 4H1XA 4PP0A 5L9MA 3D4GA 3KG2A 1AIVA 2O69A 3OOAA 3OELA 3CVGA 3OEMA 4I62A 3T9HB 4BLAA 4DXUA 3EQ1A 4NF5B 1LFIA 3VDFA 2P2AA 4QFLA 2AIXA 2KLFA 2X26A 3H6VA 4GF8A 1N3WA 3HHGA 4KHZE 3O2AA 5CBRA 2HAUA 4Q30B 1A99A 4X48A 1FTJA 1IXIA 2HZLA 3PPNA 5ICQA 2DXRA 3RLFE 4ZE9A 3TAJA 1B5IA 3PPOA 4F1UA 2I48A 3MJNA 5CI5A 1MPDA 3O6IA 4GRKA 5ITPA 2B65A 4GXSB 4LZ8A 4AB5A 5AE4A 3DP8A 1LFGA 1LBBA 4YICA 4LVQA 3PPQA 4KQPA 3D4CA 1UTHB 3M3FA 4PFYA 5ISUA 2HQ0A 4GL0A 3FVKA 1IITA 1PB7A 2VP1A 3MW0A 3O9PA 4OESA 2I0CA 1B05A 3RTWB 3U72A 1Y4CA 3U8QA 1ZIUA 2PMSA 3SKPA 4H67A 2O84X 3R26A 4IO3A 1Y20A 4OZ9A 3UGWA 2QJEA 2RC9A 3IOTA 5JK4A 4ZEDA 3TTRA 1LFHA 1FTKA 1B7ZA 1BP5A 1B2HA 4FEDA 3K2DA 1JNFA 1L5TA 1OLAA 4R72A 1POTA 3UP9A 2PT2A 3KN8A 4QFKA 3PMWA 5I2NA 4F18A 1MH4A 2F78A 1CB6A 2XHDA 1B1HA 3HV1A 3IAZA 3H7MA 1VFDA 2F7BA 4OERA 1BKAA 3TCGA 1ANFA 5CMKA 2ZYMA 2YLNA 3GLBA 5AA2D 4H5GA 2DWHA 1B3LA 1SW4A 1MDQA 4TOZA 1B4ZA 3EHTA 1URSA 2GH9A 1MY4A 1OIBA 2ONSA 3CRBA 3PPPA 2PT1A 4I8CA 1XC1A 4QHQA 3N6UA 2RF1A 5CBSA 2D5WA 1SW1A 1OVTA 1JEUA 2Q88A 4ZE8A 1PBQA 3HN0A 4R73A 1XOCA 4E0WA 1NNTA 4LZ5A 2ZNUA 3KSXA 3RGYA 1HSLA 3MPLA 1FTOA 1D3KA 4KR5A 1I6BA 4O3AA 2F6GA 3O97A 4JSDA 4R74A 1MDP1 2XXRA 1F9BA 3IB0A 1ZBMA 3PU5A 3Q27A 4KFQA 2NOOA 4P0GA 3L6HA 1QKBA 5DEXB 1DTZA 1N84A 2AYSA 1Q35A 3CI8A 1SQYA 3KFMA 4I9DA 4R9GA 1SYHA 4R2FA 4BDMA 3S9NC 2XXIA 1UIUA 2Z8FA 4KPTA 4NMYA 4OXVA 5I59B 3ILTB 4OQOA 4EUOA 5H8NB 4GOTA 4LATA 1B0HA 1DPPA 2QL3A 3CG1A 3ZKLA 2Z8DA 1P1WA 4DE8A 3P7IA 1NL5A 2DYXA 4QSEA 5IKBA 3IOWA 5I2KA 4MBPA 1SW2A 2QMWA 2ZNTA 3MP6A 3TTMA 3VXCA 2E1SA 2XX8A 4FORA 1NNPA 1SD3A 1SVXB 4LONB 3UORA 4NF5A 4FECA 1GVCA 2XXUA 4YMAA 2I4BA 4O3BA 3LC8A 3VVEA 4GD5A 1S9TA 3A3CA 5I59A 2O51A 4PETA 4TLMB 5FTIA 1B32A 4GVOA 4H65A 3FZVA 4ZDMA 3RY3A 3H6WA 4U21A 4C1TA 4F39A 3IJOB 3E4RA 2ZNSA 4MF3A 1N76A 2DE3A 4QRZA 3RPWA 3W9VA 4C0RA 1EZPA 4OTEA 2FNCA 4BDNA 5M2VA 1YPNA 2VD2A 4Q8RA 3B7DA 2DP8A 2G29A 5AA3A 3SESA 4ESXA 1US4A 2HAVA 1RYOA 2XXPA 1TFAA 3KZGA 1PEBA 2AL5A 3LBSA 3M3LA 3PV0E 4IY5A 4MLQA 3MWBA 4ONYA 5JTYB 4QFPA 1B5HA 2QS1A 3H6TA 4NEDA 1R9QA 4HW8A 2DQVA 3O29A 5H8FA 2D3IA 1II5A 1B0LA 2F7CA 3UN6A 4F31B 5KCJA 1LBCA 1H3DA 3LSLA 3JYRA 3Q29A 1I69A 2OJTA 4G8MA 1LAXA 2XXHA 5I58B 1H45A 3FJMA 3QSLA 4U1ZA 4AQ4A 1FQCA 4BDRA 3CSGA 1NH8A 2D21A 3HO7A 4G77A 4YKKA 1DPEA 1YCJA 2NWJA 1B6HA 4JWXA 3V8XB 4F2QA 1FQEA 1JVXA 5F7VA 1MY0A 3G3FA 3OO8A 4LA9A 3LR1A 5F1QA 3USDA 3WAEA 4IO2A 1UTHA 4HCYA 4EDPA 4U4SA 2I6EA 2P1SA 3PUXE 4H8JA 3S9LC 1B40A 1PB9A 2XX9A 3GZGA 3I6VA 4PFTA 2DS9A 2GRVA 4JDFA 3PUVE 1R6ZA 3T9XB 4F1YA 2DE4A 5H8QA 4L17A 1N04A 1MM7A 3C31A 1SDXA 4ND9A 2G93A 5EYFA 1EH3A 2Q9TA 3SERA 4Z7EA 2O6AA 1MQDA 3LSWA 1MS7A 3TFLA 1LB8A 1LAFE 2QMXA 1LAHE 1RKMA 2V25A 3HHFA 3T22A 5B7DA 3IL1B 2XXYA 3G3HA 3N6TA 4OWDA 3TEPA 1USYE 2XXVA 5AA4A 2F5XA 2H4IA 3KSJA 1B7HA 3K6UA 2QS2A 3OMBA 3I5OA 5CM6A 3OO6A 1N0TA 4OHNA 1WODA 4XXUA 1O7TA 3BKIB 3IR1A 2GHAA 1LCFA 3FUZA 3H6UA 3O6HA 4FJPA 4YMBA 1MQIA 2RC7A 1B58A 5AA1A 1IXHA 3MZBA 1LAGE 2X7PA 1JQFA 4Z0IA 3V83A 4LP2B 3EHUA 2R9JA 3VLWA 4LQ2A 3IB2A 1MQGA 4GWOA 2F97A 4R6KA 3F11A 1H43A 1M5CA 3FXUA 1QUJA 2LAOA 5HBCA 5DVIA 1AL3A 2F6PA 3FJGA 3MUQA 4NWDA 2AL4A 4RYAA 4UACA 3IOVA 3SEYA 1MM6A 3FVOA 4AB6A 2XXWA 4BDLA 5CMMA 2DE2A 1D4NA 3DLNA 3ECRA 3FXRA 3MBPA 3LUYA 5L9OA 2RCBA 4RJZA 5FTHA 3QXMA 1Q1KA 2NUVA 3W15C 4DLDA 1EU8A 4HTGA 1OVBA 1P99A 2UVGA 2ZXTA 4Q0CA 1MXVA 1JW1A 4XIGQ 1B1XA 5DVFA 1WDNA 1UQWA 3QIMA 3TUSA 5DTBA 4H6DA 4ZZEA 1P1UA 4F29A 1MPBA 3N5LA 3S2VA 1MXWA 3GXAA 3KJTA 3G3JA 1B3EA 4DCYA 2V84A 4F3GA 1M5DA 4RPOA 1XVYA 1FQDA 5JTYA 5KDTA 4RPNA 2H9BA 1B7UA 2UVJA 2O1LA 3IX1A 3CR9A 5ITOA 3TODA 5I56B 2REJA 2FYIA 2IA4A 3K00A 3MP1A 1GV8A 3VV5A 1MXZA 4F3SA 1LB9A 3IORA 2H25A 1TT1A 4TLLB 1MY3A 4YAHX 5B70A 1T0KA 5H8HA 4G68C 3H03A 2A5TB 4ZEBA 3C35A 1HSEA 2M8CA 2Y7PA 2XD3A 3L6GA 3MP8A 2CMOA 3QAXA 3FD3A 2I3WA 3KGCA 4FIMA 1JW5A 4P11A 4TQUQ 3FIRA 4H8IA 1Y3QA 2V3TA 3GBBA 4XKPA 5FHMA 1FQAA 3BBRA 2QPQA 4MLVA 3VFJA 1LSTA 1ELJA 4IO5A 4U23A 4YKIA 3EF7A 2WKYA 4ZEIA 1SYIA 4ZECA 3DP4A 4NF6B 2PYYA 4BDQA 3SETA 3MAMA 4HS7A 4P0IA 4X1DA 1MY1A 1M5EA 4YU0A 3K1PA 1OLCA 1FQFA 3CFLA 3DM0A 1B3FA 2DWIA 1Z7ME 3MC2A 2O7UA 1H44A 4R6HA 5H8NA 3T66A 4LUBA 4G68B 4EXKA 4FAJA 1PDAA 3HCQA 2HCAA 3ZSFA 4EXLA 5I57A 5I56A 2RCAA 1IEJA 4OENA 1Y3PA 1B52A 1MG1A 3MZ9A 3RN8A 2PVUA 1IUDA 4OFJA 5KDTB 3QYTA 4F19A 3PUWE 4HCWA 2F36A 4IGTA 2VOZA 4U1OA 4Q5TA 5DYHA 3R7XA 2I49A 3MZ1A 3RT6B 3TMGA 1VSOA 2HFBA 3E9XA 2PX1A 1URGA 2RKMA 2DVZA 1MQHA 4GLIA 3TCFA 2Y7WA 2OBGA 2I4CA 3EPEA 4DXBA 2VHAA 4GFRA 2ABHA 3MVXA 4GQOA 4OETA 2Z8EA 1B3GA 1FQBA 1MXXA 1EZ9A 4ZZAA 2ANJA 3QUJA 4WEDA 1PC3A 1YAEA 1S50A 2O7IA 2THIA 1OQGA 2XXTA 2B3BA 1KWHA 2HEUA 2DVCA 3TQWA 4IO6A 1IZ1A 1N3XA 5ELVA 1A55A 2QSXA 1FW0A 3MVWA 1B3HA 3IJXB 4LQ5A 2O68A 1QUIA 1EZOA 1B51A 3RQTA 4YKJA 2O1MA 1P1NA 2UVHA 2Y7RA 3PUZE 4EQ7A 4JXIA 3K1NA 2REGA 3V5AA 5I57B 3TCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GL8 A;  3PD9 A;  1UTB A;  4F2O A;  1NNF A;  1POY 1;  1DTG A;  1AOV A;  2Y7K A;  3C33 A;  4FE8 A;  3EN3 A;  4NF4 B;  4XKR A;  1Y9U A;  3T9U A;  2HZK A;  3VE1 B;  2ALU A;  3VLU A;  4NF6 A;  2E0S A;  1MRP A;  5AA2 A;  4G8N A;  1H76 A;  1P1O A;  1M5B A;  2DWJ A;  2Q89 A;  3B6W A;  4I1D A;  2XXX A;  1Y1M A;  2OLB A;  1NMU A;  3I3V A;  5DVJ A;  4IB2 A;  3JV9 A;  1D9Y A;  4BDO A;  5A5X A;  1ZU0 A;  3MVZ A;  3FGS A;  4U2R A;  3KOS A;  1UIV A;  3K01 A;  4NWC A;  3UA8 A;  3UK4 A;  3TTK A;  1A7L A;  3H3G A;  3OSQ A;  1MQJ A;  2RC8 A;  4IO7 A;  3EHS A;  5JEI A;  1IQ7 A;  1FTL A;  1QW0 A;  3ONM A;  3QK6 A;  3O66 A;  4WXJ A;  4U4X A;  1I6A A;  1P1Q A;  3LSF B;  2OZZ A;  3PD8 A;  4JSO A;  5I84 A;  2B3F A;  2V3U A;  4O3C A;  1A40 A;  3KN3 A;  1MH3 A;  3TTN A;  4YB5 A;  5H8F B;  1IIW A;  4NF8 B;  3CFZ A;  4KYE A;  2DXY A;  4RK9 A;  1QUL A;  4QF9 A;  1JEV A;  1ZMG A;  4PFW A;  1B5J A;  1VR5 A;  3OD7 A;  4R2B A;  4RNS A;  2QS4 A;  5AA2 B;  5BWJ A;  4POW A;  2UYF A;  2XD2 A;  1HSJ A;  3FVN A;  3TDJ A;  3VXB A;  2A5T A;  3FV2 A;  1Y1Z A;  3OEK A;  3K6X A;  5KCJ B;  1MPC A;  2GFE A;  4G68 A;  4YB6 A;  1AMF A;  1ZKB A;  4QSC A;  4G4P A;  4OEU A;  3K0V A;  1Z7N E;  3IK6 B;  4KD5 A;  4QFN A;  4OFL A;  4QFO A;  4ESW A;  2UYE A;  4POX A;  3A3U A;  4JWO A;  3C4M A;  4YB7 A;  5EHS A;  4IGR A;  1R9L A;  4N07 A;  4N13 A;  4YKP A;  3SEW A;  4XKQ A;  4F22 A;  2VD3 A;  4NE4 A;  2OWS A;  3FV1 A;  3FAS A;  1TXF A;  3N94 A;  3SEX A;  1ZTY A;  5TP9 A;  4RK2 A;  3Q25 A;  5TPA A;  4GIZ A;  3TTL A;  3O6G A;  1DSN A;  3ZKK A;  2VGQ A;  3U1O A;  2OK2 A;  3PMX A;  1Y3N A;  1I6Q A;  1QJM A;  1R1N A;  1A54 A;  1SW5 A;  2UVI A;  3E13 X;  3H06 B;  3IO6 A;  1VFE A;  4H0W A;  1MXY A;  4DIG A;  2I0B A;  1SBP A;  1ZLQ A;  5H8Q B;  3CIJ A;  1TFD A;  3H4Z A;  4OMB A;  2R6G E;  3BFU A;  2V3Q A;  1A8F A;  3C36 A;  3LSX A;  4GXA A;  5CC2 A;  5DT6 A;  3KOT A;  3TEL A;  3TKD A;  2I58 A;  5TU0 A;  1VE4 A;  5LOM A;  3IO4 A;  2X7Q A;  1JVY A;  1QVS A;  2DOJ A;  3IOU A;  3CG3 A;  5FHO A;  4NF8 A;  5TPA B;  5EHM A;  1BTJ A;  4H5F A;  2ZYO A;  3SEU A;  4LZ7 A;  1IXC A;  1N7X A;  3S9M C;  4DXC A;  2QS3 A;  1NFT A;  5CRY A;  2ESN A;  3FVG A;  1D9V A;  3JZJ A;  4KI0 E;  3R6U A;  4XKN A;  4ZEF A;  4E0X A;  4EQ9 A;  2YPN A;  4N6P A;  4M1V A;  4OYV A;  1PBP A;  3UIF A;  2UXA A;  4U22 A;  2XXQ A;  4ZS9 A;  1BLF A;  2YJP A;  4MH5 A;  3G3G A;  4THI A;  5HPQ A;  1MXU A;  3S9E A;  1M5F A;  1XS5 A;  4IO4 A;  3RUM A;  4EF1 A;  1ATG A;  1S7Y A;  3BFT A;  1O64 A;  3KEI A;  1YTV A;  4QSD A;  4UA8 A;  1DOT A;  3WAF A;  2XX7 A;  2GHB A;  1LLS A;  5ICT A;  2R71 A;  4WEP A;  1QKA A;  5K2X A;  2H98 A;  4G8H A;  1B46 A;  3PUY E;  4EF2 A;  2ZYN A;  4C1U A;  2V93 A;  5L8D A;  3SDF A;  4ELR A;  3N26 A;  4IY6 A;  4PE5 B;  5J1D A;  1JW4 A;  3G7W A;  5I58 A;  3MVY A;  1WVJ A;  1URD A;  1FCK A;  3C32 A;  4R6Y A;  3FJ7 A;  2OWT A;  4DDD A;  2ONK E;  2DSF A;  3E3K A;  5CMC A;  4F3P A;  1OQH A;  3OO9 A;  3ZS6 A;  3VVD A;  3K6W A;  5BUU A;  5IAI A;  1LGB C;  4R75 A;  3G3I A;  1BIY A;  3S4U A;  4EQB A;  3SEV A;  3QUF A;  4ISU A;  3K4U A;  4WKM A;  3OSR A;  1FTM A;  5I2K B;  4YZZ A;  3U94 A;  3DP6 A;  5I2N B;  3AXF A;  3Q28 A;  3CSB A;  1SI0 A;  3RNN A;  3W9W A;  3PMV A;  2Q2A A;  2FA7 A;  2W7Y A;  1N7W A;  5H8S A;  1GGG A;  4X1B A;  3IB1 A;  4DZ1 A;  4ECF A;  1NH7 A;  2QRY A;  3T96 B;  3TYH A;  1XT8 A;  1RYX A;  3K1M A;  3U93 A;  1JET A;  3HST A;  4JBZ A;  2H99 A;  2F34 A;  2PBW A;  3FAT A;  4RA1 A;  3DEL B;  3A09 A;  2ZMB A;  1Y4T A;  4R9F A;  3O28 A;  3ILU B;  1GTK A;  2F8D A;  1GR2 A;  3C9H A;  2Q2C A;  2ZYK A;  3KJ7 A;  4OEV A;  4RY1 A;  5TP9 B;  1IXG A;  3TPA A;  3KN7 A;  1B4H A;  4ELP A;  5A5X B;  5KZT A;  5L9S A;  2F35 A;  3OXN A;  2NXO A;  1XHY A;  3KBR A;  4XTC Q;  1USY H;  5FHN A;  4F3B A;  3OEN A;  3V89 B;  2HXW A;  4OFO A;  4KYS A;  3MPK A;  3MQ9 A;  3PGF A;  4FEB A;  4NF4 A;  5CMB A;  4DCX A;  4ELO A;  1NKX A;  3G3K A;  1XVX A;  2OCU A;  3THI A;  1J1N A;  4KCC A;  2BJJ X;  3Q26 A;  4ZEK A;  1OMP A;  1UTB B;  3PPR A;  3GBA A;  4PQJ A;  1B9J A;  3ODB A;  3B6T A;  3C34 A;  4M4G A;  5H8H B;  4FAT A;  1O63 A;  2Z22 A;  1AH5 A;  4JWY A;  4K3F A;  4OVJ A;  2Q8J A;  2ONR A;  2NVU B;  3VVF A;  1MY2 A;  2P0S A;  3T9V A;  3B6Q A;  4X9T A;  4MFI A;  3OO7 A;  3RT8 A;  4PFU A;  3TZA A;  2Z23 A;  5DEX A;  4JB7 A;  1ZJL A;  3T93 B;  4ELQ A;  1TWY A;  5AA4 B;  2RIN A;  3CFX A;  2IEE A;  3K02 A;  1A8E A;  3FXQ A;  3K6V A;  3HPI A;  4KYD A;  2A5S A;  4RXL A;  3U92 A;  2Y7I A;  2H5Y A;  2F7A A;  5K2Y A;  4KCD A;  4NTL A;  1SI1 A;  1CE2 A;  2CZL A;  3VLV A;  3M8U A;  4G2Z A;  4F1V A;  1DMB A;  1NNK A;  2Y84 A;  2I3V A;  3RTF B;  1QUK A;  1US5 A;  3TQL A;  5HM4 B;  1PB8 A;  2DWA A;  1LCT A;  3M3K A;  4H1X A;  4PP0 A;  5L9M A;  3D4G A;  3KG2 A;  1AIV A;  2O69 A;  3OOA A;  3OEL A;  3CVG A;  3OEM A;  4I62 A;  3T9H B;  4BLA A;  4DXU A;  3EQ1 A;  4NF5 B;  1LFI A;  3VDF A;  2P2A A;  4QFL A;  2AIX A;  2KLF A;  2X26 A;  3H6V A;  4GF8 A;  1N3W A;  3HHG A;  4KHZ E;  3O2A A;  5CBR A;  2HAU A;  4Q30 B;  1A99 A;  4X48 A;  1FTJ A;  1IXI A;  2HZL A;  3PPN A;  5ICQ A;  2DXR A;  3RLF E;  4ZE9 A;  3TAJ A;  1B5I A;  3PPO A;  4F1U A;  2I48 A;  3MJN A;  5CI5 A;  1MPD A;  3O6I A;  4GRK A;  5ITP A;  2B65 A;  4GXS B;  4LZ8 A;  4AB5 A;  5AE4 A;  3DP8 A;  1LFG A;  1LBB A;  4YIC A;  4LVQ A;  3PPQ A;  4KQP A;  3D4C A;  1UTH B;  3M3F A;  4PFY A;  5ISU A;  2HQ0 A;  4GL0 A;  3FVK A;  1IIT A;  1PB7 A;  2VP1 A;  3MW0 A;  3O9P A;  4OES A;  2I0C A;  1B05 A;  3RTW B;  3U72 A;  1Y4C A;  3U8Q A;  1ZIU A;  2PMS A;  3SKP A;  4H67 A;  2O84 X;  3R26 A;  4IO3 A;  1Y20 A;  4OZ9 A;  3UGW A;  2QJE A;  2RC9 A;  3IOT A;  5JK4 A;  4ZED A;  3TTR A;  1LFH A;  1FTK A;  1B7Z A;  1BP5 A;  1B2H A;  4FED A;  3K2D A;  1JNF A;  1L5T A;  1OLA A;  4R72 A;  1POT A;  3UP9 A;  2PT2 A;  3KN8 A;  4QFK A;  3PMW A;  5I2N A;  4F18 A;  1MH4 A;  2F78 A;  1CB6 A;  2XHD A;  1B1H A;  3HV1 A;  3IAZ A;  3H7M A;  1VFD A;  2F7B A;  4OER A;  1BKA A;  3TCG A;  1ANF A;  5CMK A;  2ZYM A;  2YLN A;  3GLB A;  5AA2 D;  4H5G A;  2DWH A;  1B3L A;  1SW4 A;  1MDQ A;  4TOZ A;  1B4Z A;  3EHT A;  1URS A;  2GH9 A;  1MY4 A;  1OIB A;  2ONS A;  3CRB A;  3PPP A;  2PT1 A;  4I8C A;  1XC1 A;  4QHQ A;  3N6U A;  2RF1 A;  5CBS A;  2D5W A;  1SW1 A;  1OVT A;  1JEU A;  2Q88 A;  4ZE8 A;  1PBQ A;  3HN0 A;  4R73 A;  1XOC A;  4E0W A;  1NNT A;  4LZ5 A;  2ZNU A;  3KSX A;  3RGY A;  1HSL A;  3MPL A;  1FTO A;  1D3K A;  4KR5 A;  1I6B A;  4O3A A;  2F6G A;  3O97 A;  4JSD A;  4R74 A;  1MDP 1;  2XXR A;  1F9B A;  3IB0 A;  1ZBM A;  3PU5 A;  3Q27 A;  4KFQ A;  2NOO A;  4P0G A;  3L6H A;  1QKB A;  5DEX B;  1DTZ A;  1N84 A;  2AYS A;  1Q35 A;  3CI8 A;  1SQY A;  3KFM A;  4I9D A;  4R9G A;  1SYH A;  4R2F A;  4BDM A;  3S9N C;  2XXI A;  1UIU A;  2Z8F A;  4KPT A;  4NMY A;  4OXV A;  5I59 B;  3ILT B;  4OQO A;  4EUO A;  5H8N B;  4GOT A;  4LAT A;  1B0H A;  1DPP A;  2QL3 A;  3CG1 A;  3ZKL A;  2Z8D A;  1P1W A;  4DE8 A;  3P7I A;  1NL5 A;  2DYX A;  4QSE A;  5IKB A;  3IOW A;  5I2K A;  4MBP A;  1SW2 A;  2QMW A;  2ZNT A;  3MP6 A;  3TTM A;  3VXC A;  2E1S A;  2XX8 A;  4FOR A;  1NNP A;  1SD3 A;  1SVX B;  4LON B;  3UOR A;  4NF5 A;  4FEC A;  1GVC A;  2XXU A;  4YMA A;  2I4B A;  4O3B A;  3LC8 A;  3VVE A;  4GD5 A;  1S9T A;  3A3C A;  5I59 A;  2O51 A;  4PET A;  4TLM B;  5FTI A;  1B32 A;  4GVO A;  4H65 A;  3FZV A;  4ZDM A;  3RY3 A;  3H6W A;  4U21 A;  4C1T A;  4F39 A;  3IJO B;  3E4R A;  2ZNS A;  4MF3 A;  1N76 A;  2DE3 A;  4QRZ A;  3RPW A;  3W9V A;  4C0R A;  1EZP A;  4OTE A;  2FNC A;  4BDN A;  5M2V A;  1YPN A;  2VD2 A;  4Q8R A;  3B7D A;  2DP8 A;  2G29 A;  5AA3 A;  3SES A;  4ESX A;  1US4 A;  2HAV A;  1RYO A;  2XXP A;  1TFA A;  3KZG A;  1PEB A;  2AL5 A;  3LBS A;  3M3L A;  3PV0 E;  4IY5 A;  4MLQ A;  3MWB A;  4ONY A;  5JTY B;  4QFP A;  1B5H A;  2QS1 A;  3H6T A;  4NED A;  1R9Q A;  4HW8 A;  2DQV A;  3O29 A;  5H8F A;  2D3I A;  1II5 A;  1B0L A;  2F7C A;  3UN6 A;  4F31 B;  5KCJ A;  1LBC A;  1H3D A;  3LSL A;  3JYR A;  3Q29 A;  1I69 A;  2OJT A;  4G8M A;  1LAX A;  2XXH A;  5I58 B;  1H45 A;  3FJM A;  3QSL A;  4U1Z A;  4AQ4 A;  1FQC A;  4BDR A;  3CSG A;  1NH8 A;  2D21 A;  3HO7 A;  4G77 A;  4YKK A;  1DPE A;  1YCJ A;  2NWJ A;  1B6H A;  4JWX A;  3V8X B;  4F2Q A;  1FQE A;  1JVX A;  5F7V A;  1MY0 A;  3G3F A;  3OO8 A;  4LA9 A;  3LR1 A;  5F1Q A;  3USD A;  3WAE A;  4IO2 A;  1UTH A;  4HCY A;  4EDP A;  4U4S A;  2I6E A;  2P1S A;  3PUX E;  4H8J A;  3S9L C;  1B40 A;  1PB9 A;  2XX9 A;  3GZG A;  3I6V A;  4PFT A;  2DS9 A;  2GRV A;  4JDF A;  3PUV E;  1R6Z A;  3T9X B;  4F1Y A;  2DE4 A;  5H8Q A;  4L17 A;  1N04 A;  1MM7 A;  3C31 A;  1SDX A;  4ND9 A;  2G93 A;  5EYF A;  1EH3 A;  2Q9T A;  3SER A;  4Z7E A;  2O6A A;  1MQD A;  3LSW A;  1MS7 A;  3TFL A;  1LB8 A;  1LAF E;  2QMX A;  1LAH E;  1RKM A;  2V25 A;  3HHF A;  3T22 A;  5B7D A;  3IL1 B;  2XXY A;  3G3H A;  3N6T A;  4OWD A;  3TEP A;  1USY E;  2XXV A;  5AA4 A;  2F5X A;  2H4I A;  3KSJ A;  1B7H A;  3K6U A;  2QS2 A;  3OMB A;  3I5O A;  5CM6 A;  3OO6 A;  1N0T A;  4OHN A;  1WOD A;  4XXU A;  1O7T A;  3BKI B;  3IR1 A;  2GHA A;  1LCF A;  3FUZ A;  3H6U A;  3O6H A;  4FJP A;  4YMB A;  1MQI A;  2RC7 A;  1B58 A;  5AA1 A;  1IXH A;  3MZB A;  1LAG E;  2X7P A;  1JQF A;  4Z0I A;  3V83 A;  4LP2 B;  3EHU A;  2R9J A;  3VLW A;  4LQ2 A;  3IB2 A;  1MQG A;  4GWO A;  2F97 A;  4R6K A;  3F11 A;  1H43 A;  1M5C A;  3FXU A;  1QUJ A;  2LAO A;  5HBC A;  5DVI A;  1AL3 A;  2F6P A;  3FJG A;  3MUQ A;  4NWD A;  2AL4 A;  4RYA A;  4UAC A;  3IOV A;  3SEY A;  1MM6 A;  3FVO A;  4AB6 A;  2XXW A;  4BDL A;  5CMM A;  2DE2 A;  1D4N A;  3DLN A;  3ECR A;  3FXR A;  3MBP A;  3LUY A;  5L9O A;  2RCB A;  4RJZ A;  5FTH A;  3QXM A;  1Q1K A;  2NUV A;  3W15 C;  4DLD A;  1EU8 A;  4HTG A;  1OVB A;  1P99 A;  2UVG A;  2ZXT A;  4Q0C A;  1MXV A;  1JW1 A;  4XIG Q;  1B1X A;  5DVF A;  1WDN A;  1UQW A;  3QIM A;  3TUS A;  5DTB A;  4H6D A;  4ZZE A;  1P1U A;  4F29 A;  1MPB A;  3N5L A;  3S2V A;  1MXW A;  3GXA A;  3KJT A;  3G3J A;  1B3E A;  4DCY A;  2V84 A;  4F3G A;  1M5D A;  4RPO A;  1XVY A;  1FQD A;  5JTY A;  5KDT A;  4RPN A;  2H9B A;  1B7U A;  2UVJ A;  2O1L A;  3IX1 A;  3CR9 A;  5ITO A;  3TOD A;  5I56 B;  2REJ A;  2FYI A;  2IA4 A;  3K00 A;  3MP1 A;  1GV8 A;  3VV5 A;  1MXZ A;  4F3S A;  1LB9 A;  3IOR A;  2H25 A;  1TT1 A;  4TLL B;  1MY3 A;  4YAH X;  5B70 A;  1T0K A;  5H8H A;  4G68 C;  3H03 A;  2A5T B;  4ZEB A;  3C35 A;  1HSE A;  2M8C A;  2Y7P A;  2XD3 A;  3L6G A;  3MP8 A;  2CMO A;  3QAX A;  3FD3 A;  2I3W A;  3KGC A;  4FIM A;  1JW5 A;  4P11 A;  4TQU Q;  3FIR A;  4H8I A;  1Y3Q A;  2V3T A;  3GBB A;  4XKP A;  5FHM A;  1FQA A;  3BBR A;  2QPQ A;  4MLV A;  3VFJ A;  1LST A;  1ELJ A;  4IO5 A;  4U23 A;  4YKI A;  3EF7 A;  2WKY A;  4ZEI A;  1SYI A;  4ZEC A;  3DP4 A;  4NF6 B;  2PYY A;  4BDQ A;  3SET A;  3MAM A;  4HS7 A;  4P0I A;  4X1D A;  1MY1 A;  1M5E A;  4YU0 A;  3K1P A;  1OLC A;  1FQF A;  3CFL A;  3DM0 A;  1B3F A;  2DWI A;  1Z7M E;  3MC2 A;  2O7U A;  1H44 A;  4R6H A;  5H8N A;  3T66 A;  4LUB A;  4G68 B;  4EXK A;  4FAJ A;  1PDA A;  3HCQ A;  2HCA A;  3ZSF A;  4EXL A;  5I57 A;  5I56 A;  2RCA A;  1IEJ A;  4OEN A;  1Y3P A;  1B52 A;  1MG1 A;  3MZ9 A;  3RN8 A;  2PVU A;  1IUD A;  4OFJ A;  5KDT B;  3QYT A;  4F19 A;  3PUW E;  4HCW A;  2F36 A;  4IGT A;  2VOZ A;  4U1O A;  4Q5T A;  5DYH A;  3R7X A;  2I49 A;  3MZ1 A;  3RT6 B;  3TMG A;  1VSO A;  2HFB A;  3E9X A;  2PX1 A;  1URG A;  2RKM A;  2DVZ A;  1MQH A;  4GLI A;  3TCF A;  2Y7W A;  2OBG A;  2I4C A;  3EPE A;  4DXB A;  2VHA A;  4GFR A;  2ABH A;  3MVX A;  4GQO A;  4OET A;  2Z8E A;  1B3G A;  1FQB A;  1MXX A;  1EZ9 A;  4ZZA A;  2ANJ A;  3QUJ A;  4WED A;  1PC3 A;  1YAE A;  1S50 A;  2O7I A;  2THI A;  1OQG A;  2XXT A;  2B3B A;  1KWH A;  2HEU A;  2DVC A;  3TQW A;  4IO6 A;  1IZ1 A;  1N3X A;  5ELV A;  1A55 A;  2QSX A;  1FW0 A;  3MVW A;  1B3H A;  3IJX B;  4LQ5 A;  2O68 A;  1QUI A;  1EZO A;  1B51 A;  3RQT A;  4YKJ A;  2O1M A;  1P1N A;  2UVH A;  2Y7R A;  3PUZ E;  4EQ7 A;  4JXI A;  3K1N A;  2REG A;  3V5A A;  5I57 B;  3TCH A; 
#chains in the Genus database with same CATH topology
 1POY 1;  3FBP A;  3IFA A;  3EN3 A;  1Y9U A;  3VE1 B;  4G8N A;  1M5B A;  3B6W A;  1Y1M A;  4HXV A;  3I3V A;  4PF8 A;  3K01 A;  3EHS A;  1IQ7 A;  3ONM A;  3O66 A;  3LSF B;  2V4C A;  4O3C A;  5H8F B;  4PCD A;  1IIW A;  4NF8 B;  1QUL A;  3TDJ A;  2A5T A;  3FV2 A;  4JVI A;  1AMF A;  1Z7N E;  4PF6 A;  4QFO A;  2UYE A;  4JWO A;  3C4M A;  4YB7 A;  3SEW A;  1FRP A;  4N13 A;  2OWS A;  1EYI A;  3O6G A;  3ZKK A;  2VGQ A;  3PMX A;  3RLF E;  1SW5 A;  4OMB A;  1A8F A;  3C36 A;  4GXA A;  5CC2 A;  5DT6 A;  2I58 A;  2X7Q A;  1JVY A;  3IOU A;  1FBE A;  5FHO A;  2ZYO A;  2FIX A;  3B8B A;  2QS3 A;  4U22 A;  4ZS9 A;  1BLF A;  4MH5 A;  1M5F A;  4XF5 A;  4IO4 A;  3WAF A;  2R71 A;  1QKA A;  2H98 A;  5EQ7 A;  5F24 A;  4PE5 B;  3G7W A;  3MVY A;  1FCK A;  3C32 A;  4R6Y A;  3FJ7 A;  4NX1 A;  3E3K A;  4F3P A;  5IZ3 B;  1OQH A;  5FBP A;  1SI0 A;  2Q2A A;  1N7W A;  1QGX A;  2QRY A;  3T96 B;  1XT8 A;  3HST A;  2PBW A;  3A09 A;  2ZMB A;  1Y4T A;  1CNQ A;  2F3D A;  3O28 A;  4R9F A;  3C9H A;  3KJ7 A;  2Q2C A;  5TP9 B;  3KN7 A;  4GBV A;  1IMB A;  2F35 A;  3OXN A;  1RDZ A;  3OEN A;  3V89 B;  4UAB A;  2OCU A;  4JVD A;  2WYK A;  1B9J A;  4M4G A;  4FAT A;  5H8H B;  2Z22 A;  4OVJ A;  3VVF A;  3T9V A;  3B6Q A;  4MFI A;  3RT8 A;  5T3J A;  3TZA A;  2Z23 A;  5DEX A;  3T93 B;  4ELQ A;  1TWY A;  3K02 A;  4PFR A;  2H5Y A;  4KCD A;  3NOH A;  1CE2 A;  1FBP A;  3TQL A;  3A29 A;  2I3V A;  4GWX A;  1QUK A;  1AIV A;  4PFI A;  1NV4 A;  3CVG A;  3T9H B;  2P2A A;  4GF8 A;  2KLF A;  2QVV A;  2HZL A;  5ICQ A;  2DXR A;  3MST A;  3PPO A;  4F1U A;  3MJN A;  2B65 A;  4GXS B;  4AB5 A;  5AE4 A;  1LBB A;  5ET8 A;  3PPQ A;  3D4C A;  3M3F A;  4PFY A;  4GL0 A;  4DI4 B;  1IIT A;  1PB7 A;  2PMS A;  4H67 A;  2O84 X;  2RC9 A;  3TTR A;  1FTK A;  1L5T A;  2PT2 A;  3KN8 A;  3IAZ A;  1B1H A;  4OER A;  1BKA A;  2DWH A;  1B3L A;  4MMP A;  1B4Z A;  1MY4 A;  2PT1 A;  2D5W A;  2Q88 A;  1JEU A;  4ZE8 A;  2VPO A;  4I40 A;  3RGY A;  1HSL A;  3MPL A;  4R74 A;  3IB0 A;  3Q27 A;  2HXR A;  4P0G A;  3L6H A;  1QKB A;  4R9G A;  3CI8 A;  1SQY A;  1SYH A;  2ZZV A;  4KPT A;  1B0H A;  2QL3 A;  1P1W A;  3P7I A;  5I2K A;  3TTM A;  3VXC A;  2VT5 A;  4LON B;  1GVC A;  1RDX A;  1LBX A;  3VVE A;  1KZ8 A;  4GVO A;  4H65 A;  3H6W A;  4PE3 A;  4U21 A;  5ET5 A;  3E4R A;  4C0R A;  1EZP A;  4OTE A;  1YPN A;  2G29 A;  3SES A;  2XXP A;  2AL5 A;  3MWB A;  1B5H A;  2DQV A;  3O29 A;  2ZZX A;  4F31 B;  5KCJ A;  4PGP A;  2OJT A;  3FJM A;  1FQC A;  4BDR A;  3CSG A;  2D21 A;  4YKK A;  4F2Q A;  1DPE A;  1YCJ A;  1B6H A;  3LR1 A;  3S9L C;  2P1S A;  3PUX E;  4H8J A;  1B40 A;  3I6V A;  2DS9 A;  4F1Y A;  4N15 A;  2XWV A;  2DE4 A;  2MKZ A;  1NI9 A;  1SDX A;  4ND9 A;  2G93 A;  3SER A;  1MQD A;  4MJO A;  1MS7 A;  3HHF A;  2V25 A;  3T22 A;  3N6T A;  4OWD A;  3KSJ A;  2H4I A;  1B7H A;  3K6U A;  2QS2 A;  4O8M A;  1O7T A;  3BKI B;  2L5V A;  3H6U A;  2RC7 A;  3MZB A;  2XXK A;  1LAG E;  5EQA A;  4LQ2 A;  3F11 A;  3FXU A;  1QUJ A;  3IFC A;  4UAC A;  3IOV A;  3SEY A;  3FVO A;  2XXW A;  1FBG A;  2QFL A;  4DLD A;  1EU8 A;  1P99 A;  2UVG A;  1JW1 A;  1B1X A;  5DVF A;  4F29 A;  1MPB A;  1B3E A;  4DCY A;  2V84 A;  4F3G A;  1M5D A;  2H9B A;  4F3S A;  1G0H A;  4NF0 A;  2H25 A;  1TT1 A;  4TLL B;  1MY3 A;  5H8H A;  4G68 C;  2CZH A;  2CMO A;  1JW5 A;  4TQU Q;  1Y3Q A;  3GBB A;  4MLV A;  1LST A;  4FBP A;  4IO5 A;  2WKY A;  1FJ6 A;  4ZEI A;  1SYI A;  4ZEC A;  3MAM A;  4X1D A;  1FQF A;  4ZE9 A;  1B3F A;  2DWI A;  1Z7M E;  4R6H A;  2O7U A;  1H44 A;  4G68 B;  3HCQ A;  4EXL A;  1IEJ A;  3MZ9 A;  4F19 A;  4IGT A;  4Q5T A;  3RT6 B;  1VSO A;  2HFB A;  1URG A;  1MQH A;  2I4C A;  2P3V A;  4DXB A;  5EQ9 A;  1MXX A;  2ANJ A;  4PC9 A;  1OQG A;  5ELV A;  2QSX A;  1SPI A;  1FTA A;  2O68 A;  1EZO A;  4YKJ A;  4JXI A;  3PD9 A;  1NNF A;  2Y7K A;  4XKR A;  4GWU A;  5J1D A;  2ALU A;  3VLU A;  4NF6 A;  2Q89 A;  3JV9 A;  2KR0 A;  3UA8 A;  3OSQ A;  2CEX A;  5JEI A;  2XWO A;  1QW0 A;  1FTL A;  4I3E A;  4U4X A;  1I6A A;  1P1Q A;  3PD8 A;  4P1E A;  4I3Y A;  1IMC A;  4YB5 A;  3CFZ A;  4KYE A;  2DXY A;  4QF9 A;  5BWJ A;  1NV0 A;  3OD7 A;  2QS4 A;  3VXB A;  3OEK A;  3K6X A;  5IZ1 A;  2GFE A;  4QSC A;  4G4P A;  1FSA A;  3A3U A;  1NUZ A;  4N07 A;  4XKQ A;  4RK2 A;  4GIZ A;  1DSN A;  2OK2 A;  1I6Q A;  1QJM A;  1R1N A;  2UVI A;  4H0W A;  4DIG A;  1FBC A;  1MXY A;  2I0B A;  1ZLQ A;  2R6G E;  2V3Q A;  3KOT A;  1KA1 A;  1NV5 A;  4MNC A;  5TPA B;  4H5F A;  4LZ7 A;  3D1R A;  3FVG A;  1FPB A;  3JZJ A;  4XKN A;  4E0X A;  2YPN A;  4N6P A;  3RPL A;  3UIF A;  2YJP A;  5ET7 A;  4EF1 A;  3RUM A;  1S7Y A;  3BFT A;  1O64 A;  3KEI A;  1YTV A;  5K2X A;  1B46 A;  4EF2 A;  5DW8 A;  2V93 A;  3SDF A;  4O7M A;  1JW4 A;  3E78 A;  5I58 A;  1WVJ A;  1URD A;  4LN5 A;  4PFB A;  2OWT A;  1K9Z A;  2DSF A;  2ONK E;  5CMC A;  3VVD A;  3G3I A;  4NG7 A;  3SEV A;  3QUF A;  3OSR A;  1FTM A;  2P3N A;  3DP6 A;  3W9W A;  4DZ1 A;  1GGG A;  4X1B A;  3K1M A;  3U93 A;  2H99 A;  3DEL B;  5IGA A;  2Y5L A;  1GTK A;  2F8D A;  4RY1 A;  5LOM A;  5I84 A;  2ZYK A;  4ELP A;  1B4H A;  5KZT A;  4F3B A;  1XHY A;  2HXW A;  4KYS A;  4NF4 A;  5CMB A;  1J1N A;  4KCC A;  2BJJ X;  4OA4 A;  4ZEK A;  3PPR A;  3GBA A;  4PQJ A;  3ROJ A;  3B6T A;  3C34 A;  4GWS A;  1O63 A;  1AH5 A;  1MY2 A;  2P0S A;  4PBH A;  3BIG A;  5EQ8 A;  4R72 A;  5CI5 A;  4RXL A;  3HPI A;  4GBW A;  1KA0 A;  1SI1 A;  3M8U A;  4F1V A;  3RTF B;  1US5 A;  4JVC A;  1PB8 A;  1LCT A;  4H1X A;  3OOA A;  4BLA A;  4DXU A;  4NF5 B;  1LFI A;  3VDF A;  4QFL A;  1RDY A;  3O2A A;  1A99 A;  4X48 A;  5ESY A;  1B5I A;  3O6I A;  4MNP A;  4GRK A;  5ITP A;  4NAP A;  4N4U A;  1B05 A;  1Y4C A;  3R26 A;  4IO3 A;  3UGW A;  1Y20 A;  2QJE A;  3IOT A;  4ZED A;  1LFH A;  4NHB A;  2F78 A;  1CB6 A;  2XHD A;  2F7B A;  4QXD A;  5CMK A;  3GLB A;  5AA2 D;  4H5G A;  1MDQ A;  3EHT A;  1OIB A;  4PTK A;  3CRB A;  4QFP A;  5CBS A;  1XC1 A;  3BIH A;  1PBQ A;  4R73 A;  4MCO A;  1FPJ A;  1I6B A;  4O3A A;  3O97 A;  4JSD A;  4Q30 B;  2XXR A;  1ZBM A;  2NOO A;  1DTZ A;  1N84 A;  2HPG A;  4BDM A;  4NMY A;  4OXV A;  5I59 B;  4OQO A;  4LAT A;  1DPP A;  3CG1 A;  2Z8D A;  2DYX A;  3IOW A;  3SZP A;  3UOR A;  4FEC A;  4YMA A;  4GD5 A;  5I59 A;  4TLM B;  5FTI A;  3FZV A;  4ZDM A;  1K9Y A;  4PAK A;  1FPG A;  2VD2 A;  3B7D A;  2DP8 A;  5AA3 A;  4ESX A;  1US4 A;  2HAV A;  3PV0 E;  3M3L A;  1LEV A;  2QS1 A;  4NED A;  1R9Q A;  4X8R A;  2D3I A;  1II5 A;  1B0L A;  3UN6 A;  3LSL A;  2XXH A;  3QSL A;  4U1Z A;  4DE8 A;  1NH8 A;  1JVX A;  2CZI A;  4LA9 A;  5F1Q A;  3USD A;  4IO2 A;  1UTH A;  4HCY A;  4EDP A;  4PFT A;  5H8Q A;  3T0J A;  4XEQ A;  4Z7E A;  2PCR A;  1LAH E;  2WX9 A;  2XXY A;  1USY E;  2XXV A;  1LBV A;  5CM6 A;  1WOD A;  4XXU A;  1FJ9 A;  2GHA A;  3O6H A;  3FUZ A;  1MQI A;  4PBQ A;  1JQF A;  4Z0I A;  3EHU A;  3IB2 A;  4GWO A;  1H43 A;  4G61 A;  5DVI A;  4IR8 A;  2F6P A;  4NWD A;  1MM6 A;  4BDL A;  2DE2 A;  3MBP A;  3FXR A;  5IZ3 A;  5FTH A;  4HTG A;  4XIG Q;  3TUS A;  4H6D A;  2WBD A;  1MXW A;  4OVR A;  5JTY A;  1XVY A;  4N6D A;  4DI3 D;  5I56 B;  2FYI A;  4P56 A;  1MXZ A;  1IME A;  4NN3 A;  5B70 A;  1T0K A;  4YAH X;  3H03 A;  4MEV A;  2M8C A;  3MP8 A;  2XD3 A;  3L6G A;  3EF7 A;  4HS7 A;  4P0I A;  2FBP A;  1M5E A;  3K1P A;  3ZSF A;  5I57 A;  4NQ8 A;  4NGU A;  4OEN A;  1IUD A;  5KDT B;  3ISP A;  3R7X A;  3E9X A;  3U94 A;  2OBG A;  3MVX A;  1B3G A;  1EZ9 A;  4WED A;  2O7I A;  1KWH A;  2HEU A;  3TQW A;  1IZ1 A;  3IJX B;  4LQ5 A;  1QUI A;  1B51 A;  2Y7R A;  3K1N A;  2REG A;  1BK4 A;  3V5A A;  4GL8 A;  1UTB A;  1DTG A;  3C33 A;  4FE8 A;  2R8T A;  4P3L A;  3T9U A;  2HZK A;  1FPF A;  2E0S A;  1H76 A;  4I1D A;  2XXX A;  1NMU A;  4IB2 A;  2BJI A;  4BDO A;  5A5X A;  1ZU0 A;  3MVZ A;  4U2R A;  3KOS A;  1UIV A;  3TTK A;  1A7L A;  3H3G A;  1MQJ A;  2RC8 A;  4IO7 A;  4WXJ A;  2B3F A;  1A40 A;  1MH3 A;  3TTN A;  1JEV A;  4PFW A;  2XD2 A;  1HSJ A;  1NV7 A;  3FVN A;  1DK4 A;  1FPE A;  5KCJ B;  4G68 A;  1ZKB A;  4OEU A;  3K0V A;  5ET6 A;  3IK6 B;  4KD5 A;  4QFN A;  4OFL A;  4ESW A;  4POX A;  1Q9D A;  5EHS A;  4IGR A;  1R9L A;  4YKP A;  4NE4 A;  5A5L A;  3FAS A;  1ZTY A;  3Q25 A;  5TPA A;  3U1O A;  3E13 X;  3H06 B;  3SEX A;  1A54 A;  3IO6 A;  4F22 A;  5H8Q B;  1SBP A;  3CIJ A;  1TFD A;  3H4Z A;  3BFU A;  3LSX A;  5TU0 A;  3IO4 A;  1QVS A;  2DOJ A;  5EHM A;  1IXC A;  3S9M C;  1NFT A;  1INP A;  5CRY A;  1G0I A;  1D9V A;  4AS4 A;  4EQ9 A;  2CZK A;  1XI6 A;  4M1V A;  4PAF A;  3G3G A;  3S9E A;  1MXU A;  1XS5 A;  1ATG A;  4QSD A;  2XX7 A;  2GHB A;  1LLS A;  4WEP A;  4G8H A;  2KQZ A;  4C1U A;  3N26 A;  4IY6 A;  3K6W A;  1D9Q A;  1LGB C;  4EQB A;  3S4U A;  4ISU A;  4WKM A;  4YZZ A;  5I5P A;  4N91 A;  5I2N B;  3RNN A;  2FA7 A;  5H8S A;  3IB1 A;  2ZZW A;  4ECF A;  3TYH A;  1RYX A;  1JET A;  1IMF A;  4OEV A;  5A5X B;  4XTC Q;  2NXO A;  3KBR A;  5FHN A;  3MQ9 A;  4FEB A;  5I3S A;  3Q26 A;  1OMP A;  1UTB B;  3ODB A;  4MX6 A;  4JWY A;  4OVP A;  4X9T A;  3OO7 A;  4QBA A;  1ZJL A;  5LDZ A;  5AA4 B;  3CFX A;  2IEE A;  3K6V A;  1A8E A;  3FXQ A;  3U92 A;  4KYD A;  2A5S A;  2F7A A;  4NTL A;  3VLV A;  1DMB A;  1NNK A;  4PP0 A;  2DWA A;  1NUY A;  3M3K A;  4I62 A;  3OEM A;  1NUW A;  3E79 A;  5CBR A;  4KHZ E;  1FTJ A;  4OAN A;  3PTY A;  3PPN A;  3TAJ A;  2I48 A;  3DP8 A;  1LFG A;  4YIC A;  4LVQ A;  4KQP A;  1UTH B;  5ISU A;  2HQ0 A;  2I0C A;  3RTW B;  3U72 A;  3U8Q A;  4GX6 A;  3KC1 A;  4OZ9 A;  1BP5 A;  1B2H A;  4FED A;  3K2D A;  4QFK A;  5I2N A;  1FPK A;  4F18 A;  1MH4 A;  4ZEF A;  3HV1 A;  3H7M A;  1VFD A;  2XWK A;  4N6K A;  3LV0 A;  2ZYM A;  2YLN A;  3KBZ A;  1SW4 A;  4TOZ A;  4XFE A;  1URS A;  2GH9 A;  2ONS A;  4I8C A;  3N6U A;  2RF1 A;  1YXI A;  3HN0 A;  4LZ5 A;  2ZNU A;  4KR5 A;  2F6G A;  4KFQ A;  4ZZE A;  3KFM A;  4I9D A;  1Q35 A;  5IM2 A;  3S9N C;  1UIU A;  2Z8F A;  3HFU A;  3EKI A;  5IKB A;  4MBP A;  3MP6 A;  2ZNT A;  1NNP A;  1SVX B;  2XXU A;  2I4B A;  4P47 A;  4O3B A;  3LC8 A;  2F3B A;  3A3C A;  1EYJ A;  2O51 A;  1B32 A;  4GWZ A;  3IJO B;  2ZNS A;  4MF3 A;  1N76 A;  3RPW A;  4BDN A;  2FNC A;  5M2V A;  3KZG A;  4ONY A;  4HW8 A;  1H3D A;  3Q29 A;  1I69 A;  5I58 B;  1H45 A;  3HO7 A;  4JWX A;  1FQE A;  3WAE A;  2I6E A;  1PB9 A;  3GZG A;  2GRV A;  3PUV E;  3T9X B;  4L17 A;  1N04 A;  4P9K A;  1EH3 A;  5EYF A;  2O6A A;  1LAF E;  2QMX A;  4N81 A;  3IL1 B;  3G3H A;  2VPN A;  2F5X A;  1FBF A;  3OMB A;  3I5O A;  3OO6 A;  1N0T A;  4OHN A;  3IR1 A;  1B58 A;  5AA1 A;  1IXH A;  1DBZ A;  2X7P A;  2FHY A;  4LP2 B;  3VLW A;  1MQG A;  1M5C A;  5HBC A;  2LAO A;  3FJG A;  3MUQ A;  2AL4 A;  1FPL A;  2PFZ A;  3DLN A;  1D4N A;  3QXM A;  1Q1K A;  2NUV A;  3W15 C;  1JP4 A;  2QVR A;  1OVB A;  2WYP A;  1UQW A;  3QIM A;  5DTB A;  3KJT A;  4RPO A;  5KDT A;  1FQD A;  4RPN A;  2UVJ A;  1B7U A;  3IX1 A;  5ITO A;  3CR9 A;  2REJ A;  1GV8 A;  3VV5 A;  2OWZ A;  2A5T B;  3C35 A;  3QAX A;  3FD3 A;  4FIM A;  2FVZ A;  3FIR A;  4H8I A;  4XKP A;  5FHM A;  1FQA A;  3BBR A;  2QPQ A;  3VFJ A;  1ELJ A;  4U23 A;  4NF6 B;  2PYY A;  1MY1 A;  1OLC A;  3MC2 A;  4LUB A;  4EXK A;  4AS5 A;  1PDA A;  5I56 A;  3RN8 A;  3KC0 A;  2GQ1 A;  4HCW A;  1AWB A;  2VOZ A;  3TMG A;  5H8F A;  2PX1 A;  4GLI A;  3EPE A;  2VHA A;  4GFR A;  2ABH A;  4GQO A;  4HE1 A;  4OET A;  2CEY A;  1FPD A;  3QUJ A;  1PC3 A;  1YAE A;  2THI A;  2OX3 A;  2XXT A;  1FW0 A;  3MVW A;  4HE0 A;  2QVU A;  4MAG A;  2O1M A;  3RYD A;  3TCH A;  4F2O A;  1AOV A;  4NF4 B;  1MRP A;  1P1O A;  2DWJ A;  1NV3 A;  2OLB A;  5DVJ A;  1D9Y A;  3FGS A;  4NWC A;  1NV2 A;  3UK4 A;  3QK6 A;  4KXP A;  4JSO A;  2OZZ A;  5LTC A;  2V3U A;  4N8G A;  3KN3 A;  4RK9 A;  1ZMG A;  2WBB A;  4R2B A;  1B5J A;  1VR5 A;  4RNS A;  5AA2 B;  4POW A;  2UYF A;  1Y1Z A;  1MPC A;  4YB6 A;  4PAI A;  2VD3 A;  3FV1 A;  1TXF A;  3N94 A;  5TP9 A;  3TTL A;  1Y3N A;  1VFE A;  2B4M A;  1YYZ A;  3TEL A;  3TKD A;  1VE4 A;  3CG3 A;  4NF8 A;  4HE2 A;  1BTJ A;  3SEU A;  1N7X A;  5IZZ A;  4DXC A;  4MIJ A;  2ESN A;  4KI0 E;  3R6U A;  4OYV A;  1PBP A;  2UXA A;  2XXQ A;  4THI A;  5HPQ A;  1IMA A;  1EYK A;  4GWY A;  4UA8 A;  1DOT A;  3T1B A;  3PUY E;  2ZYN A;  5L8D A;  4OVT A;  4ELR A;  2Q74 A;  4DDD A;  3OO9 A;  3ZS6 A;  5BUU A;  4R75 A;  1BIY A;  3K4U A;  5I2K B;  3AXF A;  3Q28 A;  3CSB A;  4H45 A;  3PMV A;  2W7Y A;  3GYY A;  4P8B A;  1NH7 A;  4JBZ A;  2F34 A;  3FAT A;  4RA1 A;  1LBY A;  3ILU B;  1GR2 A;  1IXG A;  2PFY A;  3TPA A;  5L9S A;  1USY H;  2Y5K A;  4OFO A;  4ELO A;  3MPK A;  3PGF A;  4DCX A;  2Q8M A;  1FPI A;  1NKX A;  3G3K A;  1XVX A;  3THI A;  1NV1 A;  5IAI A;  3V83 A;  2Q8J A;  2NVU B;  4K3F A;  2ONR A;  4MHF A;  4N8Y A;  4PFU A;  4JB7 A;  2RIN A;  1LBW A;  2Y7I A;  5K2Y A;  3MYU A;  2CZL A;  3RPL B;  4G2Z A;  2Y84 A;  5HM4 B;  5L9M A;  3D4G A;  3KG2 A;  2O69 A;  3OEL A;  3EQ1 A;  2XWI A;  2AIX A;  3H6V A;  2X26 A;  1N3W A;  3HHG A;  2HAU A;  1IXI A;  1MPD A;  1IMD A;  4LZ8 A;  3FVK A;  2VP1 A;  3MW0 A;  3O9P A;  4OES A;  1YZ0 A;  1ZIU A;  3SKP A;  1B7Z A;  1FBD A;  1JNF A;  1LBZ A;  1OLA A;  1POT A;  3UP9 A;  3PMW A;  4O7I A;  4GX4 A;  5ICT A;  4GX3 A;  3TCG A;  1ANF A;  4QHQ A;  3PPP A;  1SW1 A;  1OVT A;  2WEF A;  1XOC A;  4E0W A;  1NNT A;  3KSX A;  1FTO A;  1D3K A;  1MDP 1;  3PU5 A;  1F9B A;  5JK4 A;  5DEX B;  2AYS A;  4R2F A;  2XXI A;  2B4L A;  3ILT B;  2FIE A;  3B50 A;  4EUO A;  5H8N B;  4GOT A;  3ZKL A;  1NL5 A;  4QSE A;  1SW2 A;  2QMW A;  2E1S A;  2XX8 A;  4FOR A;  1SD3 A;  4NF5 A;  1S9T A;  5I7I A;  4PET A;  3RY3 A;  4F39 A;  4C1T A;  2DE3 A;  4QRZ A;  3W9V A;  4Q8R A;  1RYO A;  1TFA A;  1PEB A;  3LBS A;  4IY5 A;  3QMF A;  4MLQ A;  5JTY B;  4PDD A;  3H6T A;  1DCU A;  1FBH A;  2F7C A;  3CHG A;  1LBC A;  3JYR A;  4G8M A;  1LAX A;  5AA2 A;  4AQ4 A;  4G77 A;  2NWJ A;  3V8X B;  5F7V A;  1MY0 A;  3G3F A;  3OO8 A;  4U4S A;  2XX9 A;  3FXB A;  4JDF A;  1R6Z A;  5J16 A;  4P1L A;  4PGN A;  1MM7 A;  3C31 A;  4H46 A;  2Q9T A;  2HHM A;  5EYH A;  2XA5 A;  3LSW A;  3TFL A;  1NV6 A;  1LB8 A;  1RKM A;  5B7D A;  3TEP A;  5AA4 A;  4OVS A;  1LCF A;  4FJP A;  4YMB A;  2R9J A;  2F97 A;  4O94 A;  4R6K A;  1AL3 A;  4RYA A;  4AB6 A;  2JJK A;  5CMM A;  5L9O A;  3ECR A;  3LUY A;  2RCB A;  4RJZ A;  4OVQ A;  3LUZ A;  2ZXT A;  4Q0C A;  1MXV A;  5EYG A;  1WDN A;  1P1U A;  4GWW A;  3S2V A;  3N5L A;  3GXA A;  3G3J A;  2O1L A;  3TOD A;  2IA4 A;  3K00 A;  3MP1 A;  4X04 A;  1LB9 A;  3IOR A;  4ZEB A;  1HSE A;  2Y7P A;  2I3W A;  3KGC A;  4P11 A;  3U65 A;  2V3T A;  4YKI A;  4N17 A;  4PDH A;  3DP4 A;  4BDQ A;  3SET A;  4YU0 A;  3DM0 A;  3CFL A;  3T66 A;  5H8N A;  4FAJ A;  2HCA A;  2RCA A;  1Y3P A;  1B52 A;  1MG1 A;  4MNI A;  2PVU A;  4OFJ A;  3QYT A;  3PUW E;  2F36 A;  2DDK A;  4U1O A;  5DYH A;  2I49 A;  3MZ1 A;  2RKM A;  2DVZ A;  3TCF A;  2Y7W A;  2Z8E A;  1FQB A;  4ZZA A;  1S50 A;  2B3B A;  2DVC A;  4IO6 A;  1N3X A;  1A55 A;  1B3H A;  3RQT A;  3PUZ E;  1P1N A;  2UVH A;  4EQ7 A;  1VDW A;  5I57 B;  1NUX A; 
#chains in the Genus database with same CATH homology
 4GL8 A;  3PD9 A;  1UTB A;  4F2O A;  1NNF A;  1POY 1;  1DTG A;  1AOV A;  2Y7K A;  3C33 A;  4FE8 A;  3EN3 A;  4NF4 B;  4XKR A;  1Y9U A;  3T9U A;  2HZK A;  3VE1 B;  2ALU A;  3VLU A;  4NF6 A;  2E0S A;  1MRP A;  5AA2 A;  4G8N A;  1H76 A;  1P1O A;  1M5B A;  2DWJ A;  2Q89 A;  3B6W A;  4I1D A;  2XXX A;  1Y1M A;  2OLB A;  1NMU A;  3I3V A;  5DVJ A;  4IB2 A;  3JV9 A;  1D9Y A;  4BDO A;  5A5X A;  1ZU0 A;  3MVZ A;  3FGS A;  4U2R A;  3KOS A;  1UIV A;  3K01 A;  4NWC A;  3UA8 A;  3UK4 A;  3TTK A;  1A7L A;  3H3G A;  3OSQ A;  1MQJ A;  2RC8 A;  4IO7 A;  3EHS A;  5JEI A;  1IQ7 A;  1FTL A;  1QW0 A;  3ONM A;  3QK6 A;  3O66 A;  4WXJ A;  4U4X A;  1I6A A;  1P1Q A;  3LSF B;  2OZZ A;  3PD8 A;  4JSO A;  5I84 A;  2B3F A;  2V3U A;  4O3C A;  1A40 A;  3KN3 A;  1MH3 A;  3TTN A;  4YB5 A;  5H8F B;  1IIW A;  4NF8 B;  3CFZ A;  4KYE A;  2DXY A;  4RK9 A;  1QUL A;  4QF9 A;  1JEV A;  1ZMG A;  4PFW A;  1B5J A;  1VR5 A;  3OD7 A;  4R2B A;  4RNS A;  2QS4 A;  5AA2 B;  5BWJ A;  4POW A;  2UYF A;  2XD2 A;  1HSJ A;  3FVN A;  3TDJ A;  3VXB A;  2A5T A;  3FV2 A;  1Y1Z A;  3OEK A;  3K6X A;  5KCJ B;  1MPC A;  2GFE A;  4G68 A;  4YB6 A;  1AMF A;  1ZKB A;  4QSC A;  4G4P A;  4OEU A;  3K0V A;  1Z7N E;  3IK6 B;  4KD5 A;  4QFN A;  4OFL A;  4QFO A;  4ESW A;  2UYE A;  4POX A;  3A3U A;  4JWO A;  3C4M A;  4YB7 A;  5EHS A;  4IGR A;  1R9L A;  4N07 A;  4N13 A;  4YKP A;  3SEW A;  4XKQ A;  4F22 A;  2VD3 A;  4NE4 A;  2OWS A;  3FV1 A;  3FAS A;  1TXF A;  3N94 A;  3SEX A;  1ZTY A;  5TP9 A;  4RK2 A;  3Q25 A;  5TPA A;  4GIZ A;  3TTL A;  3O6G A;  1DSN A;  3ZKK A;  2VGQ A;  3U1O A;  2OK2 A;  3PMX A;  1Y3N A;  1I6Q A;  1QJM A;  1R1N A;  1A54 A;  1SW5 A;  2UVI A;  3E13 X;  3H06 B;  3IO6 A;  1VFE A;  4H0W A;  1MXY A;  4DIG A;  2I0B A;  1SBP A;  1ZLQ A;  5H8Q B;  3CIJ A;  1TFD A;  3H4Z A;  4OMB A;  2R6G E;  3BFU A;  2V3Q A;  1A8F A;  3C36 A;  3LSX A;  4GXA A;  5CC2 A;  5DT6 A;  3KOT A;  3TEL A;  3TKD A;  2I58 A;  5TU0 A;  1VE4 A;  5LOM A;  3IO4 A;  2X7Q A;  1JVY A;  1QVS A;  2DOJ A;  3IOU A;  3CG3 A;  5FHO A;  4NF8 A;  5TPA B;  5EHM A;  1BTJ A;  4H5F A;  2ZYO A;  3SEU A;  4LZ7 A;  1IXC A;  1N7X A;  3S9M C;  4DXC A;  2QS3 A;  1NFT A;  5CRY A;  2ESN A;  3FVG A;  1D9V A;  3JZJ A;  4KI0 E;  3R6U A;  4XKN A;  4ZEF A;  4E0X A;  4EQ9 A;  2YPN A;  4N6P A;  4M1V A;  4OYV A;  1PBP A;  3UIF A;  2UXA A;  4U22 A;  2XXQ A;  4ZS9 A;  1BLF A;  2YJP A;  4MH5 A;  3G3G A;  4THI A;  5HPQ A;  1MXU A;  3S9E A;  1M5F A;  1XS5 A;  4IO4 A;  3RUM A;  4EF1 A;  1ATG A;  1S7Y A;  3BFT A;  1O64 A;  3KEI A;  1YTV A;  4QSD A;  4UA8 A;  1DOT A;  3WAF A;  2XX7 A;  2GHB A;  1LLS A;  5ICT A;  2R71 A;  4WEP A;  1QKA A;  5K2X A;  2H98 A;  4G8H A;  1B46 A;  3PUY E;  4EF2 A;  2ZYN A;  4C1U A;  2V93 A;  5L8D A;  3SDF A;  4ELR A;  3N26 A;  4IY6 A;  4PE5 B;  5J1D A;  1JW4 A;  3G7W A;  5I58 A;  3MVY A;  1WVJ A;  1URD A;  1FCK A;  3C32 A;  4R6Y A;  3FJ7 A;  2OWT A;  4DDD A;  2ONK E;  2DSF A;  3E3K A;  5CMC A;  4F3P A;  1OQH A;  3OO9 A;  3ZS6 A;  3VVD A;  3K6W A;  5BUU A;  5IAI A;  1LGB C;  4R75 A;  3G3I A;  1BIY A;  3S4U A;  4EQB A;  3SEV A;  3QUF A;  4ISU A;  3K4U A;  4WKM A;  3OSR A;  1FTM A;  5I2K B;  4YZZ A;  3U94 A;  3DP6 A;  5I2N B;  3AXF A;  3Q28 A;  3CSB A;  1SI0 A;  3RNN A;  3W9W A;  3PMV A;  2Q2A A;  2FA7 A;  2W7Y A;  1N7W A;  5H8S A;  1GGG A;  4X1B A;  3IB1 A;  4DZ1 A;  4ECF A;  1NH7 A;  2QRY A;  3T96 B;  3TYH A;  1XT8 A;  1RYX A;  3K1M A;  3U93 A;  1JET A;  3HST A;  4JBZ A;  2H99 A;  2F34 A;  2PBW A;  3FAT A;  4RA1 A;  3DEL B;  3A09 A;  2ZMB A;  1Y4T A;  4R9F A;  3O28 A;  3ILU B;  1GTK A;  2F8D A;  1GR2 A;  3C9H A;  2Q2C A;  2ZYK A;  3KJ7 A;  4OEV A;  4RY1 A;  5TP9 B;  1IXG A;  3TPA A;  3KN7 A;  1B4H A;  4ELP A;  5A5X B;  5KZT A;  5L9S A;  2F35 A;  3OXN A;  2NXO A;  1XHY A;  3KBR A;  4XTC Q;  1USY H;  5FHN A;  4F3B A;  3OEN A;  3V89 B;  2HXW A;  4OFO A;  4KYS A;  3MPK A;  3MQ9 A;  3PGF A;  4FEB A;  4NF4 A;  5CMB A;  4DCX A;  4ELO A;  1NKX A;  3G3K A;  1XVX A;  2OCU A;  3THI A;  1J1N A;  4KCC A;  2BJJ X;  3Q26 A;  4ZEK A;  1OMP A;  1UTB B;  3PPR A;  3GBA A;  4PQJ A;  1B9J A;  3ODB A;  3B6T A;  3C34 A;  4M4G A;  5H8H B;  4FAT A;  1O63 A;  2Z22 A;  1AH5 A;  4JWY A;  4K3F A;  4OVJ A;  2Q8J A;  2ONR A;  2NVU B;  3VVF A;  1MY2 A;  2P0S A;  3T9V A;  3B6Q A;  4X9T A;  4MFI A;  3OO7 A;  3RT8 A;  4PFU A;  3TZA A;  2Z23 A;  5DEX A;  4JB7 A;  1ZJL A;  3T93 B;  4ELQ A;  1TWY A;  5AA4 B;  2RIN A;  3CFX A;  2IEE A;  3K02 A;  1A8E A;  3FXQ A;  3K6V A;  3HPI A;  4KYD A;  2A5S A;  4RXL A;  3U92 A;  2Y7I A;  2H5Y A;  2F7A A;  5K2Y A;  4KCD A;  4NTL A;  1SI1 A;  1CE2 A;  2CZL A;  3VLV A;  3M8U A;  4G2Z A;  4F1V A;  1DMB A;  1NNK A;  2Y84 A;  2I3V A;  3RTF B;  1QUK A;  1US5 A;  3TQL A;  5HM4 B;  1PB8 A;  2DWA A;  1LCT A;  3M3K A;  4H1X A;  4PP0 A;  5L9M A;  3D4G A;  3KG2 A;  1AIV A;  2O69 A;  3OOA A;  3OEL A;  3CVG A;  3OEM A;  4I62 A;  3T9H B;  4BLA A;  4DXU A;  3EQ1 A;  4NF5 B;  1LFI A;  3VDF A;  2P2A A;  4QFL A;  2AIX A;  2KLF A;  2X26 A;  3H6V A;  4GF8 A;  1N3W A;  3HHG A;  4KHZ E;  3O2A A;  5CBR A;  2HAU A;  4Q30 B;  1A99 A;  4X48 A;  1FTJ A;  1IXI A;  2HZL A;  3PPN A;  5ICQ A;  2DXR A;  3RLF E;  4ZE9 A;  3TAJ A;  1B5I A;  3PPO A;  4F1U A;  2I48 A;  3MJN A;  5CI5 A;  1MPD A;  3O6I A;  4GRK A;  5ITP A;  2B65 A;  4GXS B;  4LZ8 A;  4AB5 A;  5AE4 A;  3DP8 A;  1LFG A;  1LBB A;  4YIC A;  4LVQ A;  3PPQ A;  4KQP A;  3D4C A;  1UTH B;  3M3F A;  4PFY A;  5ISU A;  2HQ0 A;  4GL0 A;  3FVK A;  1IIT A;  1PB7 A;  2VP1 A;  3MW0 A;  3O9P A;  4OES A;  2I0C A;  1B05 A;  3RTW B;  3U72 A;  1Y4C A;  3U8Q A;  1ZIU A;  2PMS A;  3SKP A;  4H67 A;  2O84 X;  3R26 A;  4IO3 A;  1Y20 A;  4OZ9 A;  3UGW A;  2QJE A;  2RC9 A;  3IOT A;  5JK4 A;  4ZED A;  3TTR A;  1LFH A;  1FTK A;  1B7Z A;  1BP5 A;  1B2H A;  4FED A;  3K2D A;  1JNF A;  1L5T A;  1OLA A;  4R72 A;  1POT A;  3UP9 A;  2PT2 A;  3KN8 A;  4QFK A;  3PMW A;  5I2N A;  4F18 A;  1MH4 A;  2F78 A;  1CB6 A;  2XHD A;  1B1H A;  3HV1 A;  3IAZ A;  3H7M A;  1VFD A;  2F7B A;  4OER A;  1BKA A;  3TCG A;  1ANF A;  5CMK A;  2ZYM A;  2YLN A;  3GLB A;  5AA2 D;  4H5G A;  2DWH A;  1B3L A;  1SW4 A;  1MDQ A;  4TOZ A;  1B4Z A;  3EHT A;  1URS A;  2GH9 A;  1MY4 A;  1OIB A;  2ONS A;  3CRB A;  3PPP A;  2PT1 A;  4I8C A;  1XC1 A;  4QHQ A;  3N6U A;  2RF1 A;  5CBS A;  2D5W A;  1SW1 A;  1OVT A;  1JEU A;  2Q88 A;  4ZE8 A;  1PBQ A;  3HN0 A;  4R73 A;  1XOC A;  4E0W A;  1NNT A;  4LZ5 A;  2ZNU A;  3KSX A;  3RGY A;  1HSL A;  3MPL A;  1FTO A;  1D3K A;  4KR5 A;  1I6B A;  4O3A A;  2F6G A;  3O97 A;  4JSD A;  4R74 A;  1MDP 1;  2XXR A;  1F9B A;  3IB0 A;  1ZBM A;  3PU5 A;  3Q27 A;  4KFQ A;  2NOO A;  4P0G A;  3L6H A;  1QKB A;  5DEX B;  1DTZ A;  1N84 A;  2AYS A;  1Q35 A;  3CI8 A;  1SQY A;  3KFM A;  4I9D A;  4R9G A;  1SYH A;  4R2F A;  4BDM A;  3S9N C;  2XXI A;  1UIU A;  2Z8F A;  4KPT A;  4NMY A;  4OXV A;  5I59 B;  3ILT B;  4OQO A;  4EUO A;  5H8N B;  4GOT A;  4LAT A;  1B0H A;  1DPP A;  2QL3 A;  3CG1 A;  3ZKL A;  2Z8D A;  1P1W A;  4DE8 A;  3P7I A;  1NL5 A;  2DYX A;  4QSE A;  5IKB A;  3IOW A;  5I2K A;  4MBP A;  1SW2 A;  2QMW A;  2ZNT A;  3MP6 A;  3TTM A;  3VXC A;  2E1S A;  2XX8 A;  4FOR A;  1NNP A;  1SD3 A;  1SVX B;  4LON B;  3UOR A;  4NF5 A;  4FEC A;  1GVC A;  2XXU A;  4YMA A;  2I4B A;  4O3B A;  3LC8 A;  3VVE A;  4GD5 A;  1S9T A;  3A3C A;  5I59 A;  2O51 A;  4PET A;  4TLM B;  5FTI A;  1B32 A;  4GVO A;  4H65 A;  3FZV A;  4ZDM A;  3RY3 A;  3H6W A;  4U21 A;  4C1T A;  4F39 A;  3IJO B;  3E4R A;  2ZNS A;  4MF3 A;  1N76 A;  2DE3 A;  4QRZ A;  3RPW A;  3W9V A;  4C0R A;  1EZP A;  4OTE A;  2FNC A;  4BDN A;  5M2V A;  1YPN A;  2VD2 A;  4Q8R A;  3B7D A;  2DP8 A;  2G29 A;  5AA3 A;  3SES A;  4ESX A;  1US4 A;  2HAV A;  1RYO A;  2XXP A;  1TFA A;  3KZG A;  1PEB A;  2AL5 A;  3LBS A;  3M3L A;  3PV0 E;  4IY5 A;  4MLQ A;  3MWB A;  4ONY A;  5JTY B;  4QFP A;  1B5H A;  2QS1 A;  3H6T A;  4NED A;  1R9Q A;  4HW8 A;  2DQV A;  3O29 A;  5H8F A;  2D3I A;  1II5 A;  1B0L A;  2F7C A;  3UN6 A;  4F31 B;  5KCJ A;  1LBC A;  1H3D A;  3LSL A;  3JYR A;  3Q29 A;  1I69 A;  2OJT A;  4G8M A;  1LAX A;  2XXH A;  5I58 B;  1H45 A;  3FJM A;  3QSL A;  4U1Z A;  4AQ4 A;  1FQC A;  4BDR A;  3CSG A;  1NH8 A;  2D21 A;  3HO7 A;  4G77 A;  4YKK A;  1DPE A;  1YCJ A;  2NWJ A;  1B6H A;  4JWX A;  3V8X B;  4F2Q A;  1FQE A;  1JVX A;  5F7V A;  1MY0 A;  3G3F A;  3OO8 A;  4LA9 A;  3LR1 A;  5F1Q A;  3USD A;  3WAE A;  4IO2 A;  1UTH A;  4HCY A;  4EDP A;  4U4S A;  2I6E A;  2P1S A;  3PUX E;  4H8J A;  3S9L C;  1B40 A;  1PB9 A;  2XX9 A;  3GZG A;  3I6V A;  4PFT A;  2DS9 A;  2GRV A;  4JDF A;  3PUV E;  1R6Z A;  3T9X B;  4F1Y A;  2DE4 A;  5H8Q A;  4L17 A;  1N04 A;  1MM7 A;  3C31 A;  1SDX A;  4ND9 A;  2G93 A;  5EYF A;  1EH3 A;  2Q9T A;  3SER A;  4Z7E A;  2O6A A;  1MQD A;  3LSW A;  1MS7 A;  3TFL A;  1LB8 A;  1LAF E;  2QMX A;  1LAH E;  1RKM A;  2V25 A;  3HHF A;  3T22 A;  5B7D A;  3IL1 B;  2XXY A;  3G3H A;  3N6T A;  4OWD A;  3TEP A;  1USY E;  2XXV A;  5AA4 A;  2F5X A;  2H4I A;  3KSJ A;  1B7H A;  3K6U A;  2QS2 A;  3OMB A;  3I5O A;  5CM6 A;  3OO6 A;  1N0T A;  4OHN A;  1WOD A;  4XXU A;  1O7T A;  3BKI B;  3IR1 A;  2GHA A;  1LCF A;  3FUZ A;  3H6U A;  3O6H A;  4FJP A;  4YMB A;  1MQI A;  2RC7 A;  1B58 A;  5AA1 A;  1IXH A;  3MZB A;  1LAG E;  2X7P A;  1JQF A;  4Z0I A;  3V83 A;  4LP2 B;  3EHU A;  2R9J A;  3VLW A;  4LQ2 A;  3IB2 A;  1MQG A;  4GWO A;  2F97 A;  4R6K A;  3F11 A;  1H43 A;  1M5C A;  3FXU A;  1QUJ A;  2LAO A;  5HBC A;  5DVI A;  1AL3 A;  2F6P A;  3FJG A;  3MUQ A;  4NWD A;  2AL4 A;  4RYA A;  4UAC A;  3IOV A;  3SEY A;  1MM6 A;  3FVO A;  4AB6 A;  2XXW A;  4BDL A;  5CMM A;  2DE2 A;  1D4N A;  3DLN A;  3ECR A;  3FXR A;  3MBP A;  3LUY A;  5L9O A;  2RCB A;  4RJZ A;  5FTH A;  3QXM A;  1Q1K A;  2NUV A;  3W15 C;  4DLD A;  1EU8 A;  4HTG A;  1OVB A;  1P99 A;  2UVG A;  2ZXT A;  4Q0C A;  1MXV A;  1JW1 A;  4XIG Q;  1B1X A;  5DVF A;  1WDN A;  1UQW A;  3QIM A;  3TUS A;  5DTB A;  4H6D A;  4ZZE A;  1P1U A;  4F29 A;  1MPB A;  3N5L A;  3S2V A;  1MXW A;  3GXA A;  3KJT A;  3G3J A;  1B3E A;  4DCY A;  2V84 A;  4F3G A;  1M5D A;  4RPO A;  1XVY A;  1FQD A;  5JTY A;  5KDT A;  4RPN A;  2H9B A;  1B7U A;  2UVJ A;  2O1L A;  3IX1 A;  3CR9 A;  5ITO A;  3TOD A;  5I56 B;  2REJ A;  2FYI A;  2IA4 A;  3K00 A;  3MP1 A;  1GV8 A;  3VV5 A;  1MXZ A;  4F3S A;  1LB9 A;  3IOR A;  2H25 A;  1TT1 A;  4TLL B;  1MY3 A;  4YAH X;  5B70 A;  1T0K A;  5H8H A;  4G68 C;  3H03 A;  2A5T B;  4ZEB A;  3C35 A;  1HSE A;  2M8C A;  2Y7P A;  2XD3 A;  3L6G A;  3MP8 A;  2CMO A;  3QAX A;  3FD3 A;  2I3W A;  3KGC A;  4FIM A;  1JW5 A;  4P11 A;  4TQU Q;  3FIR A;  4H8I A;  1Y3Q A;  2V3T A;  3GBB A;  4XKP A;  5FHM A;  1FQA A;  3BBR A;  2QPQ A;  4MLV A;  3VFJ A;  1LST A;  1ELJ A;  4IO5 A;  4U23 A;  4YKI A;  3EF7 A;  2WKY A;  4ZEI A;  1SYI A;  4ZEC A;  3DP4 A;  4NF6 B;  2PYY A;  4BDQ A;  3SET A;  3MAM A;  4HS7 A;  4P0I A;  4X1D A;  1MY1 A;  1M5E A;  4YU0 A;  3K1P A;  1OLC A;  1FQF A;  3CFL A;  3DM0 A;  1B3F A;  2DWI A;  1Z7M E;  3MC2 A;  2O7U A;  1H44 A;  4R6H A;  5H8N A;  3T66 A;  4LUB A;  4G68 B;  4EXK A;  4FAJ A;  1PDA A;  3HCQ A;  2HCA A;  3ZSF A;  4EXL A;  5I57 A;  5I56 A;  2RCA A;  1IEJ A;  4OEN A;  1Y3P A;  1B52 A;  1MG1 A;  3MZ9 A;  3RN8 A;  2PVU A;  1IUD A;  4OFJ A;  5KDT B;  3QYT A;  4F19 A;  3PUW E;  4HCW A;  2F36 A;  4IGT A;  2VOZ A;  4U1O A;  4Q5T A;  5DYH A;  3R7X A;  2I49 A;  3MZ1 A;  3RT6 B;  3TMG A;  1VSO A;  2HFB A;  3E9X A;  2PX1 A;  1URG A;  2RKM A;  2DVZ A;  1MQH A;  4GLI A;  3TCF A;  2Y7W A;  2OBG A;  2I4C A;  3EPE A;  4DXB A;  2VHA A;  4GFR A;  2ABH A;  3MVX A;  4GQO A;  4OET A;  2Z8E A;  1B3G A;  1FQB A;  1MXX A;  1EZ9 A;  4ZZA A;  2ANJ A;  3QUJ A;  4WED A;  1PC3 A;  1YAE A;  1S50 A;  2O7I A;  2THI A;  1OQG A;  2XXT A;  2B3B A;  1KWH A;  2HEU A;  2DVC A;  3TQW A;  4IO6 A;  1IZ1 A;  1N3X A;  5ELV A;  1A55 A;  2QSX A;  1FW0 A;  3MVW A;  1B3H A;  3IJX B;  4LQ5 A;  2O68 A;  1QUI A;  1EZO A;  1B51 A;  3RQT A;  4YKJ A;  2O1M A;  1P1N A;  2UVH A;  2Y7R A;  3PUZ E;  4EQ7 A;  4JXI A;  3K1N A;  2REG A;  3V5A A;  5I57 B;  3TCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...