1IITA

Glur0 ligand binding core complex with l-serine
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
226
structure length
221
Chain Sequence
GSAMALKVGVVGNPPFVFYGAFTGISLDVWRAVAESQKWNSEYVRQNSISAGITAVAEGELDILIGPISVTPERAAIEGITFTQPYFSSGIGLLIPGTATPLFRSVGDLKNKEVAVVRDTTAVDWANFYQADVRETNNLTAAITLLQKKQVEAVMFDRPALIYYTRQNPNLNLEVTEIRVSLEPYGFVLKENSPLQKTINVEMLNLLYSRVIAEFTERWLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms for ligand binding to GluR0 ion channels: crystal structures of the glutamate and serine complexes and a closed apo state.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Membrane protein
molecule keywords Slr1257 protein
total genus 69
structure length 221
sequence length 226
ec nomenclature
pdb deposition date 2001-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iitA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iitA02
3RT8A 3TDJA 3N26A 3MWBA 1A8EA 4DDDA 4TLLB 1Y1MA 2OZZA 3FZVA 4EXKA 1NFTA 1TFDA 2A5TA 2AYSA 1AIVA 1LLSA 4KCDA 4TQUQ 3C32A 3M3FA 3EHUA 4GFRA 1B46A 3OO7A 3PD8A 3PPPA 4JSOA 4XKPA 5L8DA 3RTWB 4GXSB 3TKDA 4DCXA 4ELQA 1JW5A 1EH3A 4LZ7A 1NNFA 1MM6A 2O69A 3LR1A 1JETA 1N04A 4QRZA 4U23A 3BFUA 1CB6A 1B2HA 1D9VA 2I0CA 2V3TA 4IY6A 2I3WA 4ZDMA 4LQ5A 2F7CA 1B7ZA 2I6EA 3ONMA 2IA4A 1GVCA 1ZJLA 2PVUA 4BDMA 2NVUB 2PBWA 3ZKKA 2YLNA 3PPNA 3OSRA 2DE2A 4QFOA 4F3BA 2Y7RA 2PT2A 5H8FB 3HCQA 1OVBA 4MBPA 3SEWA 1LAXA 1LSTA 4Q0CA 1DMBA 1PB8A 2DSFA 4DLDA 4F1UA 2DQVA 3DELB 3EN3A 1T0KA 1P1WA 4YU0A 2H25A 2HZKA 2QS3A 2H99A 2NOOA 1SD3A 5CMMA 5M2VA 4F2QA 3IB2A 5I2NA 2DXYA 1SQYA 3PUZE 2OBGA 1SI0A 2Z8EA 3OMBA 3A3CA 2OK2A 2XXVA 4H6DA 3GBAA 1MQIA 4MLVA 4YKIA 3V5AA 4BDNA 4KFQA 1TFAA 1UTBA 3K1NA 4G2ZA 4G68B 4RNSA 2DWJA 1MQJA 3W9VA 4THIA 2HZLA 2XXRA 1B1XA 4LONB 2V25A 5EHSA 4QFPA 1B52A 2DVCA 4M1VA 3MAMA 2H5YA 1AMFA 3VDFA 1IXGA 1DTZA 1LGBC 3O6GA 4BDLA 5ISUA 2QSXA 1B40A 1O64A 1R6ZA 5ITPA 3CSGA 1I6BA 3SEVA 3EHSA 4NWDA 2GH9A 1NNKA 3OELA 3HSTA 3OEKA 3T9VA 2FA7A 4F29A 5H8QB 2F97A 1PC3A 4GVOA 5TPAA 5ICQA 4H8IA 5H8NA 3K6XA 4QSEA 3QYTA 5F1QA 3USDA 1A99A 4Z7EA 1S9TA 4FORA 2CMOA 2Q88A 3KGCA 2REGA 3O29A 4LZ5A 4OEUA 5FHNA 4C0RA 5I57A 1YAEA 3L6GA 3Q29A 4DXBA 4PFYA 4DZ1A 1SYIA 1NH8A 5DT6A 1B5JA 5L9SA 2Z8DA 2Z8FA 1B0LA 1Q1KA 5H8SA 1H76A 4ZZEA 3UGWA 2O7IA 3ILUB 3MBPA 4XKRA 3EQ1A 4RK9A 1YCJA 3RN8A 3I5OA 2XXIA 2Y7KA 4RY1A 1JW1A 3IR1A 3HPIA 4NF8B 4OENA 3TPAA 4RK2A 1MM7A 2P1SA 1MXUA 1SBPA 3C31A 4G8MA 4ONYA 1GV8A 5ICTA 4YKKA 1JEVA 3LC8A 3ECRA 4IGRA 4E0XA 3FJMA 3N6TA 3M3KA 1B3GA 1MXXA 2PX1A 2DWIA 4KI0E 5I58A 3RGYA 2OLBA 4POWA 1B05A 2OWTA 4AB6A 3TUSA 3OENA 3QSLA 4OZ9A 3G3GA 3K6VA 3O66A 3VVDA 4H1XA 4OFJA 4WEPA 1ANFA 1B7UA 3TMGA 2HQ0A 4JB7A 3C4MA 4QFLA 4I1DA 3A3UA 3KEIA 1PDAA 1ZBMA 3R26A 5EHMA 3UORA 1XT8A 3MJNA 1WDNA 4G8HA 5AE4A 4P11A 3CIJA 3DM0A 3KJTA 3TZAA 2O6AA 2ZNSA 2DE4A 3FIRA 4OESA 4U4XA 2PYYA 2I4BA 3OEMA 5IAIA 2AIXA 3H4ZA 3IX1A 3S9EA 1LBBA 1R9LA 4F39A 1QUJA 3IORA 1LAHE 1MXZA 4G77A 4RA1A 4ZZAA 1Y3NA 4X1BA 1PEBA 2ZYKA 3U92A 4JWOA 3T9XB 1TXFA 3MQ9A 4XKQA 3R6UA 3SKPA 4NF6A 2RINA 2RC8A 2R6GE 2D3IA 2DP8A 3PPQA 1OQHA 3CI8A 2THIA 3D4GA 3V8XB 3LUYA 5LOMA 4O3CA 4M4GA 1BP5A 4BDQA 1US5A 3G7WA 2ZNTA 4HCWA 5IKBA 3FGSA 3PMXA 5I2KA 1Y3QA 4FE8A 1F9BA 2Y7WA 4FIMA 3SEXA 4OHNA 1EU8A 3CRBA 4XXUA 1HSJA 1NKXA 3W15C 4GOTA 2DWHA 2UVGA 4YICA 1XVXA 1NL5A 2HFBA 3B6QA 4YKJA 3FUZA 3MPLA 4GWOA 1UTHA 3U94A 2O51A 3FV2A 4GIZA 4KR5A 4O3AA 3UN6A 2ALUA 3V89B 4ZEDA 2ZNUA 1MXWA 3IB0A 5A5XA 3CSBA 4KCCA 3UK4A 2ANJA 2F6PA 2F36A 3BBRA 1IEJA 4DIGA 1JVXA 3IJXB 3KOSA 1ZU0A 3PPRA 1MY2A 4DXCA 2QPQA 1S7YA 1JQFA 2HEUA 2HAUA 3TAJA 4EDPA 1OLAA 2D21A 3FXQA 3H6TA 3ZKLA 3KN7A 1MQHA 1TT1A 3O97A 4PFWA 4OFOA 3E4RA 4ZEFA 1A40A 1LFGA 1Q35A 4ZEIA 1B5HA 3MZ1A 3P7IA 1II5A 4Q5TA 4R73A 2I48A 2RCBA 3JZJA 2ZMBA 4OWDA 1MH3A 2DS9A 4OTEA 4ELRA 4XTCQ 5AA4B 4KYSA 2YPNA 2V3UA 3TFLA 4MF3A 1DPPA 5AA1A 4EF2A 1UTHB 2X7PA 4Q8RA 4C1TA 1SVXB 3U1OA 4LA9A 1B9JA 3HN0A 5KDTB 2X7QA 4F3GA 1A55A 3TQWA 4EQ7A 3GZGA 1US4A 2IEEA 3TTNA 5KCJB 4OVJA 4ZE8A 1NH7A 1LB9A 5TP9B 4R74A 4F1YA 5AA3A 2RF1A 1IZ1A 1FQCA 2V93A 2BJJX 2HAVA 1MDP1 5HBCA 1FTLA 2I4CA 2V84A 2X26A 1MG1A 2QS1A 1VE4A 5H8NB 3Q25A 5JTYA 2P2AA 3HO7A 1MS7A 4NF5B 5I56A 1B7HA 4P0GA 4NF5A 1Y1ZA 2Z23A 4FEDA 4LUBA 3HHFA 5I2KB 2PT1A 1MY3A 3R7XA 1FQEA 1RYXA 4YB7A 3TCHA 4C1UA 3KBRA 5ITOA 1M5BA 1VFDA 2H9BA 3PU5A 5CMBA 4OETA 1MH4A 5DTBA 3KSJA 2UVJA 1H45A 5I84A 1IITA 2O84X 3H03A 2VOZA 3KSXA 1N3XA 2O68A 1O63A 4JBZA 3Q26A 4LP2B 4ELOA 3OO9A 3RPWA 3F11A 1ATGA 3H7MA 4NEDA 1MRPA 4KQPA 5H8HB 3OXNA 3MP1A 3C9HA 4I9DA 2XX9A 4OMBA 3OOAA 4LATA 1LCFA 1QKAA 3C35A 3RLFE 1EZ9A 2E0SA 4ZE9A 1P1OA 4N13A 1MPDA 1ZIUA 2DVZA 4GXAA 1FTJA 3W9WA 4BLAA 3H06B 4HW8A 3T9HB 1MY4A 1Y4TA 1OLCA 3G3KA 5B7DA 3T93B 3U8QA 4ISUA 3VFJA 2GHAA 1IXCA 2ONRA 2H98A 3QXMA 2VGQA 4RJZA 4ELPA 4EUOA 1LAGE 2P0SA 4ECFA 2Q8JA 4O3BA 5FTHA 1I6AA 3FD3A 3QAXA 2O1LA 3OO8A 2XX7A 4POXA 5HPQA 3PGFA 2F78A 4IO2A 3FV1A 2RC7A 1N7WA 3K1MA 3FVOA 4L17A 4KD5A 4ESXA 2H4IA 2OCUA 3S9NC 1N76A 1XVYA 2O7UA 3O6IA 5JTYB 2B3FA 4MLQA 4OFLA 1A7LA 3PMWA 3G3JA 5DEXA 1D4NA 3K4UA 4R6HA 2QJEA 3KZGA 4HS7A 1WODA 1D3KA 3E9XA 1KWHA 1I69A 3M3LA 4ND9A 2ZYOA 1POTA 3MVWA 2XXYA 4KPTA 4H65A 1B32A 4YMAA 4QSCA 1JW4A 1S50A 4AB5A 5A5XB 3IB1A 4BDOA 4IO7A 4OQOA 1LAFE 4MH5A 3LSFB 1FTOA 4GRKA 3ZSFA 1JVYA 2KLFA 4YB6A 4NF4B 2Y7PA 3GXAA 2RC9A 2G29A 3CG3A 1HSEA 3MVYA 3UA8A 4FJPA 1RYOA 3VV5A 1IXIA 5CMKA 1SW1A 4XIGQ 4U2RA 2DWAA 4ZEKA 1GR2A 1LB8A 3LSLA 4IO6A 4R72A 5TPAB 4RPNA 1MY0A 3K02A 2UYEA 2XXQA 5F7VA 1SYHA 1SW5A 2Q89A 1B58A 3V83A 3D4CA 1DSNA 3ILTB 2VD3A 2XXUA 3VLUA 4LVQA 2ESNA 3G3FA 3VE1B 3DLNA 2QS2A 2ZYMA 4PFTA 5FTIA 1VFEA 3I3VA 4OERA 2QMWA 1BLFA 1TWYA 2DOJA 2QRYA 4UA8A 4TLMB 4KYEA 1FQAA 5H8HA 3SEUA 2GRVA 2I0BA 4JSDA 3C36A 1J1NA 1ZLQA 5L9MA 3THIA 3TYHA 5L9OA 2F7BA 3LBSA 4JXIA 4X9TA 2R9JA 3PPOA 4NF4A 4X48A 1IQ7A 5DVJA 3TCFA 1IUDA 2M8CA 3RNNA 1EZOA 1B3EA 1P1QA 3KN3A 4Q30B 4RPOA 1YPNA 2Z22A 1RKMA 4YKPA 2CZLA 3KN8A 5DYHA 1BTJA 1URSA 3UP9A 3DP6A 5I56B 3K01A 3GBBA 4NF8A 4N6PA 3CFZA 3MZ9A 3TTMA 5AA2D 3U72A 4U1OA 2E1SA 1MXVA 2QL3A 3HV1A 2UYFA 1PBPA 3IO6A 4OEVA 4F3SA 1OMPA 3BFTA 2RCAA 4G4PA 3IOVA 4PP0A 3QUFA 1FTKA 2O1MA 3MP8A 3B6WA 4I62A 4JWXA 3SESA 2F35A 1XC1A 1NNTA 4F1VA 2GFEA 2ONSA 4GL8A 3CFLA 4LZ8A 3S9MC 3EHTA 2OJTA 2NUVA 3IOTA 4IO5A 5B70A 2XXWA 4X1DA 5DEXB 2NXOA 3RTFB 4FAJA 1M5CA 3RQTA 2DE3A 2XX8A 4GD5A 1JEUA 1FW0A 1N3WA 3S2VA 4R2BA 3O6HA 4I8CA 1SI1A 3T22A 5CC2A 1PB7A 5K2YA 3SDFA 5H8QA 1P99A 2ZXTA 4GL0A 5I57B 4MFIA 2VD2A 2XXPA 4JWYA 4QF9A 1IXHA 1UIVA 1XHYA 3DP8A 2OWSA 3K1PA 2NWJA 2Y84A 3SERA 4WEDA 3VVFA 4NWCA 2F7AA 1L5TA 4H0WA 2I49A 4H5FA 2I58A 2A5SA 3H6UA 5CI5A 1QJMA 4DCYA 4F19A 1R1NA 4DXUA 3DP4A 1MDQA 3K6WA 1A54A 1LFIA 4R9FA 2YJPA 1XS5A 4WXJA 1URGA 1MPBA 2B3BA 2QS4A 1BKAA 1FQBA 5CRYA 5ELVA 5AA2B 5BUUA 1MY1A 1B3HA 1XOCA 5CBSA 4R6YA 4ZEBA 4PE5B 1USYE 4OYVA 1UTBB 4G68A 5FHMA 2DXRA 5K2XA 3O28A 5JK4A 5BWJA 1IIWA 1QKBA 3PUWE 3QIMA 1N0TA 1OVTA 1AOVA 4DE8A 3MVXA 5TU0A 2QMXA 1ELJA 1B51A 3T66A 4F3PA 3TQLA 2REJA 3KJ7A 2Q2AA 3K2DA 3FASA 3I6VA 2D5WA 2XXHA 3A09A 4H8JA 3B6TA 2HCAA 2W7YA 2I3VA 4PETA 4R75A 3PMVA 1R9QA 1DTGA 3JYRA 2UXAA 2AL5A 3Q27A 2Q9TA 2V3QA 1N7XA 5KCJA 1A8FA 1PB9A 1WVJA 1Z7NE 2UVHA 4HTGA 4RXLA 3RY3A 3VLWA 3SEYA 3UIFA 4N07A 1P1UA 2Y7IA 4YZZA 3GLBA 1PBQA 3SETA 3EPEA 1MXYA 3N94A 5J1DA 3N6UA 3MZBA 4QSDA 3S9LC 4F22A 5TP9A 5AA4A 4ESWA 3K0VA 4EQBA 1EZPA 4EXLA 5I58B 5I59B 3FATA 3FVKA 3WAFA 2AL4A 1O7TA 2GHBA 3IAZA 1GTKA 4PFUA 1P1NA 3FVNA 3E3KA 3KG2A 3U93A 5CBRA 1VSOA 2F5XA 4UACA 3PUYE 4NMYA 3PUXE 3OD7A 1UIUA 2WKYA 3C33A 3MP6A 5EYFA 3T96B 3T9UA 4F31B 1B6HA 1LFHA 2F34A 3FXUA 1FTMA 1FCKA 1URDA 2FYIA 4JDFA 4IGTA 3PD9A 1Y9UA 1MQDA 1B5IA 1QUKA 1ZKBA 2G93A 2XD3A 1Y3PA 3KFMA 3PUVE 4G68C 4H5GA 4IY5A 4KYDA 3VXBA 3VXCA 4ZECA 3L6HA 2Q2CA 1NNPA 1YTVA 3MW0A 4GLIA 4TOZA 4U1ZA 1QVSA 2ABHA 3KOTA 3OSQA 3QK6A 3RT6B 1HSLA 2F6GA 2XHDA 3MPKA 1M5DA 3FJ7A 1QULA 4G8NA 1D9YA 1MPCA 4QFNA 3LSWA 4RYAA 4U21A 3H3GA 1BIYA 3G3IA 4QHQA 4U4SA 3RUMA 1UQWA 2VHAA 1N84A 1B3FA 1H3DA 5DVIA 5HM4B 4FEBA 1ZMGA 4F18A 3IOUA 3TTKA 1POY1 3B7DA 1M5FA 2LAOA 3EF7A 2XXXA 4YB5A 4YAHX 4BDRA 1LBCA 3CG1A 3WAEA 1FQDA 1B4ZA 2DYXA 3CFXA 3FJGA 3HHGA 4H67A 3TTRA 4U22A 4EF1A 3QUJA 1M5EA 4IO3A 1DOTA 1ZTYA 1JNFA 3CR9A 1Y4CA 3IL1B 3K6UA 4PQJA 1B1HA 3ODBA 4R2FA 3TELA 1OQGA 3O2AA 5AA2A 5JEIA 5DVFA 3JV9A 1OIBA 4EQ9A 1VR5A 3TTLA 1SW4A 3MUQA 3VVEA 4NF6B 4P0IA 1B0HA 2R71A 2RKMA 1AH5A 2PMSA 2F8DA 3MC2A 1QUIA 4Z0IA 1FQFA 3CVGA 1GGGA 4AQ4A 2UVIA 5CM6A 3IJOB 4QFKA 3E13X 5FHOA 3TEPA 2A5TB 1I6QA 3FXRA 1SW2A 3H6VA 3PV0E 5I2NB 3G3HA 4FATA 3VLVA 3LSXA 3FVGA 4GQOA 4YMBA 2B65A 3K00A 1QW0A 3M8UA 1MQGA 4K3FA 3BKIB 3C34A 3Q28A 4KHZE 1CE2A 4IB2A 5CMCA 4F2OA 1H43A 1LCTA 1B4HA 3IK6B 1SDXA 1H44A 1USYH 4E0WA 3OO6A 3TCGA 5H8FA 4LQ2A 3N5LA 4WKMA 3TODA 5KDTA 3ZS6A 1DPEA 3AXFA 3MVZA 2XD2A 4NE4A 4GF8A 5KZTA 2HXWA 2XXTA 2ZYNA 1AL3A 4IO4A 4R9GA 4R6KA 4HCYA 1Y20A 2FNCA 2VP1A 2ONKE 1Z7ME 3IOWA 3H6WA 4NTLA 3IO4A 4FECA 4OXVA 1NMUA 4ZS9A 5I59A 3O9PA 3S4UA 4XKNA 1B3LA
chains in the Genus database with same CATH superfamily
3RT8A 3TDJA 4NQ8A 1Y1MA 3FZVA 1NFTA 4TQUQ 3C32A 4XKPA 3OO7A 3PD8A 3PPPA 5IZ3A 4LZ7A 2O69A 1FBFA 4QRZA 4IY6A 4ZDMA 4MAGA 1B7ZA 2I6EA 2MKZA 2DE2A 4F3BA 3HCQA 3SEWA 2DQVA 2H99A 4F2QA 3IB2A 4HE1A 4YICA 4EQ9A 4MLVA 4XFEA 1TFAA 1LBVA 2CZKA 2DWJA 1MQJA 4P47A 4QFPA 3SZPA 3MAMA 1AMFA 1DTZA 1QGXA 4PAFA 1B40A 3SEVA 4NWDA 3OEKA 3HSTA 5ICQA 3K6XA 4MNIA 5F1QA 3USDA 1S9TA 3U65A 1YAEA 1IMEA 5L9SA 4ZZEA 1H76A 3UGWA 3MBPA 1YCJA 2QVUA 3I5OA 2Y7KA 3HPIA 4NF8B 3C31A 4G8MA 4PTKA 3N6TA 1MXXA 2ZZWA 1B05A 4OZ9A 3VVDA 4H1XA 2HQ0A 3A3UA 5EHMA 1PDAA 3DM0A 3FXBA 2O6AA 3FIRA 4XEQA 3S9EA 1QUJA 1Y3NA 3U92A 2ZYKA 2THIA 4M4GA 3CHGA 1US5A 3FGSA 5I2KA 4X8RA 2Y7WA 3SEXA 1NL5A 4KR5A 4AS5A 3CSBA 1LBXA 3IJXB 2QPQA 2HAUA 4EDPA 1OLAA 3H6TA 1MQHA 1NI9A 1TT1A 3O97A 4OFOA 2FBPA 1B5HA 4KYSA 4C1TA 1SVXB 3U1OA 4LA9A 1A55A 3GZGA 4MHFA 5TP9B 1FQCA 1FPJA 1MDP1 2V84A 1MG1A 1FBGA 5H8NB 3Q25A 3HO7A 4NF5B 4P0GA 4FEDA 4LUBA 3HHFA 3TCHA 4C1UA 5ITOA 3PU5A 4HE2A 1MH4A 3KSJA 2UVJA 1H45A 5I84A 3H03A 2WYKA 4JBZA 4ELOA 3OO9A 2HXRA 4NEDA 1MRPA 3OXNA 3MP1A 4LATA 3IFAA 2E0SA 4ZE9A 4HW8A 1MPDA 1FTJA 1MY4A 3G3KA 5B7DA 1IXCA 3QAXA 1IMBA 4ESXA 4L17A 4N91A 3O6IA 5JTYB 1A7LA 4R6HA 2QJEA 1I69A 4JVIA 4OVSA 1KA1A 4IO7A 4MH5A 4NF4B 3GXAA 3CG3A 1HSEA 4U2RA 3LSLA 4RPNA 1FPDA 3K02A 1B58A 3V83A 1DSNA 4LVQA 3G3FA 1IMFA 4PFBA 2QRYA 1KA0A 4P9KA 1J1NA 1ZLQA 1YYZA 3PPOA 1IQ7A 4RPOA 2Z22A 5I3SA 1BTJA 2P3VA 2HPGA 5AA2D 3HV1A 2UYFA 3IO6A 1OMPA 3BFTA 4PAIA 3MP8A 3B6WA 4JWXA 2F35A 5IZZA 2QVRA 1RDZA 5EQ8A 2GFEA 4GL8A 3CFLA 1FBCA 3EHTA 3IOTA 2XXWA 3RTFB 1FW0A 5IZ1A 3O6HA 4I8CA 3T22A 4PCDA 5K2YA 5H8QA 2CZIA 4JWYA 4QF9A 1XHYA 2NWJA 2A5SA 3H6UA 5CI5A 4N6DA 4DXUA 1A54A 2ZZVA 2YJPA 4PFIA 1MPBA 1BKAA 1B3HA 4I40A 4ZEBA 1FPLA 2FVZA 2CEYA 4N17A 1IIWA 1QKBA 3MVXA 2QMXA 1B51A 3T66A 3TQLA 3KJ7A 4H8JA 2D5WA 3Q27A 1Z7NE 4HTGA 3RY3A 3VLWA 3SEYA 1PBQA 1MXYA 3MZBA 3S9LC 5AA4A 4EXLA 5I58B 3FATA 3E3KA 3KG2A 2F5XA 4N8YA 5EYFA 4F31B 1B6HA 1JP4A 1FTMA 1FCKA 1QUKA 2XD3A 4IY5A 4KYDA 3L6HA 2Q2CA 1NV0A 5ITPA 3KOTA 2XHDA 1M5DA 3G3IA 3RUMA 1N84A 4FEBA 3IOUA 3B7DA 1K9YA 1M5FA 3EF7A 3WAEA 1B4ZA 2WX9A 4EF1A 5H8HB 1DOTA 3ODBA 3O2AA 5AA2A 1OIBA 1DBZA 4NF6B 4P0IA 2PMSA 2F8DA 4AQ4A 4Z0IA 5CM6A 3IJOB 2A5TB 5ESYA 5I2NB 4FATA 1QW0A 1MQGA 4KHZE 3C34A 1CE2A 1NV6A 2L5VA 4NG7A 4E0WA 1USYH 3TODA 3MVZA 4NE4A 2XXTA 1NUXA 1AL3A 1NV1A 4NTLA 5JK4A 2QL3A 4PFRA 3MWBA 4DDDA 2OZZA 2A5TA 1LLSA 5L8DA 5JTYA 4ELQA 1NNFA 1N04A 3BFUA 2I0CA 5EQ7A 4LQ5A 4O94A 2IA4A 4QFOA 2PT2A 5H8FB 4MBPA 4I3YA 1DMBA 3DELB 2QS3A 2NOOA 5CMMA 2KR0A 3RGYA 2OBGA 1SI0A 3A3CA 2XXVA 4H6DA 4YKIA 3V5AA 1MQIA 4KFQA 4G2ZA 1UTBA 3K1NA 4PDHA 2HZLA 2XXRA 1B1XA 4LONB 2DVCA 2FIXA 1IXGA 3O6GA 3E78A 2QSXA 1R6ZA 2GH9A 1NNKA 3OELA 2FA7A 4F29A 2F97A 4GVOA 4O8MA 1NUWA 3QYTA 1A99A 3O29A 4LZ5A 4OEUA 2REGA 4DZ1A 2Z8FA 1B0LA 3ILUB 4XKRA 3RN8A 2XXIA 4RK2A 1MM7A 2P1SA 1MXUA 1SBPA 3MYUA 4ONYA 4IGRA 4E0XA 3FJMA 4MCOA 4JVCA 4AB6A 2WBBA 3O66A 3K6VA 1B7UA 4JB7A 3LUZA 3KEIA 3R26A 3MJNA 4KXPA 3TZAA 2DE4A 4OESA 1FJ6A 1LBBA 2Q74A 5LTCA 1NV5A 3T9XB 2DP8A 3PPQA 3D4GA 5LOMA 3G7WA 5ET6A 2ZNTA 4HCWA 4FIMA 3CRBA 2XWOA 4GOTA 1XVXA 3B6QA 4MEVA 4YKJA 3MPLA 1UTHA 2O51A 3FV2A 3IB0A 5A5XA 4KCCA 3UK4A 2F36A 3BBRA 1ZU0A 3PPRA 1S7YA 4PFWA 3E4RA 1LFGA 2XWIA 1FSAA 4ZEIA 4Q5TA 5H8QB 4ZE8A 3JZJA 2RCBA 2ZMBA 5AA4B 3TFLA 4MF3A 5AA1A 4EF2A 2X7PA 4Q8RA 1FTAA 1B9JA 4EQ7A 1US4A 5KCJB 1NH7A 1LB9A 2RF1A 2BJJX 2I4CA 2X26A 1VE4A 4DI4B 1MS7A 4NF5A 2Z23A 3R7XA 2PT1A 1MY3A 4N4UA 4YB7A 4DI3D 1EYIA 2H9BA 5CMBA 1FPEA 1IITA 2O84X 1FPKA 4AS4A 3Q26A 3RPWA 3OOAA 4GWYA 3RLFE 2VT5A 4HE0A 3W9WA 4GXAA 1OLCA 4ISUA 4ELPA 1SPIA 3QXMA 2P0SA 4O3BA 1I6AA 4IO2A 3FV1A 3S9NC 3FVOA 1N76A 2XXKA 4MLQA 2VPOA 1WODA 1KWHA 2ZYOA 1POTA 2XXYA 1B32A 1IMAA 1S50A 3IB1A 4P56A 3LSFB 3ZSFA 2FIEA 2KLFA 3UA8A 4FJPA 3VV5A 4XIGQ 2DWAA 1GR2A 5TPAB 4R72A 3A29A 4GWUA 2XXQA 5F24A 2XXUA 4GWZA 3VLUA 2QS2A 1INPA 4PFTA 5FTIA 1XI6A 4OERA 4TLMB 4KYEA 5H8HA 3C36A 4OANA 2F7BA 3LBSA 4X9TA 4X48A 3TCFA 1IUDA 3RNNA 3KN3A 4YKPA 5I7IA 2WBDA 1URSA 3UP9A 4N6PA 3U72A 4OEVA 1PBPA 4G4PA 3IOVA 4P8BA 4PP0A 4I62A 3SESA 2ONSA 3S9MC 3LV0A 4MJOA 1M5CA 2DE3A 2XX8A 1PB7A 3MSTA 1P99A 2ZXTA 4MFIA 1IXHA 3K1PA 2Y84A 4WEDA 2F7AA 4DCYA 3DP4A 2GQ1A 1MDQA 1LFIA 4R9FA 4WXJA 4MNCA 3EKIA 1XOCA 4PE5B 4GBVA 1UTBB 4N15A 5FHMA 5FBPA 3HFUA 5BWJA 1OVTA 4DE8A 3K2DA 4NGUA 2HCAA 3PMVA 1DTGA 3JYRA 2UXAA 1N7XA 3T0JA 1A8FA 1WVJA 2Y7IA 3B8BA 5J1DA 4F22A 1EZPA 3K0VA 4GWSA 4PFUA 5CBRA 1P1NA 3U93A 1FRPA 2ZZXA 4NMYA 3T9UA 1UIUA 3T96B 2F34A 4JDFA 2FYIA 4MIJA 1MQDA 1B5IA 1FPBA 5I5PA 4PDDA 1YTVA 4TOZA 1LBZA 3RTWB 4RYAA 3LSWA 1IMCA 5DVIA 5HM4B 1ZMGA 4F18A 2LAOA 3CG1A 3CFXA 3FJGA 4H67A 2Q8JA 1JNFA 3IL1B 3K6UA 5JEIA 1VR5A 3TTLA 1SW4A 5L9MA 2QFLA 2RKMA 3MC2A 4UABA 4QFKA 1SW2A 3LSXA 3FVGA 3K00A 4K3FA 3BKIB 4F2OA 1H43A 1B4HA 3IK6B 4LQ2A 3N5LA 3ZS6A 4GF8A 5KZTA 4R9GA 4R6KA 4HCYA 2VP1A 1DCUA 4FECA 3N26A 1TFDA 2AYSA 4DCXA 4O7IA 4NX1A 1JETA 4PGPA 2V3TA 2I3WA 5EYGA 1GVCA 4BDMA 2PVUA 2NVUB 2PBWA 3ZKKA 3PPNA 3OSRA 3QMFA 1OVBA 4DLDA 4Q0CA 1LEVA 1PB8A 3EN3A 1P1WA 4YU0A 2HZKA 1SD3A 5M2VA 5I2NA 2DXYA 1SQYA 2Z8EA 3OMBA 3GBAA 4BDNA 1NUYA 4G68B 3W9VA 2V25A 1B52A 2Q8MA 4M1VA 2H5YA 4BDLA 4GBWA 1O64A 3EHSA 3T9VA 1PC3A 5TPAA 1NV2A 2CMOA 3KGCA 3L6GA 4DXBA 2BJIA 2O7IA 1YZ0A 3EQ1A 4RK9A 4RY1A 1CNQA 1JW1A 3ROJA 3TPAA 1GV8A 3ECRA 3M3KA 1B3GA 5EYHA 2OLBA 4POWA 3T1BA 2OWTA 3TUSA 3OENA 4XF5A 3G3GA 4WEPA 1ANFA 3C4MA 4QFLA 4I1DA 3UORA 1FBPA 1XT8A 4G8HA 5AE4A 4P11A 3CIJA 3KJTA 2ZNSA 4U4XA 2PYYA 3IX1A 2KQZA 4F39A 3IORA 1LAHE 1MXZA 4RA1A 4ZZAA 4JWOA 1TXFA 3MQ9A 4XKQA 3R6UA 1LBWA 4NF6A 2CEXA 2RC8A 2D3IA 1OQHA 3V8XB 3LUYA 4O3CA 4BDQA 4PGNA 3PMXA 4FE8A 1F9BA 4OHNA 3W15C 2UVGA 3FUZA 4GWOA 3V89B 4O3AA 2ALUA 4ZEDA 2ANJA 2F6PA 1AWBA 1FBDA 1JVXA 3TAJA 1JQFA 2HEUA 2D21A 3FXQA 1LBYA 1K9ZA 4MMPA 3P7IA 1II5A 4R73A 1MH3A 4HXVA 1DPPA 5KDTB 3TQWA 4OVJA 5AA3A 1IZ1A 2HAVA 1FTLA 2QS1A 5I56A 1B7HA 1Y1ZA 5DW8A 1M5BA 2VOZA 3KSXA 4LN5A 4LP2B 1ATGA 4I9DA 2XX9A 4OMBA 3C35A 1EZ9A 1P1OA 4N13A 2DVZA 1ZIUA 4OVPA 4BLAA 4GWXA 1Y4TA 4EUOA 4X04A 5HPQA 2O1LA 3GYYA 4POXA 2F78A 4ESWA 1N7WA 4KD5A 2H4IA 2B3FA 1D4NA 5ET7A 3KZGA 1D3KA 3E9XA 4P1LA 4H65A 4YMAA 1EYKA 4QSCA 4AB5A 1LAFE 4GX6A 1FTOA 5ICTA 2G29A 1RYOA 1IXIA 5CMKA 1SW1A 4ZEKA 4IO6A 1MY0A 1SYHA 3ILTB 4H46A 2ESNA 2QMWA 1BLFA 1TWYA 4UA8A 4JSDA 5L9OA 4JXIA 2R9JA 4NF4A 2M8CA 1EZOA 1B3EA 1RKMA 2CZLA 5DYHA 4N8GA 3DP6A 5I56B 3GBBA 3TTMA 2OX3A 4U1OA 1MXVA 4F3SA 2RCAA 3QUFA 1FTKA 4LZ8A 4QXDA 2OJTA 5B70A 4X1DA 5DEXB 4FAJA 1N3WA 5CC2A 4R2BA 1SI1A 2CZHA 3SDFA 4PF8A 4GL0A 2XXPA 1UIVA 2OWSA 2F3BA 3SERA 2B4LA 3VVFA 4H0WA 2I49A 4F19A 1FBEA 3BIHA 5IM2A 1XS5A 2PFYA 1URGA 1FQBA 5CRYA 1MY1A 5CBSA 4R6YA 1USYE 4OYVA 4G68A 2DXRA 5K2XA 3O28A 4OVTA 3QIMA 1N0TA 1ELJA 3KC0A 4F3PA 2Q2AA 3FASA 2W7YA 4R75A 2I3VA 4PETA 2V3QA 1PB9A 2UVHA 5LDZA 1P1UA 3SETA 4YZZA 3GLBA 3N94A 3N6UA 3FVKA 3WAFA 1GTKA 1VSOA 3PUYE 3PUXE 3OD7A 1IMDA 3FXUA 1URDA 3S2VA 4IGTA 3PD9A 4KI0E 1ZKBA 4G68C 1Y3PA 3PUVE 4H5GA 4OA4A 3VXBA 3VXCA 1FPFA 4ZECA 2VPNA 1NNPA 3ISPA 4GX3A 3QK6A 2ABHA 5ET8A 3OSQA 3RT6B 2F6GA 3MPKA 3FJ7A 4QFNA 1QULA 1NV3A 4U21A 1MPCA 4U4SA 4NF0A 4PF6A 1B3FA 3TTKA 1POY1 4YB5A 4YAHX 4BDRA 1G0IA 3TTRA 4U22A 1ZTYA 4R2FA 4PQJA 1B1HA 1OQGA 3JV9A 4NN3A 1AH5A 1QUIA 1FQFA 1GGGA 2UVIA 4GX4A 3E13X 5FHOA 1I6QA 3G3HA 4GQOA 4YMBA 2B65A 5CMCA 1SDXA 1H44A 5H8FA 3TCGA 3IFCA 1DPEA 2XD2A 2HXWA 2ZYNA 4IO4A 2FNCA 2ONKE 3IO4A 1NMUA 4ZEFA 3O9PA 4XKNA 1B3LA 1A8EA 4TLLB 4EXKA 3BIGA 4PE3A 1AIVA 4KCDA 3M3FA 4GFRA 3EHUA 1B46A 2XWVA 4JSOA 3TKDA 4GXSB 1JW5A 1EH3A 1MM6A 3LR1A 4U23A 1CB6A 1B2HA 1D9VA 2F7CA 3ONMA 4MX6A 1G0HA 1ZJLA 4P1EA 2YLNA 2Y7RA 4I3EA 4F1UA 1LAXA 1LSTA 2DSFA 1T0KA 2H25A 3PUZE 2OK2A 4RNSA 4THIA 1FPGA 2P3NA 5EHSA 3VDFA 1LGBC 5ISUA 3CSGA 1I6BA 2Y5LA 3E79A 4H8IA 5H8NA 4QBAA 4QSEA 4Z7EA 4FORA 2Q88A 4C0RA 5I57A 5FHNA 3Q29A 4PFYA 1SYIA 1NH8A 5DT6A 1B5JA 2Z8DA 5H8SA 1Q1KA 1NV7A 3IR1A 4OENA 4YKKA 1JEVA 3LC8A 2F3DA 4OVRA 2PX1A 2DWIA 5I58A 3QSLA 4OFJA 3TMGA 1RDXA 2V4CA 1ZBMA 3RYDA 4MNPA 1WDNA 5IAIA 3OEMA 2I4BA 2AIXA 3H4ZA 1R9LA 2OWZA 4G77A 1FJ9A 1PEBA 4X1BA 3SKPA 2RINA 2R6GE 3CI8A 1BP5A 5IKBA 1Y3QA 1EU8A 2B4MA 4XXUA 1HSJA 1NKXA 2DWHA 2HFBA 3U94A 4GIZA 3UN6A 2ZNUA 1MXWA 1IEJA 4DIGA 2QVVA 3KOSA 3PTYA 1MY2A 4DXCA 3ZKLA 3KN7A 4PBHA 1A40A 1Q35A 5I59B 3MZ1A 2I48A 4OWDA 2DS9A 4OTEA 4ELRA 4XTCQ 2YPNA 2V3UA 1UTHB 3NOHA 3HN0A 2X7QA 4F3GA 2IEEA 3TTNA 4GWWA 4H45A 4R74A 4F1YA 2V93A 3KBZA 5HBCA 2P2AA 5I2KB 3D1RA 1NV4A 1FQEA 1RYXA 4N81A 3KBRA 1VFDA 4OETA 4P3LA 1N3XA 2O68A 1O63A 3F11A 3H7MA 4KQPA 3C9HA 3RPLA 1LCFA 1QKAA 4G61A 3H06B 3T9HB 3T93B 3U8QA 5IGAA 3VFJA 2GHAA 2ONRA 4RJZA 2H98A 2VGQA 1LAGE 4ECFA 5FTHA 3FD3A 3OO8A 2XX7A 3PGFA 2RC7A 3FBPA 3K1MA 2OCUA 3KC1A 4JVDA 3RPLB 1XVYA 2O7UA 5IZ3B 4OFLA 3PMWA 3G3JA 5DEXA 3K4UA 4HS7A 3M3LA 4ND9A 4KPTA 3MVWA 1JW4A 5A5XB 4OQOA 4GRKA 1JVYA 4YB6A 2Y7PA 3MVYA 2RC9A 4NHBA 1LB8A 2UYEA 5F7VA 3B50A 1SW5A 2Q89A 1Q9DA 3D4CA 2VD3A 1RDYA 3VE1B 3DLNA 2ZYMA 1VFEA 2PCRA 3I3VA 2DOJA 1FQAA 3SEUA 2GRVA 2HHMA 2I0BA 2WEFA 3THIA 3TYHA 5DVJA 1P1QA 4Q30B 1YPNA 3KN8A 3K01A 4NF8A 3CFZA 3MZ9A 5ET5A 2E1SA 1FBHA 2O1MA 2JJKA 1XC1A 1NNTA 1EYJA 4F1VA 4PAKA 2NUVA 4IO5A 2NXOA 3RQTA 4GD5A 1JEUA 5I57B 2VD2A 2WYPA 3DP8A 4NWCA 1L5TA 4H5FA 2I58A 1QJMA 1R1NA 3K6WA 4OVQA 2Y5KA 4N6KA 5EQ9A 2B3BA 2QS4A 5AA2B 5ELVA 5BUUA 4IR8A 4PC9A 2FHYA 3PUWE 1AOVA 4PBQA 1VDWA 5TU0A 1YXIA 2REJA 3I6VA 3A09A 2XXHA 3B6TA 1R9QA 5KCJA 2AL5A 2Q9TA 4NAPA 4RXLA 3UIFA 4N07A 3EPEA 4QSDA 5TP9A 4EQBA 2AL4A 1O7TA 2GHBA 3IAZA 3FVNA 5A5LA 1D9QA 4UACA 2WKYA 3C33A 3MP6A 1LFHA 1Y9UA 2G93A 3KFMA 2PFZA 3MW0A 4GLIA 4U1ZA 1FPIA 1QVSA 2XA5A 1HSLA 4G8NA 1D9YA 3H3GA 1BIYA 4QHQA 1UQWA 2VHAA 2XWKA 1H3DA 5EQAA 4O7MA 1DK4A 2XXXA 1LBCA 5J16A 1FQDA 2DYXA 1KZ8A 3HHGA 3QUJA 1M5EA 5DTBA 4IO3A 3CR9A 1Y4CA 3TELA 5DVFA 2DDKA 2R8TA 3MUQA 5T3JA 3VVEA 1B0HA 2R71A 1BK4A 4BDOA 3CVGA 4FBPA 3TEPA 3FXRA 3H6VA 3PV0E 3VLVA 3M8UA 1NUZA 3Q28A 4IB2A 1LCTA 3OO6A 4WKMA 5KDTA 3AXFA 1Y20A 1Z7ME 3IOWA 3H6WA 4ZS9A 4OXVA 5I59A 3S4UA
chains in the Genus database with same CATH topology
3RT8A 3TDJA 3N26A 3MWBA 1A8EA 4DDDA 4TLLB 1Y1MA 2OZZA 3FZVA 4EXKA 1NFTA 1TFDA 2A5TA 2AYSA 1AIVA 1LLSA 4KCDA 4TQUQ 3C32A 3M3FA 3EHUA 4GFRA 1B46A 3OO7A 3PD8A 3PPPA 4JSOA 4XKPA 5L8DA 3RTWB 4GXSB 3TKDA 4DCXA 4ELQA 1JW5A 1EH3A 4LZ7A 1NNFA 1MM6A 2O69A 3LR1A 1JETA 1N04A 4QRZA 4U23A 3BFUA 1CB6A 1B2HA 1D9VA 2I0CA 2V3TA 4IY6A 2I3WA 4ZDMA 4LQ5A 2F7CA 1B7ZA 2I6EA 3ONMA 2IA4A 1GVCA 1ZJLA 2PVUA 4BDMA 2NVUB 2PBWA 3ZKKA 2YLNA 3PPNA 3OSRA 2DE2A 4QFOA 4F3BA 2Y7RA 2PT2A 5H8FB 3HCQA 1OVBA 4MBPA 3SEWA 1LAXA 1LSTA 4Q0CA 1DMBA 1PB8A 2DSFA 4DLDA 4F1UA 2DQVA 3DELB 3EN3A 1T0KA 1P1WA 4YU0A 2H25A 2HZKA 2QS3A 2H99A 2NOOA 1SD3A 5CMMA 5M2VA 4F2QA 3IB2A 5I2NA 2DXYA 1SQYA 3PUZE 2OBGA 1SI0A 2Z8EA 3OMBA 3A3CA 2OK2A 2XXVA 4H6DA 3GBAA 1MQIA 4MLVA 4YKIA 3V5AA 4BDNA 4KFQA 1TFAA 1UTBA 3K1NA 4G2ZA 4G68B 4RNSA 2DWJA 1MQJA 3W9VA 4THIA 2HZLA 2XXRA 1B1XA 4LONB 2V25A 5EHSA 4QFPA 1B52A 2DVCA 4M1VA 3MAMA 2H5YA 1AMFA 3VDFA 1IXGA 1DTZA 1LGBC 3O6GA 4BDLA 5ISUA 2QSXA 1B40A 1O64A 1R6ZA 5ITPA 3CSGA 1I6BA 3SEVA 3EHSA 4NWDA 2GH9A 1NNKA 3OELA 3HSTA 3OEKA 3T9VA 2FA7A 4F29A 5H8QB 2F97A 1PC3A 4GVOA 5TPAA 5ICQA 4H8IA 5H8NA 3K6XA 4QSEA 3QYTA 5F1QA 3USDA 1A99A 4Z7EA 1S9TA 4FORA 2CMOA 2Q88A 3KGCA 2REGA 3O29A 4LZ5A 4OEUA 5FHNA 4C0RA 5I57A 1YAEA 3L6GA 3Q29A 4DXBA 4PFYA 4DZ1A 1SYIA 1NH8A 5DT6A 1B5JA 5L9SA 2Z8DA 2Z8FA 1B0LA 1Q1KA 5H8SA 1H76A 4ZZEA 3UGWA 2O7IA 3ILUB 3MBPA 4XKRA 3EQ1A 4RK9A 1YCJA 3RN8A 3I5OA 2XXIA 2Y7KA 4RY1A 1JW1A 3IR1A 3HPIA 4NF8B 4OENA 3TPAA 4RK2A 1MM7A 2P1SA 1MXUA 1SBPA 3C31A 4G8MA 4ONYA 1GV8A 5ICTA 4YKKA 1JEVA 3LC8A 3ECRA 4IGRA 4E0XA 3FJMA 3N6TA 3M3KA 1B3GA 1MXXA 2PX1A 2DWIA 4KI0E 5I58A 3RGYA 2OLBA 4POWA 1B05A 2OWTA 4AB6A 3TUSA 3OENA 3QSLA 4OZ9A 3G3GA 3K6VA 3O66A 3VVDA 4H1XA 4OFJA 4WEPA 1ANFA 1B7UA 3TMGA 2HQ0A 4JB7A 3C4MA 4QFLA 4I1DA 3A3UA 3KEIA 1PDAA 1ZBMA 3R26A 5EHMA 3UORA 1XT8A 3MJNA 1WDNA 4G8HA 5AE4A 4P11A 3CIJA 3DM0A 3KJTA 3TZAA 2O6AA 2ZNSA 2DE4A 3FIRA 4OESA 4U4XA 2PYYA 2I4BA 3OEMA 5IAIA 2AIXA 3H4ZA 3IX1A 3S9EA 1LBBA 1R9LA 4F39A 1QUJA 3IORA 1LAHE 1MXZA 4G77A 4RA1A 4ZZAA 1Y3NA 4X1BA 1PEBA 2ZYKA 3U92A 4JWOA 3T9XB 1TXFA 3MQ9A 4XKQA 3R6UA 3SKPA 4NF6A 2RINA 2RC8A 2R6GE 2D3IA 2DP8A 3PPQA 1OQHA 3CI8A 2THIA 3D4GA 3V8XB 3LUYA 5LOMA 4O3CA 4M4GA 1BP5A 4BDQA 1US5A 3G7WA 2ZNTA 4HCWA 5IKBA 3FGSA 3PMXA 5I2KA 1Y3QA 4FE8A 1F9BA 2Y7WA 4FIMA 3SEXA 4OHNA 1EU8A 3CRBA 4XXUA 1HSJA 1NKXA 3W15C 4GOTA 2DWHA 2UVGA 4YICA 1XVXA 1NL5A 2HFBA 3B6QA 4YKJA 3FUZA 3MPLA 4GWOA 1UTHA 3U94A 2O51A 3FV2A 4GIZA 4KR5A 4O3AA 3UN6A 2ALUA 3V89B 4ZEDA 2ZNUA 1MXWA 3IB0A 5A5XA 3CSBA 4KCCA 3UK4A 2ANJA 2F6PA 2F36A 3BBRA 1IEJA 4DIGA 1JVXA 3IJXB 3KOSA 1ZU0A 3PPRA 1MY2A 4DXCA 2QPQA 1S7YA 1JQFA 2HEUA 2HAUA 3TAJA 4EDPA 1OLAA 2D21A 3FXQA 3H6TA 3ZKLA 3KN7A 1MQHA 1TT1A 3O97A 4PFWA 4OFOA 3E4RA 4ZEFA 1A40A 1LFGA 1Q35A 4ZEIA 1B5HA 3MZ1A 3P7IA 1II5A 4Q5TA 4R73A 2I48A 2RCBA 3JZJA 2ZMBA 4OWDA 1MH3A 2DS9A 4OTEA 4ELRA 4XTCQ 5AA4B 4KYSA 2YPNA 2V3UA 3TFLA 4MF3A 1DPPA 5AA1A 4EF2A 1UTHB 2X7PA 4Q8RA 4C1TA 1SVXB 3U1OA 4LA9A 1B9JA 3HN0A 5KDTB 2X7QA 4F3GA 1A55A 3TQWA 4EQ7A 3GZGA 1US4A 2IEEA 3TTNA 5KCJB 4OVJA 4ZE8A 1NH7A 1LB9A 5TP9B 4R74A 4F1YA 5AA3A 2RF1A 1IZ1A 1FQCA 2V93A 2BJJX 2HAVA 1MDP1 5HBCA 1FTLA 2I4CA 2V84A 2X26A 1MG1A 2QS1A 1VE4A 5H8NB 3Q25A 5JTYA 2P2AA 3HO7A 1MS7A 4NF5B 5I56A 1B7HA 4P0GA 4NF5A 1Y1ZA 2Z23A 4FEDA 4LUBA 3HHFA 5I2KB 2PT1A 1MY3A 3R7XA 1FQEA 1RYXA 4YB7A 3TCHA 4C1UA 3KBRA 5ITOA 1M5BA 1VFDA 2H9BA 3PU5A 5CMBA 4OETA 1MH4A 5DTBA 3KSJA 2UVJA 1H45A 5I84A 1IITA 2O84X 3H03A 2VOZA 3KSXA 1N3XA 2O68A 1O63A 4JBZA 3Q26A 4LP2B 4ELOA 3OO9A 3RPWA 3F11A 1ATGA 3H7MA 4NEDA 1MRPA 4KQPA 5H8HB 3OXNA 3MP1A 3C9HA 4I9DA 2XX9A 4OMBA 3OOAA 4LATA 1LCFA 1QKAA 3C35A 3RLFE 1EZ9A 2E0SA 4ZE9A 1P1OA 4N13A 1MPDA 1ZIUA 2DVZA 4GXAA 1FTJA 3W9WA 4BLAA 3H06B 4HW8A 3T9HB 1MY4A 1Y4TA 1OLCA 3G3KA 5B7DA 3T93B 3U8QA 4ISUA 3VFJA 2GHAA 1IXCA 2ONRA 2H98A 3QXMA 2VGQA 4RJZA 4ELPA 4EUOA 1LAGE 2P0SA 4ECFA 2Q8JA 4O3BA 5FTHA 1I6AA 3FD3A 3QAXA 2O1LA 3OO8A 2XX7A 4POXA 5HPQA 3PGFA 2F78A 4IO2A 3FV1A 2RC7A 1N7WA 3K1MA 3FVOA 4L17A 4KD5A 4ESXA 2H4IA 2OCUA 3S9NC 1N76A 1XVYA 2O7UA 3O6IA 5JTYB 2B3FA 4MLQA 4OFLA 1A7LA 3PMWA 3G3JA 5DEXA 1D4NA 3K4UA 4R6HA 2QJEA 3KZGA 4HS7A 1WODA 1D3KA 3E9XA 1KWHA 1I69A 3M3LA 4ND9A 2ZYOA 1POTA 3MVWA 2XXYA 4KPTA 4H65A 1B32A 4YMAA 4QSCA 1JW4A 1S50A 4AB5A 5A5XB 3IB1A 4BDOA 4IO7A 4OQOA 1LAFE 4MH5A 3LSFB 1FTOA 4GRKA 3ZSFA 1JVYA 2KLFA 4YB6A 4NF4B 2Y7PA 3GXAA 2RC9A 2G29A 3CG3A 1HSEA 3MVYA 3UA8A 4FJPA 1RYOA 3VV5A 1IXIA 5CMKA 1SW1A 4XIGQ 4U2RA 2DWAA 4ZEKA 1GR2A 1LB8A 3LSLA 4IO6A 4R72A 5TPAB 4RPNA 1MY0A 3K02A 2UYEA 2XXQA 5F7VA 1SYHA 1SW5A 2Q89A 1B58A 3V83A 3D4CA 1DSNA 3ILTB 2VD3A 2XXUA 3VLUA 4LVQA 2ESNA 3G3FA 3VE1B 3DLNA 2QS2A 2ZYMA 4PFTA 5FTIA 1VFEA 3I3VA 4OERA 2QMWA 1BLFA 1TWYA 2DOJA 2QRYA 4UA8A 4TLMB 4KYEA 1FQAA 5H8HA 3SEUA 2GRVA 2I0BA 4JSDA 3C36A 1J1NA 1ZLQA 5L9MA 3THIA 3TYHA 5L9OA 2F7BA 3LBSA 4JXIA 4X9TA 2R9JA 3PPOA 4NF4A 4X48A 1IQ7A 5DVJA 3TCFA 1IUDA 2M8CA 3RNNA 1EZOA 1B3EA 1P1QA 3KN3A 4Q30B 4RPOA 1YPNA 2Z22A 1RKMA 4YKPA 2CZLA 3KN8A 5DYHA 1BTJA 1URSA 3UP9A 3DP6A 5I56B 3K01A 3GBBA 4NF8A 4N6PA 3CFZA 3MZ9A 3TTMA 5AA2D 3U72A 4U1OA 2E1SA 1MXVA 2QL3A 3HV1A 2UYFA 1PBPA 3IO6A 4OEVA 4F3SA 1OMPA 3BFTA 2RCAA 4G4PA 3IOVA 4PP0A 3QUFA 1FTKA 2O1MA 3MP8A 3B6WA 4I62A 4JWXA 3SESA 2F35A 1XC1A 1NNTA 4F1VA 2GFEA 2ONSA 4GL8A 3CFLA 4LZ8A 3S9MC 3EHTA 2OJTA 2NUVA 3IOTA 4IO5A 5B70A 2XXWA 4X1DA 5DEXB 2NXOA 3RTFB 4FAJA 1M5CA 3RQTA 2DE3A 2XX8A 4GD5A 1JEUA 1FW0A 1N3WA 3S2VA 4R2BA 3O6HA 4I8CA 1SI1A 3T22A 5CC2A 1PB7A 5K2YA 3SDFA 5H8QA 1P99A 2ZXTA 4GL0A 5I57B 4MFIA 2VD2A 2XXPA 4JWYA 4QF9A 1IXHA 1UIVA 1XHYA 3DP8A 2OWSA 3K1PA 2NWJA 2Y84A 3SERA 4WEDA 3VVFA 4NWCA 2F7AA 1L5TA 4H0WA 2I49A 4H5FA 2I58A 2A5SA 3H6UA 5CI5A 1QJMA 4DCYA 4F19A 1R1NA 4DXUA 3DP4A 1MDQA 3K6WA 1A54A 1LFIA 4R9FA 2YJPA 1XS5A 4WXJA 1URGA 1MPBA 2B3BA 2QS4A 1BKAA 1FQBA 5CRYA 5ELVA 5AA2B 5BUUA 1MY1A 1B3HA 1XOCA 5CBSA 4R6YA 4ZEBA 4PE5B 1USYE 4OYVA 1UTBB 4G68A 5FHMA 2DXRA 5K2XA 3O28A 5JK4A 5BWJA 1IIWA 1QKBA 3PUWE 3QIMA 1N0TA 1OVTA 1AOVA 4DE8A 3MVXA 5TU0A 2QMXA 1ELJA 1B51A 3T66A 4F3PA 3TQLA 2REJA 3KJ7A 2Q2AA 3K2DA 3FASA 3I6VA 2D5WA 2XXHA 3A09A 4H8JA 3B6TA 2HCAA 2W7YA 2I3VA 4PETA 4R75A 3PMVA 1R9QA 1DTGA 3JYRA 2UXAA 2AL5A 3Q27A 2Q9TA 2V3QA 1N7XA 5KCJA 1A8FA 1PB9A 1WVJA 1Z7NE 2UVHA 4HTGA 4RXLA 3RY3A 3VLWA 3SEYA 3UIFA 4N07A 1P1UA 2Y7IA 4YZZA 3GLBA 1PBQA 3SETA 3EPEA 1MXYA 3N94A 5J1DA 3N6UA 3MZBA 4QSDA 3S9LC 4F22A 5TP9A 5AA4A 4ESWA 3K0VA 4EQBA 1EZPA 4EXLA 5I58B 5I59B 3FATA 3FVKA 3WAFA 2AL4A 1O7TA 2GHBA 3IAZA 1GTKA 4PFUA 1P1NA 3FVNA 3E3KA 3KG2A 3U93A 5CBRA 1VSOA 2F5XA 4UACA 3PUYE 4NMYA 3PUXE 3OD7A 1UIUA 2WKYA 3C33A 3MP6A 5EYFA 3T96B 3T9UA 4F31B 1B6HA 1LFHA 2F34A 3FXUA 1FTMA 1FCKA 1URDA 2FYIA 4JDFA 4IGTA 3PD9A 1Y9UA 1MQDA 1B5IA 1QUKA 1ZKBA 2G93A 2XD3A 1Y3PA 3KFMA 3PUVE 4G68C 4H5GA 4IY5A 4KYDA 3VXBA 3VXCA 4ZECA 3L6HA 2Q2CA 1NNPA 1YTVA 3MW0A 4GLIA 4TOZA 4U1ZA 1QVSA 2ABHA 3KOTA 3OSQA 3QK6A 3RT6B 1HSLA 2F6GA 2XHDA 3MPKA 1M5DA 3FJ7A 1QULA 4G8NA 1D9YA 1MPCA 4QFNA 3LSWA 4RYAA 4U21A 3H3GA 1BIYA 3G3IA 4QHQA 4U4SA 3RUMA 1UQWA 2VHAA 1N84A 1B3FA 1H3DA 5DVIA 5HM4B 4FEBA 1ZMGA 4F18A 3IOUA 3TTKA 1POY1 3B7DA 1M5FA 2LAOA 3EF7A 2XXXA 4YB5A 4YAHX 4BDRA 1LBCA 3CG1A 3WAEA 1FQDA 1B4ZA 2DYXA 3CFXA 3FJGA 3HHGA 4H67A 3TTRA 4U22A 4EF1A 3QUJA 1M5EA 4IO3A 1DOTA 1ZTYA 1JNFA 3CR9A 1Y4CA 3IL1B 3K6UA 4PQJA 1B1HA 3ODBA 4R2FA 3TELA 1OQGA 3O2AA 5AA2A 5JEIA 5DVFA 3JV9A 1OIBA 4EQ9A 1VR5A 3TTLA 1SW4A 3MUQA 3VVEA 4NF6B 4P0IA 1B0HA 2R71A 2RKMA 1AH5A 2PMSA 2F8DA 3MC2A 1QUIA 4Z0IA 1FQFA 3CVGA 1GGGA 4AQ4A 2UVIA 5CM6A 3IJOB 4QFKA 3E13X 5FHOA 3TEPA 2A5TB 1I6QA 3FXRA 1SW2A 3H6VA 3PV0E 5I2NB 3G3HA 4FATA 3VLVA 3LSXA 3FVGA 4GQOA 4YMBA 2B65A 3K00A 1QW0A 3M8UA 1MQGA 4K3FA 3BKIB 3C34A 3Q28A 4KHZE 1CE2A 4IB2A 5CMCA 4F2OA 1H43A 1LCTA 1B4HA 3IK6B 1SDXA 1H44A 1USYH 4E0WA 3OO6A 3TCGA 5H8FA 4LQ2A 3N5LA 4WKMA 3TODA 5KDTA 3ZS6A 1DPEA 3AXFA 3MVZA 2XD2A 4NE4A 4GF8A 5KZTA 2HXWA 2XXTA 2ZYNA 1AL3A 4IO4A 4R9GA 4R6KA 4HCYA 1Y20A 2FNCA 2VP1A 2ONKE 1Z7ME 3IOWA 3H6WA 4NTLA 3IO4A 4FECA 4OXVA 1NMUA 4ZS9A 5I59A 3O9PA 3S4UA 4XKNA 1B3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RT8 A;  3TDJ A;  3N26 A;  3MWB A;  1A8E A;  4DDD A;  4TLL B;  1Y1M A;  2OZZ A;  3FZV A;  4EXK A;  1NFT A;  1TFD A;  2A5T A;  2AYS A;  1AIV A;  1LLS A;  4KCD A;  4TQU Q;  3C32 A;  3M3F A;  3EHU A;  4GFR A;  1B46 A;  3OO7 A;  3PD8 A;  3PPP A;  4JSO A;  4XKP A;  5L8D A;  3RTW B;  4GXS B;  3TKD A;  4DCX A;  4ELQ A;  1JW5 A;  1EH3 A;  4LZ7 A;  1NNF A;  1MM6 A;  2O69 A;  3LR1 A;  1JET A;  1N04 A;  4QRZ A;  4U23 A;  3BFU A;  1CB6 A;  1B2H A;  1D9V A;  2I0C A;  2V3T A;  4IY6 A;  2I3W A;  4ZDM A;  4LQ5 A;  2F7C A;  1B7Z A;  2I6E A;  3ONM A;  2IA4 A;  1GVC A;  1ZJL A;  2PVU A;  4BDM A;  2NVU B;  2PBW A;  3ZKK A;  2YLN A;  3PPN A;  3OSR A;  2DE2 A;  4QFO A;  4F3B A;  2Y7R A;  2PT2 A;  5H8F B;  3HCQ A;  1OVB A;  4MBP A;  3SEW A;  1LAX A;  1LST A;  4Q0C A;  1DMB A;  1PB8 A;  2DSF A;  4DLD A;  4F1U A;  2DQV A;  3DEL B;  3EN3 A;  1T0K A;  1P1W A;  4YU0 A;  2H25 A;  2HZK A;  2QS3 A;  2H99 A;  2NOO A;  1SD3 A;  5CMM A;  5M2V A;  4F2Q A;  3IB2 A;  5I2N A;  2DXY A;  1SQY A;  3PUZ E;  2OBG A;  1SI0 A;  2Z8E A;  3OMB A;  3A3C A;  2OK2 A;  2XXV A;  4H6D A;  3GBA A;  1MQI A;  4MLV A;  4YKI A;  3V5A A;  4BDN A;  4KFQ A;  1TFA A;  1UTB A;  3K1N A;  4G2Z A;  4G68 B;  4RNS A;  2DWJ A;  1MQJ A;  3W9V A;  4THI A;  2HZL A;  2XXR A;  1B1X A;  4LON B;  2V25 A;  5EHS A;  4QFP A;  1B52 A;  2DVC A;  4M1V A;  3MAM A;  2H5Y A;  1AMF A;  3VDF A;  1IXG A;  1DTZ A;  1LGB C;  3O6G A;  4BDL A;  5ISU A;  2QSX A;  1B40 A;  1O64 A;  1R6Z A;  5ITP A;  3CSG A;  1I6B A;  3SEV A;  3EHS A;  4NWD A;  2GH9 A;  1NNK A;  3OEL A;  3HST A;  3OEK A;  3T9V A;  2FA7 A;  4F29 A;  5H8Q B;  2F97 A;  1PC3 A;  4GVO A;  5TPA A;  5ICQ A;  4H8I A;  5H8N A;  3K6X A;  4QSE A;  3QYT A;  5F1Q A;  3USD A;  1A99 A;  4Z7E A;  1S9T A;  4FOR A;  2CMO A;  2Q88 A;  3KGC A;  2REG A;  3O29 A;  4LZ5 A;  4OEU A;  5FHN A;  4C0R A;  5I57 A;  1YAE A;  3L6G A;  3Q29 A;  4DXB A;  4PFY A;  4DZ1 A;  1SYI A;  1NH8 A;  5DT6 A;  1B5J A;  5L9S A;  2Z8D A;  2Z8F A;  1B0L A;  1Q1K A;  5H8S A;  1H76 A;  4ZZE A;  3UGW A;  2O7I A;  3ILU B;  3MBP A;  4XKR A;  3EQ1 A;  4RK9 A;  1YCJ A;  3RN8 A;  3I5O A;  2XXI A;  2Y7K A;  4RY1 A;  1JW1 A;  3IR1 A;  3HPI A;  4NF8 B;  4OEN A;  3TPA A;  4RK2 A;  1MM7 A;  2P1S A;  1MXU A;  1SBP A;  3C31 A;  4G8M A;  4ONY A;  1GV8 A;  5ICT A;  4YKK A;  1JEV A;  3LC8 A;  3ECR A;  4IGR A;  4E0X A;  3FJM A;  3N6T A;  3M3K A;  1B3G A;  1MXX A;  2PX1 A;  2DWI A;  4KI0 E;  5I58 A;  3RGY A;  2OLB A;  4POW A;  1B05 A;  2OWT A;  4AB6 A;  3TUS A;  3OEN A;  3QSL A;  4OZ9 A;  3G3G A;  3K6V A;  3O66 A;  3VVD A;  4H1X A;  4OFJ A;  4WEP A;  1ANF A;  1B7U A;  3TMG A;  2HQ0 A;  4JB7 A;  3C4M A;  4QFL A;  4I1D A;  3A3U A;  3KEI A;  1PDA A;  1ZBM A;  3R26 A;  5EHM A;  3UOR A;  1XT8 A;  3MJN A;  1WDN A;  4G8H A;  5AE4 A;  4P11 A;  3CIJ A;  3DM0 A;  3KJT A;  3TZA A;  2O6A A;  2ZNS A;  2DE4 A;  3FIR A;  4OES A;  4U4X A;  2PYY A;  2I4B A;  3OEM A;  5IAI A;  2AIX A;  3H4Z A;  3IX1 A;  3S9E A;  1LBB A;  1R9L A;  4F39 A;  1QUJ A;  3IOR A;  1LAH E;  1MXZ A;  4G77 A;  4RA1 A;  4ZZA A;  1Y3N A;  4X1B A;  1PEB A;  2ZYK A;  3U92 A;  4JWO A;  3T9X B;  1TXF A;  3MQ9 A;  4XKQ A;  3R6U A;  3SKP A;  4NF6 A;  2RIN A;  2RC8 A;  2R6G E;  2D3I A;  2DP8 A;  3PPQ A;  1OQH A;  3CI8 A;  2THI A;  3D4G A;  3V8X B;  3LUY A;  5LOM A;  4O3C A;  4M4G A;  1BP5 A;  4BDQ A;  1US5 A;  3G7W A;  2ZNT A;  4HCW A;  5IKB A;  3FGS A;  3PMX A;  5I2K A;  1Y3Q A;  4FE8 A;  1F9B A;  2Y7W A;  4FIM A;  3SEX A;  4OHN A;  1EU8 A;  3CRB A;  4XXU A;  1HSJ A;  1NKX A;  3W15 C;  4GOT A;  2DWH A;  2UVG A;  4YIC A;  1XVX A;  1NL5 A;  2HFB A;  3B6Q A;  4YKJ A;  3FUZ A;  3MPL A;  4GWO A;  1UTH A;  3U94 A;  2O51 A;  3FV2 A;  4GIZ A;  4KR5 A;  4O3A A;  3UN6 A;  2ALU A;  3V89 B;  4ZED A;  2ZNU A;  1MXW A;  3IB0 A;  5A5X A;  3CSB A;  4KCC A;  3UK4 A;  2ANJ A;  2F6P A;  2F36 A;  3BBR A;  1IEJ A;  4DIG A;  1JVX A;  3IJX B;  3KOS A;  1ZU0 A;  3PPR A;  1MY2 A;  4DXC A;  2QPQ A;  1S7Y A;  1JQF A;  2HEU A;  2HAU A;  3TAJ A;  4EDP A;  1OLA A;  2D21 A;  3FXQ A;  3H6T A;  3ZKL A;  3KN7 A;  1MQH A;  1TT1 A;  3O97 A;  4PFW A;  4OFO A;  3E4R A;  4ZEF A;  1A40 A;  1LFG A;  1Q35 A;  4ZEI A;  1B5H A;  3MZ1 A;  3P7I A;  1II5 A;  4Q5T A;  4R73 A;  2I48 A;  2RCB A;  3JZJ A;  2ZMB A;  4OWD A;  1MH3 A;  2DS9 A;  4OTE A;  4ELR A;  4XTC Q;  5AA4 B;  4KYS A;  2YPN A;  2V3U A;  3TFL A;  4MF3 A;  1DPP A;  5AA1 A;  4EF2 A;  1UTH B;  2X7P A;  4Q8R A;  4C1T A;  1SVX B;  3U1O A;  4LA9 A;  1B9J A;  3HN0 A;  5KDT B;  2X7Q A;  4F3G A;  1A55 A;  3TQW A;  4EQ7 A;  3GZG A;  1US4 A;  2IEE A;  3TTN A;  5KCJ B;  4OVJ A;  4ZE8 A;  1NH7 A;  1LB9 A;  5TP9 B;  4R74 A;  4F1Y A;  5AA3 A;  2RF1 A;  1IZ1 A;  1FQC A;  2V93 A;  2BJJ X;  2HAV A;  1MDP 1;  5HBC A;  1FTL A;  2I4C A;  2V84 A;  2X26 A;  1MG1 A;  2QS1 A;  1VE4 A;  5H8N B;  3Q25 A;  5JTY A;  2P2A A;  3HO7 A;  1MS7 A;  4NF5 B;  5I56 A;  1B7H A;  4P0G A;  4NF5 A;  1Y1Z A;  2Z23 A;  4FED A;  4LUB A;  3HHF A;  5I2K B;  2PT1 A;  1MY3 A;  3R7X A;  1FQE A;  1RYX A;  4YB7 A;  3TCH A;  4C1U A;  3KBR A;  5ITO A;  1M5B A;  1VFD A;  2H9B A;  3PU5 A;  5CMB A;  4OET A;  1MH4 A;  5DTB A;  3KSJ A;  2UVJ A;  1H45 A;  5I84 A;  1IIT A;  2O84 X;  3H03 A;  2VOZ A;  3KSX A;  1N3X A;  2O68 A;  1O63 A;  4JBZ A;  3Q26 A;  4LP2 B;  4ELO A;  3OO9 A;  3RPW A;  3F11 A;  1ATG A;  3H7M A;  4NED A;  1MRP A;  4KQP A;  5H8H B;  3OXN A;  3MP1 A;  3C9H A;  4I9D A;  2XX9 A;  4OMB A;  3OOA A;  4LAT A;  1LCF A;  1QKA A;  3C35 A;  3RLF E;  1EZ9 A;  2E0S A;  4ZE9 A;  1P1O A;  4N13 A;  1MPD A;  1ZIU A;  2DVZ A;  4GXA A;  1FTJ A;  3W9W A;  4BLA A;  3H06 B;  4HW8 A;  3T9H B;  1MY4 A;  1Y4T A;  1OLC A;  3G3K A;  5B7D A;  3T93 B;  3U8Q A;  4ISU A;  3VFJ A;  2GHA A;  1IXC A;  2ONR A;  2H98 A;  3QXM A;  2VGQ A;  4RJZ A;  4ELP A;  4EUO A;  1LAG E;  2P0S A;  4ECF A;  2Q8J A;  4O3B A;  5FTH A;  1I6A A;  3FD3 A;  3QAX A;  2O1L A;  3OO8 A;  2XX7 A;  4POX A;  5HPQ A;  3PGF A;  2F78 A;  4IO2 A;  3FV1 A;  2RC7 A;  1N7W A;  3K1M A;  3FVO A;  4L17 A;  4KD5 A;  4ESX A;  2H4I A;  2OCU A;  3S9N C;  1N76 A;  1XVY A;  2O7U A;  3O6I A;  5JTY B;  2B3F A;  4MLQ A;  4OFL A;  1A7L A;  3PMW A;  3G3J A;  5DEX A;  1D4N A;  3K4U A;  4R6H A;  2QJE A;  3KZG A;  4HS7 A;  1WOD A;  1D3K A;  3E9X A;  1KWH A;  1I69 A;  3M3L A;  4ND9 A;  2ZYO A;  1POT A;  3MVW A;  2XXY A;  4KPT A;  4H65 A;  1B32 A;  4YMA A;  4QSC A;  1JW4 A;  1S50 A;  4AB5 A;  5A5X B;  3IB1 A;  4BDO A;  4IO7 A;  4OQO A;  1LAF E;  4MH5 A;  3LSF B;  1FTO A;  4GRK A;  3ZSF A;  1JVY A;  2KLF A;  4YB6 A;  4NF4 B;  2Y7P A;  3GXA A;  2RC9 A;  2G29 A;  3CG3 A;  1HSE A;  3MVY A;  3UA8 A;  4FJP A;  1RYO A;  3VV5 A;  1IXI A;  5CMK A;  1SW1 A;  4XIG Q;  4U2R A;  2DWA A;  4ZEK A;  1GR2 A;  1LB8 A;  3LSL A;  4IO6 A;  4R72 A;  5TPA B;  4RPN A;  1MY0 A;  3K02 A;  2UYE A;  2XXQ A;  5F7V A;  1SYH A;  1SW5 A;  2Q89 A;  1B58 A;  3V83 A;  3D4C A;  1DSN A;  3ILT B;  2VD3 A;  2XXU A;  3VLU A;  4LVQ A;  2ESN A;  3G3F A;  3VE1 B;  3DLN A;  2QS2 A;  2ZYM A;  4PFT A;  5FTI A;  1VFE A;  3I3V A;  4OER A;  2QMW A;  1BLF A;  1TWY A;  2DOJ A;  2QRY A;  4UA8 A;  4TLM B;  4KYE A;  1FQA A;  5H8H A;  3SEU A;  2GRV A;  2I0B A;  4JSD A;  3C36 A;  1J1N A;  1ZLQ A;  5L9M A;  3THI A;  3TYH A;  5L9O A;  2F7B A;  3LBS A;  4JXI A;  4X9T A;  2R9J A;  3PPO A;  4NF4 A;  4X48 A;  1IQ7 A;  5DVJ A;  3TCF A;  1IUD A;  2M8C A;  3RNN A;  1EZO A;  1B3E A;  1P1Q A;  3KN3 A;  4Q30 B;  4RPO A;  1YPN A;  2Z22 A;  1RKM A;  4YKP A;  2CZL A;  3KN8 A;  5DYH A;  1BTJ A;  1URS A;  3UP9 A;  3DP6 A;  5I56 B;  3K01 A;  3GBB A;  4NF8 A;  4N6P A;  3CFZ A;  3MZ9 A;  3TTM A;  5AA2 D;  3U72 A;  4U1O A;  2E1S A;  1MXV A;  2QL3 A;  3HV1 A;  2UYF A;  1PBP A;  3IO6 A;  4OEV A;  4F3S A;  1OMP A;  3BFT A;  2RCA A;  4G4P A;  3IOV A;  4PP0 A;  3QUF A;  1FTK A;  2O1M A;  3MP8 A;  3B6W A;  4I62 A;  4JWX A;  3SES A;  2F35 A;  1XC1 A;  1NNT A;  4F1V A;  2GFE A;  2ONS A;  4GL8 A;  3CFL A;  4LZ8 A;  3S9M C;  3EHT A;  2OJT A;  2NUV A;  3IOT A;  4IO5 A;  5B70 A;  2XXW A;  4X1D A;  5DEX B;  2NXO A;  3RTF B;  4FAJ A;  1M5C A;  3RQT A;  2DE3 A;  2XX8 A;  4GD5 A;  1JEU A;  1FW0 A;  1N3W A;  3S2V A;  4R2B A;  3O6H A;  4I8C A;  1SI1 A;  3T22 A;  5CC2 A;  1PB7 A;  5K2Y A;  3SDF A;  5H8Q A;  1P99 A;  2ZXT A;  4GL0 A;  5I57 B;  4MFI A;  2VD2 A;  2XXP A;  4JWY A;  4QF9 A;  1IXH A;  1UIV A;  1XHY A;  3DP8 A;  2OWS A;  3K1P A;  2NWJ A;  2Y84 A;  3SER A;  4WED A;  3VVF A;  4NWC A;  2F7A A;  1L5T A;  4H0W A;  2I49 A;  4H5F A;  2I58 A;  2A5S A;  3H6U A;  5CI5 A;  1QJM A;  4DCY A;  4F19 A;  1R1N A;  4DXU A;  3DP4 A;  1MDQ A;  3K6W A;  1A54 A;  1LFI A;  4R9F A;  2YJP A;  1XS5 A;  4WXJ A;  1URG A;  1MPB A;  2B3B A;  2QS4 A;  1BKA A;  1FQB A;  5CRY A;  5ELV A;  5AA2 B;  5BUU A;  1MY1 A;  1B3H A;  1XOC A;  5CBS A;  4R6Y A;  4ZEB A;  4PE5 B;  1USY E;  4OYV A;  1UTB B;  4G68 A;  5FHM A;  2DXR A;  5K2X A;  3O28 A;  5JK4 A;  5BWJ A;  1IIW A;  1QKB A;  3PUW E;  3QIM A;  1N0T A;  1OVT A;  1AOV A;  4DE8 A;  3MVX A;  5TU0 A;  2QMX A;  1ELJ A;  1B51 A;  3T66 A;  4F3P A;  3TQL A;  2REJ A;  3KJ7 A;  2Q2A A;  3K2D A;  3FAS A;  3I6V A;  2D5W A;  2XXH A;  3A09 A;  4H8J A;  3B6T A;  2HCA A;  2W7Y A;  2I3V A;  4PET A;  4R75 A;  3PMV A;  1R9Q A;  1DTG A;  3JYR A;  2UXA A;  2AL5 A;  3Q27 A;  2Q9T A;  2V3Q A;  1N7X A;  5KCJ A;  1A8F A;  1PB9 A;  1WVJ A;  1Z7N E;  2UVH A;  4HTG A;  4RXL A;  3RY3 A;  3VLW A;  3SEY A;  3UIF A;  4N07 A;  1P1U A;  2Y7I A;  4YZZ A;  3GLB A;  1PBQ A;  3SET A;  3EPE A;  1MXY A;  3N94 A;  5J1D A;  3N6U A;  3MZB A;  4QSD A;  3S9L C;  4F22 A;  5TP9 A;  5AA4 A;  4ESW A;  3K0V A;  4EQB A;  1EZP A;  4EXL A;  5I58 B;  5I59 B;  3FAT A;  3FVK A;  3WAF A;  2AL4 A;  1O7T A;  2GHB A;  3IAZ A;  1GTK A;  4PFU A;  1P1N A;  3FVN A;  3E3K A;  3KG2 A;  3U93 A;  5CBR A;  1VSO A;  2F5X A;  4UAC A;  3PUY E;  4NMY A;  3PUX E;  3OD7 A;  1UIU A;  2WKY A;  3C33 A;  3MP6 A;  5EYF A;  3T96 B;  3T9U A;  4F31 B;  1B6H A;  1LFH A;  2F34 A;  3FXU A;  1FTM A;  1FCK A;  1URD A;  2FYI A;  4JDF A;  4IGT A;  3PD9 A;  1Y9U A;  1MQD A;  1B5I A;  1QUK A;  1ZKB A;  2G93 A;  2XD3 A;  1Y3P A;  3KFM A;  3PUV E;  4G68 C;  4H5G A;  4IY5 A;  4KYD A;  3VXB A;  3VXC A;  4ZEC A;  3L6H A;  2Q2C A;  1NNP A;  1YTV A;  3MW0 A;  4GLI A;  4TOZ A;  4U1Z A;  1QVS A;  2ABH A;  3KOT A;  3OSQ A;  3QK6 A;  3RT6 B;  1HSL A;  2F6G A;  2XHD A;  3MPK A;  1M5D A;  3FJ7 A;  1QUL A;  4G8N A;  1D9Y A;  1MPC A;  4QFN A;  3LSW A;  4RYA A;  4U21 A;  3H3G A;  1BIY A;  3G3I A;  4QHQ A;  4U4S A;  3RUM A;  1UQW A;  2VHA A;  1N84 A;  1B3F A;  1H3D A;  5DVI A;  5HM4 B;  4FEB A;  1ZMG A;  4F18 A;  3IOU A;  3TTK A;  1POY 1;  3B7D A;  1M5F A;  2LAO A;  3EF7 A;  2XXX A;  4YB5 A;  4YAH X;  4BDR A;  1LBC A;  3CG1 A;  3WAE A;  1FQD A;  1B4Z A;  2DYX A;  3CFX A;  3FJG A;  3HHG A;  4H67 A;  3TTR A;  4U22 A;  4EF1 A;  3QUJ A;  1M5E A;  4IO3 A;  1DOT A;  1ZTY A;  1JNF A;  3CR9 A;  1Y4C A;  3IL1 B;  3K6U A;  4PQJ A;  1B1H A;  3ODB A;  4R2F A;  3TEL A;  1OQG A;  3O2A A;  5AA2 A;  5JEI A;  5DVF A;  3JV9 A;  1OIB A;  4EQ9 A;  1VR5 A;  3TTL A;  1SW4 A;  3MUQ A;  3VVE A;  4NF6 B;  4P0I A;  1B0H A;  2R71 A;  2RKM A;  1AH5 A;  2PMS A;  2F8D A;  3MC2 A;  1QUI A;  4Z0I A;  1FQF A;  3CVG A;  1GGG A;  4AQ4 A;  2UVI A;  5CM6 A;  3IJO B;  4QFK A;  3E13 X;  5FHO A;  3TEP A;  2A5T B;  1I6Q A;  3FXR A;  1SW2 A;  3H6V A;  3PV0 E;  5I2N B;  3G3H A;  4FAT A;  3VLV A;  3LSX A;  3FVG A;  4GQO A;  4YMB A;  2B65 A;  3K00 A;  1QW0 A;  3M8U A;  1MQG A;  4K3F A;  3BKI B;  3C34 A;  3Q28 A;  4KHZ E;  1CE2 A;  4IB2 A;  5CMC A;  4F2O A;  1H43 A;  1LCT A;  1B4H A;  3IK6 B;  1SDX A;  1H44 A;  1USY H;  4E0W A;  3OO6 A;  3TCG A;  5H8F A;  4LQ2 A;  3N5L A;  4WKM A;  3TOD A;  5KDT A;  3ZS6 A;  1DPE A;  3AXF A;  3MVZ A;  2XD2 A;  4NE4 A;  4GF8 A;  5KZT A;  2HXW A;  2XXT A;  2ZYN A;  1AL3 A;  4IO4 A;  4R9G A;  4R6K A;  4HCY A;  1Y20 A;  2FNC A;  2VP1 A;  2ONK E;  1Z7M E;  3IOW A;  3H6W A;  4NTL A;  3IO4 A;  4FEC A;  4OXV A;  1NMU A;  4ZS9 A;  5I59 A;  3O9P A;  3S4U A;  4XKN A;  1B3L A; 
#chains in the Genus database with same CATH topology
 3RT8 A;  3TDJ A;  4NQ8 A;  1Y1M A;  3FZV A;  1NFT A;  4TQU Q;  3C32 A;  4XKP A;  3OO7 A;  3PD8 A;  3PPP A;  5IZ3 A;  4LZ7 A;  2O69 A;  1FBF A;  4QRZ A;  4IY6 A;  4ZDM A;  4MAG A;  1B7Z A;  2I6E A;  2MKZ A;  2DE2 A;  4F3B A;  3HCQ A;  3SEW A;  2DQV A;  2H99 A;  4F2Q A;  3IB2 A;  4HE1 A;  4YIC A;  4EQ9 A;  4MLV A;  4XFE A;  1TFA A;  1LBV A;  2CZK A;  2DWJ A;  1MQJ A;  4P47 A;  4QFP A;  3SZP A;  3MAM A;  1AMF A;  1DTZ A;  1QGX A;  4PAF A;  1B40 A;  3SEV A;  4NWD A;  3OEK A;  3HST A;  5ICQ A;  3K6X A;  4MNI A;  5F1Q A;  3USD A;  1S9T A;  3U65 A;  1YAE A;  1IME A;  5L9S A;  4ZZE A;  1H76 A;  3UGW A;  3MBP A;  1YCJ A;  2QVU A;  3I5O A;  2Y7K A;  3HPI A;  4NF8 B;  3C31 A;  4G8M A;  4PTK A;  3N6T A;  1MXX A;  2ZZW A;  1B05 A;  4OZ9 A;  3VVD A;  4H1X A;  2HQ0 A;  3A3U A;  5EHM A;  1PDA A;  3DM0 A;  3FXB A;  2O6A A;  3FIR A;  4XEQ A;  3S9E A;  1QUJ A;  1Y3N A;  3U92 A;  2ZYK A;  2THI A;  4M4G A;  3CHG A;  1US5 A;  3FGS A;  5I2K A;  4X8R A;  2Y7W A;  3SEX A;  1NL5 A;  4KR5 A;  4AS5 A;  3CSB A;  1LBX A;  3IJX B;  2QPQ A;  2HAU A;  4EDP A;  1OLA A;  3H6T A;  1MQH A;  1NI9 A;  1TT1 A;  3O97 A;  4OFO A;  2FBP A;  1B5H A;  4KYS A;  4C1T A;  1SVX B;  3U1O A;  4LA9 A;  1A55 A;  3GZG A;  4MHF A;  5TP9 B;  1FQC A;  1FPJ A;  1MDP 1;  2V84 A;  1MG1 A;  1FBG A;  5H8N B;  3Q25 A;  3HO7 A;  4NF5 B;  4P0G A;  4FED A;  4LUB A;  3HHF A;  3TCH A;  4C1U A;  5ITO A;  3PU5 A;  4HE2 A;  1MH4 A;  3KSJ A;  2UVJ A;  1H45 A;  5I84 A;  3H03 A;  2WYK A;  4JBZ A;  4ELO A;  3OO9 A;  2HXR A;  4NED A;  1MRP A;  3OXN A;  3MP1 A;  4LAT A;  3IFA A;  2E0S A;  4ZE9 A;  4HW8 A;  1MPD A;  1FTJ A;  1MY4 A;  3G3K A;  5B7D A;  1IXC A;  3QAX A;  1IMB A;  4ESX A;  4L17 A;  4N91 A;  3O6I A;  5JTY B;  1A7L A;  4R6H A;  2QJE A;  1I69 A;  4JVI A;  4OVS A;  1KA1 A;  4IO7 A;  4MH5 A;  4NF4 B;  3GXA A;  3CG3 A;  1HSE A;  4U2R A;  3LSL A;  4RPN A;  1FPD A;  3K02 A;  1B58 A;  3V83 A;  1DSN A;  4LVQ A;  3G3F A;  1IMF A;  4PFB A;  2QRY A;  1KA0 A;  4P9K A;  1J1N A;  1ZLQ A;  1YYZ A;  3PPO A;  1IQ7 A;  4RPO A;  2Z22 A;  5I3S A;  1BTJ A;  2P3V A;  2HPG A;  5AA2 D;  3HV1 A;  2UYF A;  3IO6 A;  1OMP A;  3BFT A;  4PAI A;  3MP8 A;  3B6W A;  4JWX A;  2F35 A;  5IZZ A;  2QVR A;  1RDZ A;  5EQ8 A;  2GFE A;  4GL8 A;  3CFL A;  1FBC A;  3EHT A;  3IOT A;  2XXW A;  3RTF B;  1FW0 A;  5IZ1 A;  3O6H A;  4I8C A;  3T22 A;  4PCD A;  5K2Y A;  5H8Q A;  2CZI A;  4JWY A;  4QF9 A;  1XHY A;  2NWJ A;  2A5S A;  3H6U A;  5CI5 A;  4N6D A;  4DXU A;  1A54 A;  2ZZV A;  2YJP A;  4PFI A;  1MPB A;  1BKA A;  1B3H A;  4I40 A;  4ZEB A;  1FPL A;  2FVZ A;  2CEY A;  4N17 A;  1IIW A;  1QKB A;  3MVX A;  2QMX A;  1B51 A;  3T66 A;  3TQL A;  3KJ7 A;  4H8J A;  2D5W A;  3Q27 A;  1Z7N E;  4HTG A;  3RY3 A;  3VLW A;  3SEY A;  1PBQ A;  1MXY A;  3MZB A;  3S9L C;  5AA4 A;  4EXL A;  5I58 B;  3FAT A;  3E3K A;  3KG2 A;  2F5X A;  4N8Y A;  5EYF A;  4F31 B;  1B6H A;  1JP4 A;  1FTM A;  1FCK A;  1QUK A;  2XD3 A;  4IY5 A;  4KYD A;  3L6H A;  2Q2C A;  1NV0 A;  5ITP A;  3KOT A;  2XHD A;  1M5D A;  3G3I A;  3RUM A;  1N84 A;  4FEB A;  3IOU A;  3B7D A;  1K9Y A;  1M5F A;  3EF7 A;  3WAE A;  1B4Z A;  2WX9 A;  4EF1 A;  5H8H B;  1DOT A;  3ODB A;  3O2A A;  5AA2 A;  1OIB A;  1DBZ A;  4NF6 B;  4P0I A;  2PMS A;  2F8D A;  4AQ4 A;  4Z0I A;  5CM6 A;  3IJO B;  2A5T B;  5ESY A;  5I2N B;  4FAT A;  1QW0 A;  1MQG A;  4KHZ E;  3C34 A;  1CE2 A;  1NV6 A;  2L5V A;  4NG7 A;  4E0W A;  1USY H;  3TOD A;  3MVZ A;  4NE4 A;  2XXT A;  1NUX A;  1AL3 A;  1NV1 A;  4NTL A;  5JK4 A;  2QL3 A;  4PFR A;  3MWB A;  4DDD A;  2OZZ A;  2A5T A;  1LLS A;  5L8D A;  5JTY A;  4ELQ A;  1NNF A;  1N04 A;  3BFU A;  2I0C A;  5EQ7 A;  4LQ5 A;  4O94 A;  2IA4 A;  4QFO A;  2PT2 A;  5H8F B;  4MBP A;  4I3Y A;  1DMB A;  3DEL B;  2QS3 A;  2NOO A;  5CMM A;  2KR0 A;  3RGY A;  2OBG A;  1SI0 A;  3A3C A;  2XXV A;  4H6D A;  4YKI A;  3V5A A;  1MQI A;  4KFQ A;  4G2Z A;  1UTB A;  3K1N A;  4PDH A;  2HZL A;  2XXR A;  1B1X A;  4LON B;  2DVC A;  2FIX A;  1IXG A;  3O6G A;  3E78 A;  2QSX A;  1R6Z A;  2GH9 A;  1NNK A;  3OEL A;  2FA7 A;  4F29 A;  2F97 A;  4GVO A;  4O8M A;  1NUW A;  3QYT A;  1A99 A;  3O29 A;  4LZ5 A;  4OEU A;  2REG A;  4DZ1 A;  2Z8F A;  1B0L A;  3ILU B;  4XKR A;  3RN8 A;  2XXI A;  4RK2 A;  1MM7 A;  2P1S A;  1MXU A;  1SBP A;  3MYU A;  4ONY A;  4IGR A;  4E0X A;  3FJM A;  4MCO A;  4JVC A;  4AB6 A;  2WBB A;  3O66 A;  3K6V A;  1B7U A;  4JB7 A;  3LUZ A;  3KEI A;  3R26 A;  3MJN A;  4KXP A;  3TZA A;  2DE4 A;  4OES A;  1FJ6 A;  1LBB A;  2Q74 A;  5LTC A;  1NV5 A;  3T9X B;  2DP8 A;  3PPQ A;  3D4G A;  5LOM A;  3G7W A;  5ET6 A;  2ZNT A;  4HCW A;  4FIM A;  3CRB A;  2XWO A;  4GOT A;  1XVX A;  3B6Q A;  4MEV A;  4YKJ A;  3MPL A;  1UTH A;  2O51 A;  3FV2 A;  3IB0 A;  5A5X A;  4KCC A;  3UK4 A;  2F36 A;  3BBR A;  1ZU0 A;  3PPR A;  1S7Y A;  4PFW A;  3E4R A;  1LFG A;  2XWI A;  1FSA A;  4ZEI A;  4Q5T A;  5H8Q B;  4ZE8 A;  3JZJ A;  2RCB A;  2ZMB A;  5AA4 B;  3TFL A;  4MF3 A;  5AA1 A;  4EF2 A;  2X7P A;  4Q8R A;  1FTA A;  1B9J A;  4EQ7 A;  1US4 A;  5KCJ B;  1NH7 A;  1LB9 A;  2RF1 A;  2BJJ X;  2I4C A;  2X26 A;  1VE4 A;  4DI4 B;  1MS7 A;  4NF5 A;  2Z23 A;  3R7X A;  2PT1 A;  1MY3 A;  4N4U A;  4YB7 A;  4DI3 D;  1EYI A;  2H9B A;  5CMB A;  1FPE A;  1IIT A;  2O84 X;  1FPK A;  4AS4 A;  3Q26 A;  3RPW A;  3OOA A;  4GWY A;  3RLF E;  2VT5 A;  4HE0 A;  3W9W A;  4GXA A;  1OLC A;  4ISU A;  4ELP A;  1SPI A;  3QXM A;  2P0S A;  4O3B A;  1I6A A;  4IO2 A;  3FV1 A;  3S9N C;  3FVO A;  1N76 A;  2XXK A;  4MLQ A;  2VPO A;  1WOD A;  1KWH A;  2ZYO A;  1POT A;  2XXY A;  1B32 A;  1IMA A;  1S50 A;  3IB1 A;  4P56 A;  3LSF B;  3ZSF A;  2FIE A;  2KLF A;  3UA8 A;  4FJP A;  3VV5 A;  4XIG Q;  2DWA A;  1GR2 A;  5TPA B;  4R72 A;  3A29 A;  4GWU A;  2XXQ A;  5F24 A;  2XXU A;  4GWZ A;  3VLU A;  2QS2 A;  1INP A;  4PFT A;  5FTI A;  1XI6 A;  4OER A;  4TLM B;  4KYE A;  5H8H A;  3C36 A;  4OAN A;  2F7B A;  3LBS A;  4X9T A;  4X48 A;  3TCF A;  1IUD A;  3RNN A;  3KN3 A;  4YKP A;  5I7I A;  2WBD A;  1URS A;  3UP9 A;  4N6P A;  3U72 A;  4OEV A;  1PBP A;  4G4P A;  3IOV A;  4P8B A;  4PP0 A;  4I62 A;  3SES A;  2ONS A;  3S9M C;  3LV0 A;  4MJO A;  1M5C A;  2DE3 A;  2XX8 A;  1PB7 A;  3MST A;  1P99 A;  2ZXT A;  4MFI A;  1IXH A;  3K1P A;  2Y84 A;  4WED A;  2F7A A;  4DCY A;  3DP4 A;  2GQ1 A;  1MDQ A;  1LFI A;  4R9F A;  4WXJ A;  4MNC A;  3EKI A;  1XOC A;  4PE5 B;  4GBV A;  1UTB B;  4N15 A;  5FHM A;  5FBP A;  3HFU A;  5BWJ A;  1OVT A;  4DE8 A;  3K2D A;  4NGU A;  2HCA A;  3PMV A;  1DTG A;  3JYR A;  2UXA A;  1N7X A;  3T0J A;  1A8F A;  1WVJ A;  2Y7I A;  3B8B A;  5J1D A;  4F22 A;  1EZP A;  3K0V A;  4GWS A;  4PFU A;  5CBR A;  1P1N A;  3U93 A;  1FRP A;  2ZZX A;  4NMY A;  3T9U A;  1UIU A;  3T96 B;  2F34 A;  4JDF A;  2FYI A;  4MIJ A;  1MQD A;  1B5I A;  1FPB A;  5I5P A;  4PDD A;  1YTV A;  4TOZ A;  1LBZ A;  3RTW B;  4RYA A;  3LSW A;  1IMC A;  5DVI A;  5HM4 B;  1ZMG A;  4F18 A;  2LAO A;  3CG1 A;  3CFX A;  3FJG A;  4H67 A;  2Q8J A;  1JNF A;  3IL1 B;  3K6U A;  5JEI A;  1VR5 A;  3TTL A;  1SW4 A;  5L9M A;  2QFL A;  2RKM A;  3MC2 A;  4UAB A;  4QFK A;  1SW2 A;  3LSX A;  3FVG A;  3K00 A;  4K3F A;  3BKI B;  4F2O A;  1H43 A;  1B4H A;  3IK6 B;  4LQ2 A;  3N5L A;  3ZS6 A;  4GF8 A;  5KZT A;  4R9G A;  4R6K A;  4HCY A;  2VP1 A;  1DCU A;  4FEC A;  3N26 A;  1TFD A;  2AYS A;  4DCX A;  4O7I A;  4NX1 A;  1JET A;  4PGP A;  2V3T A;  2I3W A;  5EYG A;  1GVC A;  4BDM A;  2PVU A;  2NVU B;  2PBW A;  3ZKK A;  3PPN A;  3OSR A;  3QMF A;  1OVB A;  4DLD A;  4Q0C A;  1LEV A;  1PB8 A;  3EN3 A;  1P1W A;  4YU0 A;  2HZK A;  1SD3 A;  5M2V A;  5I2N A;  2DXY A;  1SQY A;  2Z8E A;  3OMB A;  3GBA A;  4BDN A;  1NUY A;  4G68 B;  3W9V A;  2V25 A;  1B52 A;  2Q8M A;  4M1V A;  2H5Y A;  4BDL A;  4GBW A;  1O64 A;  3EHS A;  3T9V A;  1PC3 A;  5TPA A;  1NV2 A;  2CMO A;  3KGC A;  3L6G A;  4DXB A;  2BJI A;  2O7I A;  1YZ0 A;  3EQ1 A;  4RK9 A;  4RY1 A;  1CNQ A;  1JW1 A;  3ROJ A;  3TPA A;  1GV8 A;  3ECR A;  3M3K A;  1B3G A;  5EYH A;  2OLB A;  4POW A;  3T1B A;  2OWT A;  3TUS A;  3OEN A;  4XF5 A;  3G3G A;  4WEP A;  1ANF A;  3C4M A;  4QFL A;  4I1D A;  3UOR A;  1FBP A;  1XT8 A;  4G8H A;  5AE4 A;  4P11 A;  3CIJ A;  3KJT A;  2ZNS A;  4U4X A;  2PYY A;  3IX1 A;  2KQZ A;  4F39 A;  3IOR A;  1LAH E;  1MXZ A;  4RA1 A;  4ZZA A;  4JWO A;  1TXF A;  3MQ9 A;  4XKQ A;  3R6U A;  1LBW A;  4NF6 A;  2CEX A;  2RC8 A;  2D3I A;  1OQH A;  3V8X B;  3LUY A;  4O3C A;  4BDQ A;  4PGN A;  3PMX A;  4FE8 A;  1F9B A;  4OHN A;  3W15 C;  2UVG A;  3FUZ A;  4GWO A;  3V89 B;  4O3A A;  2ALU A;  4ZED A;  2ANJ A;  2F6P A;  1AWB A;  1FBD A;  1JVX A;  3TAJ A;  1JQF A;  2HEU A;  2D21 A;  3FXQ A;  1LBY A;  1K9Z A;  4MMP A;  3P7I A;  1II5 A;  4R73 A;  1MH3 A;  4HXV A;  1DPP A;  5KDT B;  3TQW A;  4OVJ A;  5AA3 A;  1IZ1 A;  2HAV A;  1FTL A;  2QS1 A;  5I56 A;  1B7H A;  1Y1Z A;  5DW8 A;  1M5B A;  2VOZ A;  3KSX A;  4LN5 A;  4LP2 B;  1ATG A;  4I9D A;  2XX9 A;  4OMB A;  3C35 A;  1EZ9 A;  1P1O A;  4N13 A;  2DVZ A;  1ZIU A;  4OVP A;  4BLA A;  4GWX A;  1Y4T A;  4EUO A;  4X04 A;  5HPQ A;  2O1L A;  3GYY A;  4POX A;  2F78 A;  4ESW A;  1N7W A;  4KD5 A;  2H4I A;  2B3F A;  1D4N A;  5ET7 A;  3KZG A;  1D3K A;  3E9X A;  4P1L A;  4H65 A;  4YMA A;  1EYK A;  4QSC A;  4AB5 A;  1LAF E;  4GX6 A;  1FTO A;  5ICT A;  2G29 A;  1RYO A;  1IXI A;  5CMK A;  1SW1 A;  4ZEK A;  4IO6 A;  1MY0 A;  1SYH A;  3ILT B;  4H46 A;  2ESN A;  2QMW A;  1BLF A;  1TWY A;  4UA8 A;  4JSD A;  5L9O A;  4JXI A;  2R9J A;  4NF4 A;  2M8C A;  1EZO A;  1B3E A;  1RKM A;  2CZL A;  5DYH A;  4N8G A;  3DP6 A;  5I56 B;  3GBB A;  3TTM A;  2OX3 A;  4U1O A;  1MXV A;  4F3S A;  2RCA A;  3QUF A;  1FTK A;  4LZ8 A;  4QXD A;  2OJT A;  5B70 A;  4X1D A;  5DEX B;  4FAJ A;  1N3W A;  5CC2 A;  4R2B A;  1SI1 A;  2CZH A;  3SDF A;  4PF8 A;  4GL0 A;  2XXP A;  1UIV A;  2OWS A;  2F3B A;  3SER A;  2B4L A;  3VVF A;  4H0W A;  2I49 A;  4F19 A;  1FBE A;  3BIH A;  5IM2 A;  1XS5 A;  2PFY A;  1URG A;  1FQB A;  5CRY A;  1MY1 A;  5CBS A;  4R6Y A;  1USY E;  4OYV A;  4G68 A;  2DXR A;  5K2X A;  3O28 A;  4OVT A;  3QIM A;  1N0T A;  1ELJ A;  3KC0 A;  4F3P A;  2Q2A A;  3FAS A;  2W7Y A;  4R75 A;  2I3V A;  4PET A;  2V3Q A;  1PB9 A;  2UVH A;  5LDZ A;  1P1U A;  3SET A;  4YZZ A;  3GLB A;  3N94 A;  3N6U A;  3FVK A;  3WAF A;  1GTK A;  1VSO A;  3PUY E;  3PUX E;  3OD7 A;  1IMD A;  3FXU A;  1URD A;  3S2V A;  4IGT A;  3PD9 A;  4KI0 E;  1ZKB A;  4G68 C;  1Y3P A;  3PUV E;  4H5G A;  4OA4 A;  3VXB A;  3VXC A;  1FPF A;  4ZEC A;  2VPN A;  1NNP A;  3ISP A;  4GX3 A;  3QK6 A;  2ABH A;  5ET8 A;  3OSQ A;  3RT6 B;  2F6G A;  3MPK A;  3FJ7 A;  4QFN A;  1QUL A;  1NV3 A;  4U21 A;  1MPC A;  4U4S A;  4NF0 A;  4PF6 A;  1B3F A;  3TTK A;  1POY 1;  4YB5 A;  4YAH X;  4BDR A;  1G0I A;  3TTR A;  4U22 A;  1ZTY A;  4R2F A;  4PQJ A;  1B1H A;  1OQG A;  3JV9 A;  4NN3 A;  1AH5 A;  1QUI A;  1FQF A;  1GGG A;  2UVI A;  4GX4 A;  3E13 X;  5FHO A;  1I6Q A;  3G3H A;  4GQO A;  4YMB A;  2B65 A;  5CMC A;  1SDX A;  1H44 A;  5H8F A;  3TCG A;  3IFC A;  1DPE A;  2XD2 A;  2HXW A;  2ZYN A;  4IO4 A;  2FNC A;  2ONK E;  3IO4 A;  1NMU A;  4ZEF A;  3O9P A;  4XKN A;  1B3L A;  1A8E A;  4TLL B;  4EXK A;  3BIG A;  4PE3 A;  1AIV A;  4KCD A;  3M3F A;  4GFR A;  3EHU A;  1B46 A;  2XWV A;  4JSO A;  3TKD A;  4GXS B;  1JW5 A;  1EH3 A;  1MM6 A;  3LR1 A;  4U23 A;  1CB6 A;  1B2H A;  1D9V A;  2F7C A;  3ONM A;  4MX6 A;  1G0H A;  1ZJL A;  4P1E A;  2YLN A;  2Y7R A;  4I3E A;  4F1U A;  1LAX A;  1LST A;  2DSF A;  1T0K A;  2H25 A;  3PUZ E;  2OK2 A;  4RNS A;  4THI A;  1FPG A;  2P3N A;  5EHS A;  3VDF A;  1LGB C;  5ISU A;  3CSG A;  1I6B A;  2Y5L A;  3E79 A;  4H8I A;  5H8N A;  4QBA A;  4QSE A;  4Z7E A;  4FOR A;  2Q88 A;  4C0R A;  5I57 A;  5FHN A;  3Q29 A;  4PFY A;  1SYI A;  1NH8 A;  5DT6 A;  1B5J A;  2Z8D A;  5H8S A;  1Q1K A;  1NV7 A;  3IR1 A;  4OEN A;  4YKK A;  1JEV A;  3LC8 A;  2F3D A;  4OVR A;  2PX1 A;  2DWI A;  5I58 A;  3QSL A;  4OFJ A;  3TMG A;  1RDX A;  2V4C A;  1ZBM A;  3RYD A;  4MNP A;  1WDN A;  5IAI A;  3OEM A;  2I4B A;  2AIX A;  3H4Z A;  1R9L A;  2OWZ A;  4G77 A;  1FJ9 A;  1PEB A;  4X1B A;  3SKP A;  2RIN A;  2R6G E;  3CI8 A;  1BP5 A;  5IKB A;  1Y3Q A;  1EU8 A;  2B4M A;  4XXU A;  1HSJ A;  1NKX A;  2DWH A;  2HFB A;  3U94 A;  4GIZ A;  3UN6 A;  2ZNU A;  1MXW A;  1IEJ A;  4DIG A;  2QVV A;  3KOS A;  3PTY A;  1MY2 A;  4DXC A;  3ZKL A;  3KN7 A;  4PBH A;  1A40 A;  1Q35 A;  5I59 B;  3MZ1 A;  2I48 A;  4OWD A;  2DS9 A;  4OTE A;  4ELR A;  4XTC Q;  2YPN A;  2V3U A;  1UTH B;  3NOH A;  3HN0 A;  2X7Q A;  4F3G A;  2IEE A;  3TTN A;  4GWW A;  4H45 A;  4R74 A;  4F1Y A;  2V93 A;  3KBZ A;  5HBC A;  2P2A A;  5I2K B;  3D1R A;  1NV4 A;  1FQE A;  1RYX A;  4N81 A;  3KBR A;  1VFD A;  4OET A;  4P3L A;  1N3X A;  2O68 A;  1O63 A;  3F11 A;  3H7M A;  4KQP A;  3C9H A;  3RPL A;  1LCF A;  1QKA A;  4G61 A;  3H06 B;  3T9H B;  3T93 B;  3U8Q A;  5IGA A;  3VFJ A;  2GHA A;  2ONR A;  4RJZ A;  2H98 A;  2VGQ A;  1LAG E;  4ECF A;  5FTH A;  3FD3 A;  3OO8 A;  2XX7 A;  3PGF A;  2RC7 A;  3FBP A;  3K1M A;  2OCU A;  3KC1 A;  4JVD A;  3RPL B;  1XVY A;  2O7U A;  5IZ3 B;  4OFL A;  3PMW A;  3G3J A;  5DEX A;  3K4U A;  4HS7 A;  3M3L A;  4ND9 A;  4KPT A;  3MVW A;  1JW4 A;  5A5X B;  4OQO A;  4GRK A;  1JVY A;  4YB6 A;  2Y7P A;  3MVY A;  2RC9 A;  4NHB A;  1LB8 A;  2UYE A;  5F7V A;  3B50 A;  1SW5 A;  2Q89 A;  1Q9D A;  3D4C A;  2VD3 A;  1RDY A;  3VE1 B;  3DLN A;  2ZYM A;  1VFE A;  2PCR A;  3I3V A;  2DOJ A;  1FQA A;  3SEU A;  2GRV A;  2HHM A;  2I0B A;  2WEF A;  3THI A;  3TYH A;  5DVJ A;  1P1Q A;  4Q30 B;  1YPN A;  3KN8 A;  3K01 A;  4NF8 A;  3CFZ A;  3MZ9 A;  5ET5 A;  2E1S A;  1FBH A;  2O1M A;  2JJK A;  1XC1 A;  1NNT A;  1EYJ A;  4F1V A;  4PAK A;  2NUV A;  4IO5 A;  2NXO A;  3RQT A;  4GD5 A;  1JEU A;  5I57 B;  2VD2 A;  2WYP A;  3DP8 A;  4NWC A;  1L5T A;  4H5F A;  2I58 A;  1QJM A;  1R1N A;  3K6W A;  4OVQ A;  2Y5K A;  4N6K A;  5EQ9 A;  2B3B A;  2QS4 A;  5AA2 B;  5ELV A;  5BUU A;  4IR8 A;  4PC9 A;  2FHY A;  3PUW E;  1AOV A;  4PBQ A;  1VDW A;  5TU0 A;  1YXI A;  2REJ A;  3I6V A;  3A09 A;  2XXH A;  3B6T A;  1R9Q A;  5KCJ A;  2AL5 A;  2Q9T A;  4NAP A;  4RXL A;  3UIF A;  4N07 A;  3EPE A;  4QSD A;  5TP9 A;  4EQB A;  2AL4 A;  1O7T A;  2GHB A;  3IAZ A;  3FVN A;  5A5L A;  1D9Q A;  4UAC A;  2WKY A;  3C33 A;  3MP6 A;  1LFH A;  1Y9U A;  2G93 A;  3KFM A;  2PFZ A;  3MW0 A;  4GLI A;  4U1Z A;  1FPI A;  1QVS A;  2XA5 A;  1HSL A;  4G8N A;  1D9Y A;  3H3G A;  1BIY A;  4QHQ A;  1UQW A;  2VHA A;  2XWK A;  1H3D A;  5EQA A;  4O7M A;  1DK4 A;  2XXX A;  1LBC A;  5J16 A;  1FQD A;  2DYX A;  1KZ8 A;  3HHG A;  3QUJ A;  1M5E A;  5DTB A;  4IO3 A;  3CR9 A;  1Y4C A;  3TEL A;  5DVF A;  2DDK A;  2R8T A;  3MUQ A;  5T3J A;  3VVE A;  1B0H A;  2R71 A;  1BK4 A;  4BDO A;  3CVG A;  4FBP A;  3TEP A;  3FXR A;  3H6V A;  3PV0 E;  3VLV A;  3M8U A;  1NUZ A;  3Q28 A;  4IB2 A;  1LCT A;  3OO6 A;  4WKM A;  5KDT A;  3AXF A;  1Y20 A;  1Z7M E;  3IOW A;  3H6W A;  4ZS9 A;  4OXV A;  5I59 A;  3S4U A; 
#chains in the Genus database with same CATH homology
 3RT8 A;  3TDJ A;  3N26 A;  3MWB A;  1A8E A;  4DDD A;  4TLL B;  1Y1M A;  2OZZ A;  3FZV A;  4EXK A;  1NFT A;  1TFD A;  2A5T A;  2AYS A;  1AIV A;  1LLS A;  4KCD A;  4TQU Q;  3C32 A;  3M3F A;  3EHU A;  4GFR A;  1B46 A;  3OO7 A;  3PD8 A;  3PPP A;  4JSO A;  4XKP A;  5L8D A;  3RTW B;  4GXS B;  3TKD A;  4DCX A;  4ELQ A;  1JW5 A;  1EH3 A;  4LZ7 A;  1NNF A;  1MM6 A;  2O69 A;  3LR1 A;  1JET A;  1N04 A;  4QRZ A;  4U23 A;  3BFU A;  1CB6 A;  1B2H A;  1D9V A;  2I0C A;  2V3T A;  4IY6 A;  2I3W A;  4ZDM A;  4LQ5 A;  2F7C A;  1B7Z A;  2I6E A;  3ONM A;  2IA4 A;  1GVC A;  1ZJL A;  2PVU A;  4BDM A;  2NVU B;  2PBW A;  3ZKK A;  2YLN A;  3PPN A;  3OSR A;  2DE2 A;  4QFO A;  4F3B A;  2Y7R A;  2PT2 A;  5H8F B;  3HCQ A;  1OVB A;  4MBP A;  3SEW A;  1LAX A;  1LST A;  4Q0C A;  1DMB A;  1PB8 A;  2DSF A;  4DLD A;  4F1U A;  2DQV A;  3DEL B;  3EN3 A;  1T0K A;  1P1W A;  4YU0 A;  2H25 A;  2HZK A;  2QS3 A;  2H99 A;  2NOO A;  1SD3 A;  5CMM A;  5M2V A;  4F2Q A;  3IB2 A;  5I2N A;  2DXY A;  1SQY A;  3PUZ E;  2OBG A;  1SI0 A;  2Z8E A;  3OMB A;  3A3C A;  2OK2 A;  2XXV A;  4H6D A;  3GBA A;  1MQI A;  4MLV A;  4YKI A;  3V5A A;  4BDN A;  4KFQ A;  1TFA A;  1UTB A;  3K1N A;  4G2Z A;  4G68 B;  4RNS A;  2DWJ A;  1MQJ A;  3W9V A;  4THI A;  2HZL A;  2XXR A;  1B1X A;  4LON B;  2V25 A;  5EHS A;  4QFP A;  1B52 A;  2DVC A;  4M1V A;  3MAM A;  2H5Y A;  1AMF A;  3VDF A;  1IXG A;  1DTZ A;  1LGB C;  3O6G A;  4BDL A;  5ISU A;  2QSX A;  1B40 A;  1O64 A;  1R6Z A;  5ITP A;  3CSG A;  1I6B A;  3SEV A;  3EHS A;  4NWD A;  2GH9 A;  1NNK A;  3OEL A;  3HST A;  3OEK A;  3T9V A;  2FA7 A;  4F29 A;  5H8Q B;  2F97 A;  1PC3 A;  4GVO A;  5TPA A;  5ICQ A;  4H8I A;  5H8N A;  3K6X A;  4QSE A;  3QYT A;  5F1Q A;  3USD A;  1A99 A;  4Z7E A;  1S9T A;  4FOR A;  2CMO A;  2Q88 A;  3KGC A;  2REG A;  3O29 A;  4LZ5 A;  4OEU A;  5FHN A;  4C0R A;  5I57 A;  1YAE A;  3L6G A;  3Q29 A;  4DXB A;  4PFY A;  4DZ1 A;  1SYI A;  1NH8 A;  5DT6 A;  1B5J A;  5L9S A;  2Z8D A;  2Z8F A;  1B0L A;  1Q1K A;  5H8S A;  1H76 A;  4ZZE A;  3UGW A;  2O7I A;  3ILU B;  3MBP A;  4XKR A;  3EQ1 A;  4RK9 A;  1YCJ A;  3RN8 A;  3I5O A;  2XXI A;  2Y7K A;  4RY1 A;  1JW1 A;  3IR1 A;  3HPI A;  4NF8 B;  4OEN A;  3TPA A;  4RK2 A;  1MM7 A;  2P1S A;  1MXU A;  1SBP A;  3C31 A;  4G8M A;  4ONY A;  1GV8 A;  5ICT A;  4YKK A;  1JEV A;  3LC8 A;  3ECR A;  4IGR A;  4E0X A;  3FJM A;  3N6T A;  3M3K A;  1B3G A;  1MXX A;  2PX1 A;  2DWI A;  4KI0 E;  5I58 A;  3RGY A;  2OLB A;  4POW A;  1B05 A;  2OWT A;  4AB6 A;  3TUS A;  3OEN A;  3QSL A;  4OZ9 A;  3G3G A;  3K6V A;  3O66 A;  3VVD A;  4H1X A;  4OFJ A;  4WEP A;  1ANF A;  1B7U A;  3TMG A;  2HQ0 A;  4JB7 A;  3C4M A;  4QFL A;  4I1D A;  3A3U A;  3KEI A;  1PDA A;  1ZBM A;  3R26 A;  5EHM A;  3UOR A;  1XT8 A;  3MJN A;  1WDN A;  4G8H A;  5AE4 A;  4P11 A;  3CIJ A;  3DM0 A;  3KJT A;  3TZA A;  2O6A A;  2ZNS A;  2DE4 A;  3FIR A;  4OES A;  4U4X A;  2PYY A;  2I4B A;  3OEM A;  5IAI A;  2AIX A;  3H4Z A;  3IX1 A;  3S9E A;  1LBB A;  1R9L A;  4F39 A;  1QUJ A;  3IOR A;  1LAH E;  1MXZ A;  4G77 A;  4RA1 A;  4ZZA A;  1Y3N A;  4X1B A;  1PEB A;  2ZYK A;  3U92 A;  4JWO A;  3T9X B;  1TXF A;  3MQ9 A;  4XKQ A;  3R6U A;  3SKP A;  4NF6 A;  2RIN A;  2RC8 A;  2R6G E;  2D3I A;  2DP8 A;  3PPQ A;  1OQH A;  3CI8 A;  2THI A;  3D4G A;  3V8X B;  3LUY A;  5LOM A;  4O3C A;  4M4G A;  1BP5 A;  4BDQ A;  1US5 A;  3G7W A;  2ZNT A;  4HCW A;  5IKB A;  3FGS A;  3PMX A;  5I2K A;  1Y3Q A;  4FE8 A;  1F9B A;  2Y7W A;  4FIM A;  3SEX A;  4OHN A;  1EU8 A;  3CRB A;  4XXU A;  1HSJ A;  1NKX A;  3W15 C;  4GOT A;  2DWH A;  2UVG A;  4YIC A;  1XVX A;  1NL5 A;  2HFB A;  3B6Q A;  4YKJ A;  3FUZ A;  3MPL A;  4GWO A;  1UTH A;  3U94 A;  2O51 A;  3FV2 A;  4GIZ A;  4KR5 A;  4O3A A;  3UN6 A;  2ALU A;  3V89 B;  4ZED A;  2ZNU A;  1MXW A;  3IB0 A;  5A5X A;  3CSB A;  4KCC A;  3UK4 A;  2ANJ A;  2F6P A;  2F36 A;  3BBR A;  1IEJ A;  4DIG A;  1JVX A;  3IJX B;  3KOS A;  1ZU0 A;  3PPR A;  1MY2 A;  4DXC A;  2QPQ A;  1S7Y A;  1JQF A;  2HEU A;  2HAU A;  3TAJ A;  4EDP A;  1OLA A;  2D21 A;  3FXQ A;  3H6T A;  3ZKL A;  3KN7 A;  1MQH A;  1TT1 A;  3O97 A;  4PFW A;  4OFO A;  3E4R A;  4ZEF A;  1A40 A;  1LFG A;  1Q35 A;  4ZEI A;  1B5H A;  3MZ1 A;  3P7I A;  1II5 A;  4Q5T A;  4R73 A;  2I48 A;  2RCB A;  3JZJ A;  2ZMB A;  4OWD A;  1MH3 A;  2DS9 A;  4OTE A;  4ELR A;  4XTC Q;  5AA4 B;  4KYS A;  2YPN A;  2V3U A;  3TFL A;  4MF3 A;  1DPP A;  5AA1 A;  4EF2 A;  1UTH B;  2X7P A;  4Q8R A;  4C1T A;  1SVX B;  3U1O A;  4LA9 A;  1B9J A;  3HN0 A;  5KDT B;  2X7Q A;  4F3G A;  1A55 A;  3TQW A;  4EQ7 A;  3GZG A;  1US4 A;  2IEE A;  3TTN A;  5KCJ B;  4OVJ A;  4ZE8 A;  1NH7 A;  1LB9 A;  5TP9 B;  4R74 A;  4F1Y A;  5AA3 A;  2RF1 A;  1IZ1 A;  1FQC A;  2V93 A;  2BJJ X;  2HAV A;  1MDP 1;  5HBC A;  1FTL A;  2I4C A;  2V84 A;  2X26 A;  1MG1 A;  2QS1 A;  1VE4 A;  5H8N B;  3Q25 A;  5JTY A;  2P2A A;  3HO7 A;  1MS7 A;  4NF5 B;  5I56 A;  1B7H A;  4P0G A;  4NF5 A;  1Y1Z A;  2Z23 A;  4FED A;  4LUB A;  3HHF A;  5I2K B;  2PT1 A;  1MY3 A;  3R7X A;  1FQE A;  1RYX A;  4YB7 A;  3TCH A;  4C1U A;  3KBR A;  5ITO A;  1M5B A;  1VFD A;  2H9B A;  3PU5 A;  5CMB A;  4OET A;  1MH4 A;  5DTB A;  3KSJ A;  2UVJ A;  1H45 A;  5I84 A;  1IIT A;  2O84 X;  3H03 A;  2VOZ A;  3KSX A;  1N3X A;  2O68 A;  1O63 A;  4JBZ A;  3Q26 A;  4LP2 B;  4ELO A;  3OO9 A;  3RPW A;  3F11 A;  1ATG A;  3H7M A;  4NED A;  1MRP A;  4KQP A;  5H8H B;  3OXN A;  3MP1 A;  3C9H A;  4I9D A;  2XX9 A;  4OMB A;  3OOA A;  4LAT A;  1LCF A;  1QKA A;  3C35 A;  3RLF E;  1EZ9 A;  2E0S A;  4ZE9 A;  1P1O A;  4N13 A;  1MPD A;  1ZIU A;  2DVZ A;  4GXA A;  1FTJ A;  3W9W A;  4BLA A;  3H06 B;  4HW8 A;  3T9H B;  1MY4 A;  1Y4T A;  1OLC A;  3G3K A;  5B7D A;  3T93 B;  3U8Q A;  4ISU A;  3VFJ A;  2GHA A;  1IXC A;  2ONR A;  2H98 A;  3QXM A;  2VGQ A;  4RJZ A;  4ELP A;  4EUO A;  1LAG E;  2P0S A;  4ECF A;  2Q8J A;  4O3B A;  5FTH A;  1I6A A;  3FD3 A;  3QAX A;  2O1L A;  3OO8 A;  2XX7 A;  4POX A;  5HPQ A;  3PGF A;  2F78 A;  4IO2 A;  3FV1 A;  2RC7 A;  1N7W A;  3K1M A;  3FVO A;  4L17 A;  4KD5 A;  4ESX A;  2H4I A;  2OCU A;  3S9N C;  1N76 A;  1XVY A;  2O7U A;  3O6I A;  5JTY B;  2B3F A;  4MLQ A;  4OFL A;  1A7L A;  3PMW A;  3G3J A;  5DEX A;  1D4N A;  3K4U A;  4R6H A;  2QJE A;  3KZG A;  4HS7 A;  1WOD A;  1D3K A;  3E9X A;  1KWH A;  1I69 A;  3M3L A;  4ND9 A;  2ZYO A;  1POT A;  3MVW A;  2XXY A;  4KPT A;  4H65 A;  1B32 A;  4YMA A;  4QSC A;  1JW4 A;  1S50 A;  4AB5 A;  5A5X B;  3IB1 A;  4BDO A;  4IO7 A;  4OQO A;  1LAF E;  4MH5 A;  3LSF B;  1FTO A;  4GRK A;  3ZSF A;  1JVY A;  2KLF A;  4YB6 A;  4NF4 B;  2Y7P A;  3GXA A;  2RC9 A;  2G29 A;  3CG3 A;  1HSE A;  3MVY A;  3UA8 A;  4FJP A;  1RYO A;  3VV5 A;  1IXI A;  5CMK A;  1SW1 A;  4XIG Q;  4U2R A;  2DWA A;  4ZEK A;  1GR2 A;  1LB8 A;  3LSL A;  4IO6 A;  4R72 A;  5TPA B;  4RPN A;  1MY0 A;  3K02 A;  2UYE A;  2XXQ A;  5F7V A;  1SYH A;  1SW5 A;  2Q89 A;  1B58 A;  3V83 A;  3D4C A;  1DSN A;  3ILT B;  2VD3 A;  2XXU A;  3VLU A;  4LVQ A;  2ESN A;  3G3F A;  3VE1 B;  3DLN A;  2QS2 A;  2ZYM A;  4PFT A;  5FTI A;  1VFE A;  3I3V A;  4OER A;  2QMW A;  1BLF A;  1TWY A;  2DOJ A;  2QRY A;  4UA8 A;  4TLM B;  4KYE A;  1FQA A;  5H8H A;  3SEU A;  2GRV A;  2I0B A;  4JSD A;  3C36 A;  1J1N A;  1ZLQ A;  5L9M A;  3THI A;  3TYH A;  5L9O A;  2F7B A;  3LBS A;  4JXI A;  4X9T A;  2R9J A;  3PPO A;  4NF4 A;  4X48 A;  1IQ7 A;  5DVJ A;  3TCF A;  1IUD A;  2M8C A;  3RNN A;  1EZO A;  1B3E A;  1P1Q A;  3KN3 A;  4Q30 B;  4RPO A;  1YPN A;  2Z22 A;  1RKM A;  4YKP A;  2CZL A;  3KN8 A;  5DYH A;  1BTJ A;  1URS A;  3UP9 A;  3DP6 A;  5I56 B;  3K01 A;  3GBB A;  4NF8 A;  4N6P A;  3CFZ A;  3MZ9 A;  3TTM A;  5AA2 D;  3U72 A;  4U1O A;  2E1S A;  1MXV A;  2QL3 A;  3HV1 A;  2UYF A;  1PBP A;  3IO6 A;  4OEV A;  4F3S A;  1OMP A;  3BFT A;  2RCA A;  4G4P A;  3IOV A;  4PP0 A;  3QUF A;  1FTK A;  2O1M A;  3MP8 A;  3B6W A;  4I62 A;  4JWX A;  3SES A;  2F35 A;  1XC1 A;  1NNT A;  4F1V A;  2GFE A;  2ONS A;  4GL8 A;  3CFL A;  4LZ8 A;  3S9M C;  3EHT A;  2OJT A;  2NUV A;  3IOT A;  4IO5 A;  5B70 A;  2XXW A;  4X1D A;  5DEX B;  2NXO A;  3RTF B;  4FAJ A;  1M5C A;  3RQT A;  2DE3 A;  2XX8 A;  4GD5 A;  1JEU A;  1FW0 A;  1N3W A;  3S2V A;  4R2B A;  3O6H A;  4I8C A;  1SI1 A;  3T22 A;  5CC2 A;  1PB7 A;  5K2Y A;  3SDF A;  5H8Q A;  1P99 A;  2ZXT A;  4GL0 A;  5I57 B;  4MFI A;  2VD2 A;  2XXP A;  4JWY A;  4QF9 A;  1IXH A;  1UIV A;  1XHY A;  3DP8 A;  2OWS A;  3K1P A;  2NWJ A;  2Y84 A;  3SER A;  4WED A;  3VVF A;  4NWC A;  2F7A A;  1L5T A;  4H0W A;  2I49 A;  4H5F A;  2I58 A;  2A5S A;  3H6U A;  5CI5 A;  1QJM A;  4DCY A;  4F19 A;  1R1N A;  4DXU A;  3DP4 A;  1MDQ A;  3K6W A;  1A54 A;  1LFI A;  4R9F A;  2YJP A;  1XS5 A;  4WXJ A;  1URG A;  1MPB A;  2B3B A;  2QS4 A;  1BKA A;  1FQB A;  5CRY A;  5ELV A;  5AA2 B;  5BUU A;  1MY1 A;  1B3H A;  1XOC A;  5CBS A;  4R6Y A;  4ZEB A;  4PE5 B;  1USY E;  4OYV A;  1UTB B;  4G68 A;  5FHM A;  2DXR A;  5K2X A;  3O28 A;  5JK4 A;  5BWJ A;  1IIW A;  1QKB A;  3PUW E;  3QIM A;  1N0T A;  1OVT A;  1AOV A;  4DE8 A;  3MVX A;  5TU0 A;  2QMX A;  1ELJ A;  1B51 A;  3T66 A;  4F3P A;  3TQL A;  2REJ A;  3KJ7 A;  2Q2A A;  3K2D A;  3FAS A;  3I6V A;  2D5W A;  2XXH A;  3A09 A;  4H8J A;  3B6T A;  2HCA A;  2W7Y A;  2I3V A;  4PET A;  4R75 A;  3PMV A;  1R9Q A;  1DTG A;  3JYR A;  2UXA A;  2AL5 A;  3Q27 A;  2Q9T A;  2V3Q A;  1N7X A;  5KCJ A;  1A8F A;  1PB9 A;  1WVJ A;  1Z7N E;  2UVH A;  4HTG A;  4RXL A;  3RY3 A;  3VLW A;  3SEY A;  3UIF A;  4N07 A;  1P1U A;  2Y7I A;  4YZZ A;  3GLB A;  1PBQ A;  3SET A;  3EPE A;  1MXY A;  3N94 A;  5J1D A;  3N6U A;  3MZB A;  4QSD A;  3S9L C;  4F22 A;  5TP9 A;  5AA4 A;  4ESW A;  3K0V A;  4EQB A;  1EZP A;  4EXL A;  5I58 B;  5I59 B;  3FAT A;  3FVK A;  3WAF A;  2AL4 A;  1O7T A;  2GHB A;  3IAZ A;  1GTK A;  4PFU A;  1P1N A;  3FVN A;  3E3K A;  3KG2 A;  3U93 A;  5CBR A;  1VSO A;  2F5X A;  4UAC A;  3PUY E;  4NMY A;  3PUX E;  3OD7 A;  1UIU A;  2WKY A;  3C33 A;  3MP6 A;  5EYF A;  3T96 B;  3T9U A;  4F31 B;  1B6H A;  1LFH A;  2F34 A;  3FXU A;  1FTM A;  1FCK A;  1URD A;  2FYI A;  4JDF A;  4IGT A;  3PD9 A;  1Y9U A;  1MQD A;  1B5I A;  1QUK A;  1ZKB A;  2G93 A;  2XD3 A;  1Y3P A;  3KFM A;  3PUV E;  4G68 C;  4H5G A;  4IY5 A;  4KYD A;  3VXB A;  3VXC A;  4ZEC A;  3L6H A;  2Q2C A;  1NNP A;  1YTV A;  3MW0 A;  4GLI A;  4TOZ A;  4U1Z A;  1QVS A;  2ABH A;  3KOT A;  3OSQ A;  3QK6 A;  3RT6 B;  1HSL A;  2F6G A;  2XHD A;  3MPK A;  1M5D A;  3FJ7 A;  1QUL A;  4G8N A;  1D9Y A;  1MPC A;  4QFN A;  3LSW A;  4RYA A;  4U21 A;  3H3G A;  1BIY A;  3G3I A;  4QHQ A;  4U4S A;  3RUM A;  1UQW A;  2VHA A;  1N84 A;  1B3F A;  1H3D A;  5DVI A;  5HM4 B;  4FEB A;  1ZMG A;  4F18 A;  3IOU A;  3TTK A;  1POY 1;  3B7D A;  1M5F A;  2LAO A;  3EF7 A;  2XXX A;  4YB5 A;  4YAH X;  4BDR A;  1LBC A;  3CG1 A;  3WAE A;  1FQD A;  1B4Z A;  2DYX A;  3CFX A;  3FJG A;  3HHG A;  4H67 A;  3TTR A;  4U22 A;  4EF1 A;  3QUJ A;  1M5E A;  4IO3 A;  1DOT A;  1ZTY A;  1JNF A;  3CR9 A;  1Y4C A;  3IL1 B;  3K6U A;  4PQJ A;  1B1H A;  3ODB A;  4R2F A;  3TEL A;  1OQG A;  3O2A A;  5AA2 A;  5JEI A;  5DVF A;  3JV9 A;  1OIB A;  4EQ9 A;  1VR5 A;  3TTL A;  1SW4 A;  3MUQ A;  3VVE A;  4NF6 B;  4P0I A;  1B0H A;  2R71 A;  2RKM A;  1AH5 A;  2PMS A;  2F8D A;  3MC2 A;  1QUI A;  4Z0I A;  1FQF A;  3CVG A;  1GGG A;  4AQ4 A;  2UVI A;  5CM6 A;  3IJO B;  4QFK A;  3E13 X;  5FHO A;  3TEP A;  2A5T B;  1I6Q A;  3FXR A;  1SW2 A;  3H6V A;  3PV0 E;  5I2N B;  3G3H A;  4FAT A;  3VLV A;  3LSX A;  3FVG A;  4GQO A;  4YMB A;  2B65 A;  3K00 A;  1QW0 A;  3M8U A;  1MQG A;  4K3F A;  3BKI B;  3C34 A;  3Q28 A;  4KHZ E;  1CE2 A;  4IB2 A;  5CMC A;  4F2O A;  1H43 A;  1LCT A;  1B4H A;  3IK6 B;  1SDX A;  1H44 A;  1USY H;  4E0W A;  3OO6 A;  3TCG A;  5H8F A;  4LQ2 A;  3N5L A;  4WKM A;  3TOD A;  5KDT A;  3ZS6 A;  1DPE A;  3AXF A;  3MVZ A;  2XD2 A;  4NE4 A;  4GF8 A;  5KZT A;  2HXW A;  2XXT A;  2ZYN A;  1AL3 A;  4IO4 A;  4R9G A;  4R6K A;  4HCY A;  1Y20 A;  2FNC A;  2VP1 A;  2ONK E;  1Z7M E;  3IOW A;  3H6W A;  4NTL A;  3IO4 A;  4FEC A;  4OXV A;  1NMU A;  4ZS9 A;  5I59 A;  3O9P A;  3S4U A;  4XKN A;  1B3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...