1IITA

Glur0 ligand binding core complex with l-serine
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
226
structure length
221
Chain Sequence
GSAMALKVGVVGNPPFVFYGAFTGISLDVWRAVAESQKWNSEYVRQNSISAGITAVAEGELDILIGPISVTPERAAIEGITFTQPYFSSGIGLLIPGTATPLFRSVGDLKNKEVAVVRDTTAVDWANFYQADVRETNNLTAAITLLQKKQVEAVMFDRPALIYYTRQNPNLNLEVTEIRVSLEPYGFVLKENSPLQKTINVEMLNLLYSRVIAEFTERWLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Slr1257 protein
publication title Mechanisms for ligand binding to GluR0 ion channels: crystal structures of the glutamate and serine complexes and a closed apo state.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Membrane protein
total genus 69
structure length 221
sequence length 226
ec nomenclature
pdb deposition date 2001-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iitA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iitA02
4OFOA 4F18A 1JNFA 3IB0A 2DS9A 3FGSA 4NF8B 4F2OA 4PFUA 5KCJB 3OEMA 1QW0A 2V84A 3TZAA 1B0LA 3ILTB 2H25A 1A7LA 5H8QB 4IB2A 1QKBA 3TQWA 2P1SA 2RC7A 5AA3A 3B6TA 4LZ5A 1Y3QA 4ISUA 3T9HB 2Q8JA 1MXUA 3PUXE 3MVWA 2OJTA 1MXXA 4MLQA 4ND9A 4YU0A 3MAMA 4LATA 1SI0A 3DP6A 1LAFE 3T9VA 3FV2A 2F6GA 2ABHA 3TFLA 2DQVA 1MH3A 2HZLA 4YICA 5JK4A 4F1YA 2VGQA 3K4UA 4I8CA 3N26A 2DVCA 4WKMA 4E0XA 5ITOA 3K6XA 4MLVA 3PPOA 3C35A 3M8UA 4FJPA 4IO6A 1ZU0A 1PC3A 3RN8A 4ELQA 3ODBA 1URGA 1EH3A 2QMWA 1FTKA 1PBQA 2QSXA 4KFQA 3W9VA 3OMBA 1SBPA 4YMAA 1B5JA 3CI8A 3IOTA 2CMOA 1DTGA 1NH8A 3K1MA 2DYXA 1MXYA 3FV1A 1IXCA 4H8JA 3TUSA 3RY3A 2XXVA 1OIBA 5JTYA 3IO4A 1B3EA 1FQCA 2Q2CA 4N13A 2QPQA 3MZ9A 3PUVE 5I58B 3FJ7A 3IK6B 5H8NA 3PPPA 3TDJA 3TCFA 2VOZA 4FATA 3A3CA 3FJGA 1B58A 1MRPA 4QFLA 5BWJA 2F8DA 1AOVA 3K6WA 3S9NC 1FCKA 3VVDA 3HCQA 5DVJA 5CMCA 3MPKA 1ZJLA 1USYE 1A8FA 3FVGA 1R1NA 2I58A 1Y4CA 1GTKA 4R6HA 1B3GA 3O66A 4ZECA 2Q88A 3DP8A 1BTJA 4G68B 3T22A 1BIYA 4TLLB 1M5FA 2NVUB 5LOMA 5I57B 1JW4A 3LSWA 4G2ZA 1MPDA 3RTFB 4LZ7A 4RY1A 1MM6A 4UA8A 1J1NA 1VFDA 1ZIUA 2ONSA 4EDPA 1TT1A 5HM4B 2B3FA 2H4IA 3IO6A 4OEVA 4F39A 1JVXA 1B0HA 2OLBA 3R7XA 4BDLA 2RINA 5AA4A 4NWCA 4F3SA 1PBPA 2DVZA 1P1WA 1QUIA 3HHGA 4DXBA 1O7TA 2F7BA 4PETA 2G93A 2ZYNA 4JWXA 4BDMA 1TXFA 4XKPA 1ELJA 4UACA 2VHAA 2QS4A 3EHTA 4F22A 2OZZA 5H8FA 3FXRA 4X9TA 1N3XA 4H67A 2I49A 5CM6A 3HO7A 4LZ8A 3TTMA 2Q2AA 3O6GA 2X7PA 1D3KA 5I2NB 1LAHE 1US5A 3PD8A 5I56B 2B3BA 3OD7A 2F34A 3OSQA 4JDFA 3RPWA 4DZ1A 3KJ7A 4ECFA 4ZZEA 5AA2D 2O7UA 4BDQA 3CFLA 3SEWA 3O97A 4OMBA 4WEDA 1EZOA 1ZLQA 4THIA 2UXAA 4FIMA 4WEPA 2ANJA 4KCDA 4O3AA 3GBAA 1XHYA 4NF5B 4F29A 5HBCA 3CFXA 2REJA 4YKJA 4FE8A 3VVFA 2REGA 2I3WA 3JYRA 3OO9A 1OQHA 4HS7A 3MQ9A 4R9FA 3LSXA 5A5XA 2RCBA 3G3IA 4RK2A 3N6TA 1P99A 2XX8A 3DP4A 2PYYA 1LLSA 4XIGQ 3GXAA 4YZZA 1EZPA 1HSJA 1TWYA 2OK2A 3PD9A 2D5WA 1N7XA 5F1QA 1B52A 3GBBA 5AA2A 2R9JA 3L6HA 4BDOA 3G3KA 3RT8A 3KZGA 1MDQA 2ZYOA 3BFTA 2F97A 2F5XA 4BDNA 4DIGA 3VXCA 4NF6A 2A5TB 1M5EA 1A55A 3IJOB 1LFHA 1ZKBA 4LUBA 5AA1A 4RPNA 1H76A 1BLFA 1MQDA 4NEDA 5TP9A 2H98A 4LONB 4IGTA 1OVBA 5I84A 3CSGA 2G29A 3EPEA 3B6WA 2XXWA 2XXIA 3K02A 3IB1A 4DCYA 2RC9A 3Q25A 4GXAA 2DXRA 4FORA 3QXMA 2HAVA 2X26A 4POXA 4GFRA 1IITA 4P0IA 3FIRA 4H1XA 4G8MA 3D4CA 1SW2A 2IEEA 2ZXTA 1VFEA 4GQOA 2XXQA 2A5SA 1P1NA 2UYEA 2QMXA 4X48A 2ZYKA 5FTIA 4QF9A 2ZNUA 4ZS9A 5KDTB 1IZ1A 5EYFA 1B3HA 1OLAA 3C36A 2XXHA 3JZJA 4Q5TA 1SVXB 3BKIB 5B7DA 3OO6A 1NNTA 2Q89A 3I3VA 2Z8EA 2OWTA 1YTVA 2QS2A 1Y1MA 4R9GA 3ZSFA 2QL3A 3FVOA 3TTLA 5ICTA 3IAZA 4YB5A 4OEUA 2O6AA 4H5FA 1F9BA 4TOZA 3EQ1A 4R6KA 4H65A 3W9WA 1VE4A 3PUZE 1NNKA 1SD3A 2P2AA 2OBGA 3ONMA 1VR5A 1NNPA 2H5YA 2UYFA 1NNFA 3MJNA 1RYXA 3MW0A 3DM0A 2Z23A 1BKAA 3PV0E 3WAEA 4YAHX 2OCUA 1MG1A 3KFMA 4FEDA 1QVSA 4X1DA 3PU5A 5DT6A 2H9BA 1IXIA 2DE3A 5CRYA 1N7WA 3HSTA 4OXVA 1FW0A 1FQEA 2E1SA 4U1OA 3TPAA 1Y4TA 5DVIA 1M5CA 3BBRA 4IY5A 5FTHA 3EN3A 3OOAA 1MXZA 4EQ9A 3UGWA 4JB7A 1JQFA 3VVEA 2I3VA 3WAFA 3C4MA 5L9MA 2XXXA 5H8HB 4JSOA 1AIVA 3VDFA 4OFJA 1FTMA 1XS5A 5J1DA 3FD3A 4HCWA 1DSNA 2HCAA 3EHSA 3S9MC 1SYIA 2ZMBA 1S7YA 3TQLA 5I59A 5DVFA 3IOVA 1SYHA 1GV8A 1LCFA 2XD3A 2HZKA 4RPOA 5DEXA 1D9VA 3L6GA 4L17A 4YKPA 4H5GA 5KZTA 4H6DA 1FQBA 4ZE8A 3VE1B 5TU0A 3U94A 4E0WA 4GOTA 3MWBA 4N07A 1MH4A 3PPRA 4F19A 2ONKE 3UA8A 2ONRA 4MBPA 3HPIA 5F7VA 4ZDMA 1ANFA 1UTBB 3S9EA 4IO5A 2R6GE 3PPNA 1IXGA 2ZNTA 4JXIA 3P7IA 1UQWA 4FEBA 4KPTA 2F35A 1B32A 2RCAA 4C1UA 5EHSA 4NF8A 2F7AA 4ELOA 1YCJA 3K0VA 2O68A 2RKMA 5KCJA 2V3QA 3TCHA 2UVIA 1DTZA 1IQ7A 4GIZA 1USYH 2I6EA 4QSCA 4NTLA 4TLMB 1H43A 5H8QA 1JEVA 4U4SA 1B9JA 2HFBA 2PT2A 3C32A 2F7CA 4U4XA 2Y7WA 2V93A 3FXQA 3BFUA 1Z7ME 3DELB 3SDFA 3U8QA 1SW1A 5IAIA 1B1XA 4IO3A 2GHAA 1B46A 3B7DA 2ESNA 4PQJA 1UTHB 1I6BA 1MPCA 3F11A 3EF7A 1MY1A 1OLCA 3KEIA 4ZEBA 1LAXA 1QKAA 3ZS6A 2QS1A 4OQOA 3V8XB 5TP9B 2V25A 3KN7A 2FYIA 1MY0A 3AXFA 2I48A 3Q29A 2XXYA 1RYOA 4GRKA 2O51A 1LGBC 5ELVA 1MY4A 1SI1A 2PBWA 5K2YA 1XVYA 3KJTA 4OHNA 2RF1A 3TMGA 3CIJA 1B6HA 3T96B 4OWDA 4R2FA 1NFTA 4QSDA 2DE4A 5AE4A 4IO4A 3SKPA 4U2RA 3KOSA 3SEXA 4RJZA 4ELRA 4PP0A 2PMSA 4QFPA 4GF8A 3A3UA 1MXWA 1R9QA 1POY1 2FNCA 1OMPA 1T0KA 5I58A 2F78A 3QYTA 1CB6A 4XXUA 3FVNA 2NWJA 4GL8A 4OENA 4P11A 3THIA 3HV1A 3DLNA 3D4GA 3MP1A 3PPQA 2IA4A 2M8CA 1P1QA 3G3GA 3FUZA 3M3KA 5FHNA 3H6WA 4PE5B 3H06B 3PMWA 1GGGA 4KI0E 5BUUA 5FHOA 3MVYA 1LCTA 5L8DA 3VLUA 4NF4B 1URSA 2THIA 3C9HA 3RUMA 1AL3A 4KYDA 3MUQA 1XC1A 4I1DA 2QS3A 1UIVA 4KQPA 4ELPA 4F1VA 2GHBA 1UIUA 3K2DA 4XKNA 5EHMA 3I6VA 1B2HA 4EF1A 5I2KB 4G68A 1ATGA 2UVHA 1LBBA 4LQ5A 1B4ZA 5JEIA 3IL1B 2PX1A 2F36A 3HN0A 5I57A 5M2VA 3FJMA 1XOCA 1Q35A 2AL4A 1LFGA 3IORA 5CBRA 1D9YA 3K1PA 3TELA 1GR2A 5B70A 4EXLA 2VP1A 1BP5A 3TODA 4IO7A 2FA7A 2R71A 4PFYA 1H45A 3QUFA 2E0SA 3TEPA 1HSEA 2O84X 4DXUA 4EUOA 3UK4A 3SEYA 3KSJA 1B05A 1PB8A 3FXUA 4DDDA 4LA9A 4KYEA 3OO7A 1B3LA 3N94A 1AMFA 4Z0IA 3PMXA 1B1HA 1R6ZA 2Y7PA 1OQGA 4F3BA 4LVQA 5ISUA 3RQTA 1NKXA 3LSLA 4DCXA 1SDXA 4F1UA 3CRBA 2DWIA 4HW8A 4C1TA 4OERA 1B3FA 2VD2A 1LFIA 4QSEA 3H6UA 1WODA 3KGCA 1LB8A 5I56A 1O64A 4F3GA 2Y7RA 4R73A 2DWJA 5HPQA 4RYAA 1QJMA 1JW1A 1EU8A 1FTOA 1MY3A 3U92A 3FZVA 3E13X 3B6QA 1B40A 1M5DA 2HEUA 3O6IA 2DE2A 3T9UA 3MVXA 1PB7A 1B5IA 4NF5A 1TFDA 4ZE9A 5JTYB 3CG1A 3OXNA 5CMBA 5TPAA 4AB5A 1R9LA 4U22A 3G3FA 1MY2A 2DXYA 3V83A 4OTEA 3FVKA 4YB7A 3UIFA 3U1OA 3C33A 5H8NB 1B7HA 1RKMA 1ZMGA 5H8SA 3K01A 3QIMA 1FQDA 1FQAA 3Q26A 3U72A 3ZKLA 4YMBA 2OWSA 1MS7A 4EQBA 2H99A 3KN3A 4F31B 3H03A 2V3TA 4YKIA 1NMUA 3FATA 4ZEKA 3O6HA 3K6UA 4PFWA 2A5TA 1DOTA 1IEJA 5L9SA 3OEKA 4WXJA 3ZKKA 4PFTA 3O9PA 1O63A 2XHDA 1P1UA 3V5AA 1ZTYA 2DSFA 3A09A 1B7UA 2UVJA 4AB6A 3S4UA 1DPEA 4M1VA 2NOOA 3I5OA 3KN8A 3PUWE 2GH9A 4IY6A 3QK6A 2PT1A 4ZEFA 1L5TA 3TTNA 4LQ2A 1VSOA 2Y7IA 3GLBA 1SW5A 5ICQA 1QUKA 4EF2A 1S9TA 3G3HA 5CBSA 5AA4B 3SETA 3OSRA 1IUDA 1US4A 3O29A 1QUJA 1MQIA 3GZGA 4GXSB 4TQUQ 1FTLA 3S2VA 5H8FB 1JVYA 3MC2A 2B65A 3IB2A 3MPLA 3CR9A 5DTBA 3O2AA 4RK9A 4QFKA 4OFLA 4M4GA 3VLVA 4U21A 3VLWA 3OO8A 2V3UA 4KR5A 1YAEA 1POTA 4QRZA 3TTRA 4ESWA 5KDTA 1Y3NA 1I69A 3O28A 3RNNA 4N6PA 3H7MA 4H8IA 3EHUA 2GRVA 3C34A 2Z8DA 1HSLA 3K6VA 4MH5A 1Q1KA 1FQFA 3T66A 3RGYA 3RT6B 4AQ4A 2P0SA 4BDRA 1B7ZA 3Q27A 3K1NA 1Y1ZA 4YB6A 1XVXA 3VFJA 4JWYA 4BLAA 3LUYA 4R74A 3OELA 3TTKA 3E4RA 2I4BA 2Y84A 4F2QA 1A99A 5FHMA 3PGFA 3IOWA 4F3PA 3H3GA 3MBPA 2AL5A 4JSDA 3H6VA 5L9OA 1Z7NE 5A5XB 4RA1A 4RXLA 3UP9A 2O1LA 4I9DA 1FTJA 3G3JA 4P0GA 2NUVA 2XX7A 1N0TA 4HCYA 4POWA 3LSFB 3VXBA 2XXRA 1H44A 4OYVA 4ZEDA 2ZNSA 3IR1A 4ZEIA 3MZ1A 2PVUA 4JBZA 4MFIA 5DYHA 1XT8A 1MM7A 3R6UA 5AA2B 4FAJA 3OENA 4IGRA 3E3KA 1B5HA 1B51A 1B4HA 3RLFE 4NF6B 1YPNA 2I0CA 3FASA 4KD5A 3CG3A 2Z22A 1URDA 5K2XA 4GWOA 1N84A 4NMYA 4OVJA 3U93A 3TAJA 2O69A 4QFNA 2NXOA 4R75A 4OETA 2RC8A 3N5LA 4GVOA 1EZ9A 5H8HA 3ECRA 3T9XB 2HQ0A 1Y20A 4O3CA 3TCGA 2O1MA 4EXKA 3USDA 1SW4A 2QJEA 4Q0CA 1LB9A 3JV9A 4R72A 3E9XA 2Q9TA 2HXWA 2XX9A 1NL5A 2DWAA 3ILUB 4OZ9A 2Y7KA 1GVCA 4FECA 1N3WA 1PB9A 1ZBMA 5CMKA 1MQGA 1N76A 1PDAA 3N6UA 1MDP1 3C31A 4ESXA 1A40A 3LBSA 2I0BA 1DPPA 4HTGA 4IO2A 3K00A 1A8EA 3UN6A 3SEUA 2XD2A 3H4ZA 3R26A 4K3FA 4KHZE 2YJPA 1UTBA 4XTCQ 4OESA 1MPBA 1MQJA 3IX1A 5TPAB 3TKDA 1QULA 2DWHA 3MP8A 1A54A 2CZLA 3CVGA 3KSXA 1WDNA 3PUYE 3S9LC 3SEVA 3G7WA 1KWHA 1NH7A 2BJJX 4QHQA 1TFAA 4G4PA 1JW5A 1Y9UA 1DMBA 2VD3A 1I6AA 1OVTA 4MF3A 3QAXA 1AH5A 4XKRA 4NE4A 1SQYA 4R2BA 4H0WA 2O7IA 3W15C 4YKKA 4X1BA 2F6PA 3MZBA 2ZYMA 3QUJA 1UTHA 3CFZA 4G8HA 2ALUA 2DOJA 4LP2B 2WKYA 2D21A 1JEUA 4R6YA 4Z7EA 4RNSA 4Q8RA 2Z8FA 1IXHA 1PEBA 4G77A 3KOTA 2YPNA 4G8NA 3CSBA 1LAGE 3IOUA 4GD5A 4Q30B 4ZZAA 3UORA 5IKBA 2UVGA 1S50A 3SESA 2W7YA 2HAUA 4XKQA 1IIWA 4G68C 3VV5A 3IJXB 5I2NA 2XXPA 2LAOA 4DLDA 1N04A 4DXCA 5CC2A 3LC8A 3LR1A 4DE8A 1I6QA 4EQ7A 3Q28A 5CMMA 1M5BA 2AYSA 1WVJA 1CE2A 4GL0A 3RTWB 1JETA 2XXTA 3KG2A 2D3IA 5I59B 2AIXA 1H3DA 4QFOA 3KBRA 4C0RA 4KYSA 5DEXB 2QRYA 4U23A 4KCCA 3M3FA 1LBCA 1Y3PA 2GFEA 1MQHA 3TYHA 4NF4A 2DP8A 3PMVA 3MP6A 4U1ZA 3V89B 5ITPA 1D4NA 3QSLA 3M3LA 4I62A 3H6TA 4GLIA 2KLFA 4ONYA 1LSTA 2YLNA 4JWOA 4NWDA 2XXUA 4O3BA 1P1OA 3HHFA 3SERA 5CI5A 3MVZA 1MXVA 1II5A 2X7QA 5I2KA 2I4CA 3T93B
chains in the Genus database with same CATH superfamily
4OFOA 4F18A 1JNFA 3IB0A 2DS9A 3FGSA 3SZPA 4NF8B 4F2OA 4PFUA 5KCJB 3OEMA 5I5PA 1QW0A 2V84A 3TZAA 1IMEA 1B0LA 3ILTB 1CNQA 2H25A 1A7LA 5H8QB 5IGAA 4IB2A 1QKBA 3TQWA 2P1SA 2RC7A 5AA3A 3B6TA 4LZ5A 1Y3QA 1LBWA 4ISUA 3T9HB 2Q8JA 1MXUA 2P3VA 3PUXE 3MVWA 2OJTA 1MXXA 4MLQA 4ND9A 4YU0A 3MAMA 4LATA 1LBZA 1SI0A 3DP6A 1LAFE 1Q9DA 1G0IA 4GX3A 3T9VA 3FV2A 2F6GA 2ABHA 1FPGA 3TFLA 2DQVA 1MH3A 2HZLA 4YICA 5JK4A 4F1YA 2VGQA 3K4UA 4I8CA 3N26A 2DVCA 4WKMA 4E0XA 5ITOA 3K6XA 4MLVA 3PPOA 3C35A 3M8UA 4FJPA 4IO6A 1NV6A 1ZU0A 4PFBA 4QXDA 1PC3A 3RN8A 4ELQA 3ODBA 1URGA 1EH3A 2QMWA 1FTKA 1AWBA 1PBQA 2QSXA 4KFQA 3W9VA 3OMBA 1SBPA 4YMAA 1B5JA 3CI8A 3IOTA 2CMOA 1FTAA 1DTGA 1NH8A 3K1MA 4PBHA 2DYXA 1MXYA 2R8TA 3FV1A 1IXCA 4H8JA 3TUSA 3RY3A 2XXVA 1OIBA 3FXBA 5JTYA 5IZZA 3IO4A 1B3EA 1FQCA 2Q2CA 2FBPA 4N13A 2QPQA 3MZ9A 3PUVE 4PBQA 5I58B 3FJ7A 3IK6B 5H8NA 4PAKA 3PPPA 3TDJA 1FRPA 3TCFA 2VOZA 4FATA 3A3CA 3FJGA 1NV5A 1B58A 1MRPA 4QFLA 5BWJA 2F8DA 3MSTA 1AOVA 1YYZA 3K6WA 3S9NC 1FCKA 3VVDA 3HCQA 5DVJA 5CMCA 3MPKA 1ZJLA 1USYE 2QVRA 1A8FA 2B4LA 3FVGA 1R1NA 2I58A 4OA4A 1Y4CA 1GTKA 2BJIA 3PTYA 1B3GA 3O66A 4R6HA 4ZECA 2Q88A 3DP8A 1BTJA 4G68B 3T22A 1BIYA 4TLLB 1M5FA 2NVUB 5LOMA 5I57B 1JW4A 3LSWA 4G2ZA 1MPDA 3ROJA 3RTFB 4LZ7A 4O94A 4RY1A 1MM6A 4UA8A 1J1NA 1VFDA 1ZIUA 2ONSA 4EDPA 1TT1A 5HM4B 2B3FA 2QVUA 2CZKA 2H4IA 3IO6A 4XF5A 4OEVA 4F39A 1JVXA 5EQ9A 1B0HA 2OLBA 3R7XA 4I3YA 4BDLA 2RINA 5AA4A 4NWCA 4F3SA 1PBPA 2DVZA 4P1EA 1P1WA 4XFEA 1QUIA 3HHGA 4DXBA 2Y5LA 2VPOA 1O7TA 2F7BA 4PETA 2G93A 2ZYNA 4JWXA 4BDMA 1TXFA 4XKPA 1ELJA 4UACA 2VHAA 2QS4A 3EHTA 4N6KA 2OZZA 4F22A 5H8FA 1LBXA 3FXRA 4X9TA 1N3XA 4H67A 2I49A 5CM6A 3HO7A 4LZ8A 4AS5A 3TTMA 2Q2AA 3O6GA 2WEFA 2X7PA 1D3KA 5I2NB 1LAHE 1US5A 3PD8A 5I56B 2B3BA 3OD7A 5EYGA 2F34A 3OSQA 4JDFA 3RPWA 4DZ1A 3KJ7A 4ECFA 4ZZEA 5AA2D 2O7UA 3RPLB 4BDQA 3CFLA 3SEWA 3O97A 4OMBA 4WEDA 4N17A 1EZOA 1ZLQA 4THIA 2UXAA 4FIMA 4WEPA 2ANJA 4KCDA 4O3AA 2CEXA 3GBAA 1XHYA 4NF5B 4F29A 5HBCA 4HXVA 3CFXA 2REJA 4YKJA 4H45A 4FE8A 3VVFA 2REGA 2I3WA 3JYRA 4PC9A 2WYPA 3OO9A 4GX4A 1OQHA 4O8MA 4HS7A 3MQ9A 4R9FA 2MKZA 3NOHA 3LSXA 5A5XA 2RCBA 3G3IA 4NN3A 4RK2A 3N6TA 1P99A 2XX8A 3DP4A 2PYYA 1LLSA 4XIGQ 3GXAA 4YZZA 1EZPA 1HSJA 1TWYA 2OK2A 3PD9A 5EQ7A 2D5WA 1N7XA 5F1QA 1B52A 4P47A 1LEVA 3GBBA 5AA2A 2R9JA 3L6HA 4BDOA 3G3KA 3RT8A 3KZGA 1MDQA 2ZYOA 3BFTA 2F97A 2F5XA 4BDNA 4DIGA 3VXCA 4NF6A 2A5TB 4O7MA 1M5EA 1A55A 3IJOB 2XWIA 1LFHA 1ZKBA 4LUBA 5AA1A 4RPNA 1H76A 3E79A 1RDZA 1BLFA 1MQDA 4NEDA 5TP9A 2H98A 4LONB 4IGTA 1OVBA 2PCRA 5I84A 3CSGA 2G29A 1FBHA 3EPEA 4PAIA 3GYYA 4N8GA 3B6WA 4UABA 2XXWA 1NV4A 4MIJA 2XXIA 1IMCA 3K02A 3IB1A 4DCYA 2RC9A 1QGXA 3Q25A 4GWSA 4GXAA 2DXRA 4FORA 1FPFA 3QXMA 2HAVA 2X26A 4POXA 4GFRA 5I3SA 4OVRA 1IITA 4P0IA 3FIRA 4H1XA 1FPBA 4G8MA 4LN5A 3D4CA 1SW2A 2OX3A 2IEEA 2ZXTA 1VFEA 1KA1A 4GQOA 2XXQA 2A5SA 1P1NA 2UYEA 1FBPA 2V4CA 2QMXA 4X48A 2ZYKA 5FTIA 4QF9A 3QMFA 4P8BA 2HHMA 1KZ8A 2ZNUA 4ZS9A 5KDTB 5EYHA 1IZ1A 1SPIA 4DI3D 5EYFA 1B3HA 4PF8A 1OLAA 3C36A 2XXHA 3JZJA 4Q5TA 3KC1A 1SVXB 3BKIB 5B7DA 3OO6A 1NNTA 4GWWA 2Q89A 3I3VA 2Z8EA 2OWTA 1YTVA 2QS2A 4AS4A 1Y1MA 4R9GA 3ZSFA 2CZIA 2QL3A 3FVOA 3TTLA 5ICTA 3IAZA 4YB5A 4OEUA 2O6AA 4H5FA 1F9BA 4TOZA 3EQ1A 4R6KA 4H65A 3W9WA 1VE4A 3PUZE 1NNKA 1SD3A 3LUZA 2P2AA 2OBGA 3ONMA 1VR5A 1NNPA 3BIHA 2H5YA 1FSAA 2UYFA 1NNFA 4HE2A 3MJNA 1RYXA 2WBBA 3MW0A 3DM0A 4NAPA 4N4UA 2Z23A 2L5VA 1BKAA 3PV0E 3WAEA 4YAHX 2OCUA 1MG1A 3KFMA 4FEDA 1QVSA 4X1DA 1DK4A 3PU5A 5DT6A 2H9BA 1IXIA 2DE3A 5CRYA 1N7WA 3HSTA 4OXVA 1FW0A 1FQEA 2E1SA 5IZ3A 4U1OA 3TPAA 1Y4TA 2FIEA 5DVIA 1M5CA 3BBRA 4IY5A 5FTHA 3EN3A 3OOAA 1MXZA 4EQ9A 3UGWA 4JB7A 1JQFA 3VVEA 2I3VA 3WAFA 3C4MA 5L9MA 3CHGA 2XXXA 5H8HB 4JSOA 3A29A 1AIVA 3VDFA 1NUXA 4OFJA 1FTMA 1XS5A 5J1DA 3FD3A 4HCWA 1DSNA 2HCAA 3EHSA 3S9MC 1SYIA 2ZMBA 2KQZA 1S7YA 3TQLA 5I59A 5DVFA 3IOVA 1SYHA 1GV8A 3ISPA 1LCFA 2XD3A 2HZKA 4I40A 4RPOA 5DEXA 1D9VA 5T3JA 2XWVA 3L6GA 4L17A 4YKPA 4H5GA 5KZTA 4H6DA 1FQBA 4ZE8A 3VE1B 5TU0A 3U94A 4GOTA 4E0WA 3MWBA 4N07A 1MH4A 3PPRA 4F19A 4I3EA 2ONKE 3UA8A 2ONRA 4MBPA 3HPIA 5F7VA 2XXKA 4ZDMA 1ANFA 2FVZA 1UTBB 3S9EA 4IO5A 2R6GE 1BK4A 3PPNA 1IXGA 2VT5A 4MHFA 2ZNTA 4JXIA 3P7IA 1FPLA 1UQWA 4FEBA 4KPTA 2F35A 1B32A 2RCAA 3EKIA 4C1UA 5EHSA 4NF8A 2F7AA 5ET8A 4ELOA 1YCJA 3K0VA 2O68A 2RKMA 4OVSA 5KCJA 2V3QA 1NV1A 3TCHA 2UVIA 1DTZA 1IQ7A 4GIZA 1USYH 2I6EA 4QSCA 4NTLA 4TLMB 1H43A 5H8QA 1JEVA 4U4SA 1B9JA 2HFBA 2QVVA 2PT2A 3C32A 2F7CA 4U4XA 2Y7WA 2V93A 3FXQA 3BFUA 1Z7ME 3DELB 1FBEA 3SDFA 3U8QA 1SW1A 5IAIA 1B1XA 4IO3A 2GHAA 1B46A 1INPA 3B7DA 2ESNA 4PQJA 1UTHB 1I6BA 1MPCA 3F11A 3EF7A 1MY1A 4N91A 1OLCA 3KEIA 5ET6A 4ZEBA 1LAXA 1QKAA 3ZS6A 2QS1A 4OQOA 3V8XB 5TP9B 2V25A 3KN7A 2FYIA 4MCOA 4DI4B 3BIGA 1MY0A 3AXFA 2I48A 3Q29A 2XXYA 1RYOA 4GRKA 2O51A 1LGBC 5ELVA 1MY4A 1SI1A 2PBWA 5K2YA 5F24A 1XVYA 4MJOA 3KJTA 4OHNA 2RF1A 3TMGA 3CIJA 1B6HA 3T96B 4OWDA 4R2FA 1NFTA 4QSDA 2DE4A 2ZZWA 5AE4A 4IO4A 3SKPA 4U2RA 3KOSA 4MNIA 5EQAA 3SEXA 4RJZA 1G0HA 4PGPA 4ELRA 4PAFA 4PP0A 2PMSA 4QFPA 4GF8A 3A3UA 1MXWA 1YZ0A 1R9QA 1POY1 1NV0A 2FNCA 1OMPA 1T0KA 5I58A 2F78A 3QYTA 1CB6A 4XXUA 3FVNA 2NWJA 4GL8A 2CZHA 4OENA 4P11A 3THIA 3HV1A 3DLNA 3D4GA 3MP1A 3PPQA 2IA4A 2M8CA 1P1QA 3G3GA 3FUZA 3M3KA 5FHNA 3H6WA 4PE5B 2P3NA 3H06B 3PMWA 1GGGA 4KI0E 1DBZA 5BUUA 3T0JA 5FHOA 3MVYA 1LCTA 5L8DA 3VLUA 4NF4B 2XWKA 1K9YA 1URSA 2THIA 4MAGA 3C9HA 3RUMA 1AL3A 4KYDA 3MUQA 1XC1A 4I1DA 2QS3A 1UIVA 3KC0A 4KQPA 4ELPA 4F1VA 2GHBA 4HE0A 1UIUA 4O7IA 3K2DA 4XKNA 5EHMA 1FJ6A 3I6VA 1B2HA 4MMPA 4EF1A 5I2KB 1EYKA 4G68A 1ATGA 2UVHA 1LBBA 1FBCA 4LQ5A 1B4ZA 5JEIA 3IL1B 2PX1A 2F36A 4NG7A 3HN0A 5I57A 1FBGA 5M2VA 3FJMA 1XOCA 4KXPA 1Q35A 2AL4A 1LFGA 3IORA 5CBRA 1D9YA 3K1PA 3TELA 1GR2A 1NUZA 5B70A 4EXLA 2Q8MA 3E78A 2VP1A 1BP5A 3TODA 4PF6A 4IO7A 5A5LA 2FA7A 2R71A 4PFYA 1H45A 3QUFA 2E0SA 4NX1A 3TEPA 1HSEA 2O84X 2HXRA 4DXUA 4EUOA 3UK4A 2WBDA 3SEYA 3KSJA 1B05A 1PB8A 3FXUA 4DDDA 4LA9A 4KYEA 4OVQA 3OO7A 1B3LA 3N94A 3KBZA 1AMFA 4Z0IA 3PMXA 4XEQA 1B1HA 1R6ZA 2Y7PA 1OQGA 4F3BA 4LVQA 5ISUA 3RQTA 4NGUA 1NKXA 3LSLA 2WX9A 4DCXA 1SDXA 2WYKA 4F1UA 3CRBA 2DWIA 4HW8A 2PFZA 4C1TA 1FJ9A 4OERA 1B3FA 2VD2A 1LFIA 4QSEA 3H6UA 1FPDA 1WODA 3KGCA 1LB8A 5I56A 1KA0A 1O64A 3T1BA 3HFUA 5ET7A 4MX6A 4F3GA 2Y7RA 4MEVA 4R73A 1RDYA 2DWJA 5HPQA 4RYAA 1JP4A 1QJMA 3RPLA 1JW1A 1EU8A 1FTOA 4N8YA 4JVCA 1MY3A 3U92A 3FZVA 3E13X 3B6QA 1B40A 1M5DA 2HEUA 3O6IA 2DE2A 3T9UA 3MVXA 1PB7A 1B5IA 1VDWA 4NF5A 1TFDA 4ZE9A 4N6DA 5JTYB 3CG1A 3OXNA 5CMBA 5TPAA 4AB5A 1R9LA 2DDKA 4U22A 3G3FA 5LDZA 1MY2A 2DXYA 3V83A 4OTEA 3FVKA 4YB7A 3UIFA 3U1OA 3C33A 5H8NB 1B7HA 1RKMA 1ZMGA 5H8SA 3K01A 3QIMA 1FQDA 1FQAA 3Q26A 4NHBA 3U72A 2PFYA 3ZKLA 1FPIA 4YMBA 2OWSA 1MS7A 4EQBA 2H99A 3B8BA 3KN3A 4F31B 2FIXA 3H03A 2V3TA 4YKIA 1NMUA 3FATA 4ZEKA 4NQ8A 3O6HA 3K6UA 2F3DA 4PFWA 2A5TA 1DOTA 1IEJA 5L9SA 3OEKA 4WXJA 3ZKKA 1IMBA 4PFTA 3O9PA 1O63A 2XHDA 1P1UA 3V5AA 1ZTYA 4PGNA 2DSFA 3A09A 1B7UA 2UVJA 4AB6A 3S4UA 1DPEA 4M1VA 2XA5A 4PCDA 2NOOA 3I5OA 3KN8A 3PUWE 2GH9A 4IY6A 3QK6A 2PT1A 4ZEFA 1L5TA 3TTNA 2ZZXA 4PFRA 4LQ2A 1VSOA 2Y7IA 2CEYA 3GLBA 1SW5A 4MNPA 1IMAA 5ICQA 1QUKA 4EF2A 1S9TA 3G3HA 5CBSA 5AA4B 4H46A 3SETA 3OSRA 1IUDA 1US4A 3O29A 2XWOA 1QUJA 1MQIA 3GZGA 4GXSB 4TQUQ 5I7IA 1FTLA 2B4MA 5H8FB 3S2VA 1JVYA 3MC2A 2B65A 3IB2A 3MPLA 2ZZVA 1LBYA 1IMDA 3CR9A 5DTBA 3O2AA 4RK9A 4QFKA 4OFLA 1RDXA 4M4GA 3VLVA 4U21A 1NV3A 3OO8A 3VLWA 2V3UA 3U65A 4KR5A 1YAEA 5ESYA 1POTA 4QRZA 3TTRA 4ESWA 1EYIA 5KDTA 1NUYA 5DW8A 1FPJA 1Y3NA 1XI6A 1I69A 3O28A 3RNNA 4N6PA 3H7MA 4H8IA 3EHUA 2GRVA 3C34A 5IZ1A 2Z8DA 1HSLA 4OVTA 3K6VA 4MH5A 1Q1KA 1FQFA 1NI9A 3T66A 3RGYA 3RT6B 4AQ4A 2P0SA 4BDRA 1FPKA 1B7ZA 3Q27A 3K1NA 1Y1ZA 4YB6A 1XVXA 3VFJA 4JWYA 4BLAA 3LUYA 4R74A 3OELA 3TTKA 3E4RA 2I4BA 2Y84A 4F2QA 1A99A 5FHMA 1K9ZA 3PGFA 3IOWA 4F3PA 3H3GA 3MBPA 1D9QA 2AL5A 4PDHA 4JSDA 3H6VA 5L9OA 1Z7NE 5A5XB 4RA1A 4RXLA 3UP9A 2O1LA 4I9DA 1FTJA 3G3JA 4P0GA 2NUVA 2XX7A 1N0TA 4HCYA 4POWA 3LSFB 3VXBA 2XXRA 1H44A 4OYVA 3IFCA 4ZEDA 2ZNSA 3IR1A 4ZEIA 3MZ1A 4GWXA 2PVUA 4JBZA 4MFIA 5DYHA 1XT8A 1MM7A 3R6UA 5AA2B 4FAJA 3OENA 4IGRA 2FHYA 3E3KA 4JVDA 1B5HA 4NF0A 1B51A 1B4HA 3RLFE 2QFLA 5EQ8A 4NF6B 1YPNA 3D1RA 2I0CA 3FASA 4KD5A 3CG3A 2Z22A 1URDA 5K2XA 4GWOA 1N84A 4NMYA 4OVJA 3U93A 3TAJA 2O69A 4QFNA 2NXOA 4QBAA 4R75A 4OETA 1EYJA 2JJKA 2RC8A 3N5LA 4GVOA 4JVIA 4P1LA 1EZ9A 5H8HA 3ECRA 3T9XB 2HQ0A 1Y20A 4OVPA 4O3CA 4HE1A 3TCGA 2O1MA 4EXKA 3USDA 1SW4A 2QJEA 4Q0CA 1LB9A 3JV9A 4R72A 2GQ1A 3E9XA 2Q9TA 2HXWA 2XX9A 4GBWA 1NL5A 2DWAA 3ILUB 4IR8A 4OANA 4P3LA 4OZ9A 2Y7KA 3RYDA 1GVCA 4FECA 1N3WA 1PB9A 1ZBMA 5CMKA 1MQGA 1N76A 1PDAA 3N6UA 1MDP1 3C31A 4PFIA 4ESXA 1A40A 2Y5KA 3LBSA 2I0BA 1DPPA 4HTGA 4IO2A 3K00A 1A8EA 3UN6A 5J16A 4P9KA 3SEUA 2XD2A 3H4ZA 3R26A 4N15A 4K3FA 4KHZE 5ET5A 2YJPA 1UTBA 4XTCQ 4OESA 1MPBA 1MQJA 3IX1A 5TPAB 3TKDA 1QULA 2DWHA 3MP8A 4GBVA 3LV0A 1A54A 2CZLA 3CVGA 3KSXA 1WDNA 3PUYE 3S9LC 3SEVA 3G7WA 1KWHA 1NH7A 2BJJX 4QHQA 1TFAA 4G4PA 4GWZA 1JW5A 1Y9UA 1DMBA 2VPNA 2VD3A 1I6AA 1OVTA 3B50A 4MF3A 3QAXA 1FBFA 1AH5A 4XKRA 4GWYA 4NE4A 1SQYA 4R2BA 4H0WA 1NV2A 2O7IA 4X04A 3W15C 4PDDA 4YKKA 4X1BA 2F6PA 3MZBA 2ZYMA 3QUJA 1UTHA 3CFZA 4G8HA 2ALUA 2DOJA 4LP2B 2WKYA 2D21A 1JEUA 4R6YA 1LBVA 4Z7EA 4RNSA 5FBPA 4PE3A 4Q8RA 2Z8FA 1IXHA 1PEBA 4G77A 3KOTA 2YPNA 4G8NA 3CSBA 1FPEA 1LAGE 1YXIA 3IOUA 4GD5A 4Q30B 5IZ3B 4ZZAA 3UORA 5IKBA 2UVGA 1S50A 3SESA 2W7YA 2HAUA 4XKQA 1IIWA 4G68C 3IFAA 3VV5A 3IJXB 5I2NA 2XXPA 2LAOA 4DLDA 1N04A 4DXCA 5CC2A 3LC8A 3LR1A 4DE8A 1I6QA 4EQ7A 3Q28A 4P56A 2KR0A 1NV7A 5LTCA 5CMMA 1M5BA 2AYSA 1WVJA 1CE2A 3FBPA 4G61A 4GL0A 3RTWB 1JETA 2XXTA 4PTKA 3KG2A 2D3IA 5I59B 2F3BA 2AIXA 1H3DA 4QFOA 3KBRA 4C0RA 4KYSA 5DEXB 2QRYA 4U23A 1DCUA 4KCCA 3M3FA 1LBCA 1Y3PA 4GWUA 2GFEA 4MNCA 4X8RA 1MQHA 4N81A 3TYHA 4NF4A 2DP8A 3PMVA 3MP6A 4U1ZA 1FBDA 3V89B 5ITPA 1D4NA 3QSLA 3M3LA 4I62A 2HPGA 3H6TA 4GLIA 2KLFA 4ONYA 1LSTA 2YLNA 4JWOA 4NWDA 2XXUA 4O3BA 4GX6A 2Q74A 1P1OA 3HHFA 3SERA 5CI5A 3MVZA 1MXVA 4FBPA 1II5A 2X7QA 2OWZA 1IMFA 1NUWA 5I2KA 5IM2A 2I4CA 3MYUA 3T93B
chains in the Genus database with same CATH topology
4OFOA 4F18A 1JNFA 3IB0A 2DS9A 3FGSA 4NF8B 4F2OA 4PFUA 5KCJB 3OEMA 1QW0A 2V84A 3TZAA 1B0LA 3ILTB 2H25A 1A7LA 5H8QB 4IB2A 1QKBA 3TQWA 2P1SA 2RC7A 5AA3A 3B6TA 4LZ5A 1Y3QA 4ISUA 3T9HB 2Q8JA 1MXUA 3PUXE 3MVWA 2OJTA 1MXXA 4MLQA 4ND9A 4YU0A 3MAMA 4LATA 1SI0A 3DP6A 1LAFE 3T9VA 3FV2A 2F6GA 2ABHA 3TFLA 2DQVA 1MH3A 2HZLA 4YICA 5JK4A 4F1YA 2VGQA 3K4UA 4I8CA 3N26A 2DVCA 4WKMA 4E0XA 5ITOA 3K6XA 4MLVA 3PPOA 3C35A 3M8UA 4FJPA 4IO6A 1ZU0A 1PC3A 3RN8A 4ELQA 3ODBA 1URGA 1EH3A 2QMWA 1FTKA 1PBQA 2QSXA 4KFQA 3W9VA 3OMBA 1SBPA 4YMAA 1B5JA 3CI8A 3IOTA 2CMOA 1DTGA 1NH8A 3K1MA 2DYXA 1MXYA 3FV1A 1IXCA 4H8JA 3TUSA 3RY3A 2XXVA 1OIBA 5JTYA 3IO4A 1B3EA 1FQCA 2Q2CA 4N13A 2QPQA 3MZ9A 3PUVE 5I58B 3FJ7A 3IK6B 5H8NA 3PPPA 3TDJA 3TCFA 2VOZA 4FATA 3A3CA 3FJGA 1B58A 1MRPA 4QFLA 5BWJA 2F8DA 1AOVA 3K6WA 3S9NC 1FCKA 3VVDA 3HCQA 5DVJA 5CMCA 3MPKA 1ZJLA 1USYE 1A8FA 3FVGA 1R1NA 2I58A 1Y4CA 1GTKA 4R6HA 1B3GA 3O66A 4ZECA 2Q88A 3DP8A 1BTJA 4G68B 3T22A 1BIYA 4TLLB 1M5FA 2NVUB 5LOMA 5I57B 1JW4A 3LSWA 4G2ZA 1MPDA 3RTFB 4LZ7A 4RY1A 1MM6A 4UA8A 1J1NA 1VFDA 1ZIUA 2ONSA 4EDPA 1TT1A 5HM4B 2B3FA 2H4IA 3IO6A 4OEVA 4F39A 1JVXA 1B0HA 2OLBA 3R7XA 4BDLA 2RINA 5AA4A 4NWCA 4F3SA 1PBPA 2DVZA 1P1WA 1QUIA 3HHGA 4DXBA 1O7TA 2F7BA 4PETA 2G93A 2ZYNA 4JWXA 4BDMA 1TXFA 4XKPA 1ELJA 4UACA 2VHAA 2QS4A 3EHTA 4F22A 2OZZA 5H8FA 3FXRA 4X9TA 1N3XA 4H67A 2I49A 5CM6A 3HO7A 4LZ8A 3TTMA 2Q2AA 3O6GA 2X7PA 1D3KA 5I2NB 1LAHE 1US5A 3PD8A 5I56B 2B3BA 3OD7A 2F34A 3OSQA 4JDFA 3RPWA 4DZ1A 3KJ7A 4ECFA 4ZZEA 5AA2D 2O7UA 4BDQA 3CFLA 3SEWA 3O97A 4OMBA 4WEDA 1EZOA 1ZLQA 4THIA 2UXAA 4FIMA 4WEPA 2ANJA 4KCDA 4O3AA 3GBAA 1XHYA 4NF5B 4F29A 5HBCA 3CFXA 2REJA 4YKJA 4FE8A 3VVFA 2REGA 2I3WA 3JYRA 3OO9A 1OQHA 4HS7A 3MQ9A 4R9FA 3LSXA 5A5XA 2RCBA 3G3IA 4RK2A 3N6TA 1P99A 2XX8A 3DP4A 2PYYA 1LLSA 4XIGQ 3GXAA 4YZZA 1EZPA 1HSJA 1TWYA 2OK2A 3PD9A 2D5WA 1N7XA 5F1QA 1B52A 3GBBA 5AA2A 2R9JA 3L6HA 4BDOA 3G3KA 3RT8A 3KZGA 1MDQA 2ZYOA 3BFTA 2F97A 2F5XA 4BDNA 4DIGA 3VXCA 4NF6A 2A5TB 1M5EA 1A55A 3IJOB 1LFHA 1ZKBA 4LUBA 5AA1A 4RPNA 1H76A 1BLFA 1MQDA 4NEDA 5TP9A 2H98A 4LONB 4IGTA 1OVBA 5I84A 3CSGA 2G29A 3EPEA 3B6WA 2XXWA 2XXIA 3K02A 3IB1A 4DCYA 2RC9A 3Q25A 4GXAA 2DXRA 4FORA 3QXMA 2HAVA 2X26A 4POXA 4GFRA 1IITA 4P0IA 3FIRA 4H1XA 4G8MA 3D4CA 1SW2A 2IEEA 2ZXTA 1VFEA 4GQOA 2XXQA 2A5SA 1P1NA 2UYEA 2QMXA 4X48A 2ZYKA 5FTIA 4QF9A 2ZNUA 4ZS9A 5KDTB 1IZ1A 5EYFA 1B3HA 1OLAA 3C36A 2XXHA 3JZJA 4Q5TA 1SVXB 3BKIB 5B7DA 3OO6A 1NNTA 2Q89A 3I3VA 2Z8EA 2OWTA 1YTVA 2QS2A 1Y1MA 4R9GA 3ZSFA 2QL3A 3FVOA 3TTLA 5ICTA 3IAZA 4YB5A 4OEUA 2O6AA 4H5FA 1F9BA 4TOZA 3EQ1A 4R6KA 4H65A 3W9WA 1VE4A 3PUZE 1NNKA 1SD3A 2P2AA 2OBGA 3ONMA 1VR5A 1NNPA 2H5YA 2UYFA 1NNFA 3MJNA 1RYXA 3MW0A 3DM0A 2Z23A 1BKAA 3PV0E 3WAEA 4YAHX 2OCUA 1MG1A 3KFMA 4FEDA 1QVSA 4X1DA 3PU5A 5DT6A 2H9BA 1IXIA 2DE3A 5CRYA 1N7WA 3HSTA 4OXVA 1FW0A 1FQEA 2E1SA 4U1OA 3TPAA 1Y4TA 5DVIA 1M5CA 3BBRA 4IY5A 5FTHA 3EN3A 3OOAA 1MXZA 4EQ9A 3UGWA 4JB7A 1JQFA 3VVEA 2I3VA 3WAFA 3C4MA 5L9MA 2XXXA 5H8HB 4JSOA 1AIVA 3VDFA 4OFJA 1FTMA 1XS5A 5J1DA 3FD3A 4HCWA 1DSNA 2HCAA 3EHSA 3S9MC 1SYIA 2ZMBA 1S7YA 3TQLA 5I59A 5DVFA 3IOVA 1SYHA 1GV8A 1LCFA 2XD3A 2HZKA 4RPOA 5DEXA 1D9VA 3L6GA 4L17A 4YKPA 4H5GA 5KZTA 4H6DA 1FQBA 4ZE8A 3VE1B 5TU0A 3U94A 4E0WA 4GOTA 3MWBA 4N07A 1MH4A 3PPRA 4F19A 2ONKE 3UA8A 2ONRA 4MBPA 3HPIA 5F7VA 4ZDMA 1ANFA 1UTBB 3S9EA 4IO5A 2R6GE 3PPNA 1IXGA 2ZNTA 4JXIA 3P7IA 1UQWA 4FEBA 4KPTA 2F35A 1B32A 2RCAA 4C1UA 5EHSA 4NF8A 2F7AA 4ELOA 1YCJA 3K0VA 2O68A 2RKMA 5KCJA 2V3QA 3TCHA 2UVIA 1DTZA 1IQ7A 4GIZA 1USYH 2I6EA 4QSCA 4NTLA 4TLMB 1H43A 5H8QA 1JEVA 4U4SA 1B9JA 2HFBA 2PT2A 3C32A 2F7CA 4U4XA 2Y7WA 2V93A 3FXQA 3BFUA 1Z7ME 3DELB 3SDFA 3U8QA 1SW1A 5IAIA 1B1XA 4IO3A 2GHAA 1B46A 3B7DA 2ESNA 4PQJA 1UTHB 1I6BA 1MPCA 3F11A 3EF7A 1MY1A 1OLCA 3KEIA 4ZEBA 1LAXA 1QKAA 3ZS6A 2QS1A 4OQOA 3V8XB 5TP9B 2V25A 3KN7A 2FYIA 1MY0A 3AXFA 2I48A 3Q29A 2XXYA 1RYOA 4GRKA 2O51A 1LGBC 5ELVA 1MY4A 1SI1A 2PBWA 5K2YA 1XVYA 3KJTA 4OHNA 2RF1A 3TMGA 3CIJA 1B6HA 3T96B 4OWDA 4R2FA 1NFTA 4QSDA 2DE4A 5AE4A 4IO4A 3SKPA 4U2RA 3KOSA 3SEXA 4RJZA 4ELRA 4PP0A 2PMSA 4QFPA 4GF8A 3A3UA 1MXWA 1R9QA 1POY1 2FNCA 1OMPA 1T0KA 5I58A 2F78A 3QYTA 1CB6A 4XXUA 3FVNA 2NWJA 4GL8A 4OENA 4P11A 3THIA 3HV1A 3DLNA 3D4GA 3MP1A 3PPQA 2IA4A 2M8CA 1P1QA 3G3GA 3FUZA 3M3KA 5FHNA 3H6WA 4PE5B 3H06B 3PMWA 1GGGA 4KI0E 5BUUA 5FHOA 3MVYA 1LCTA 5L8DA 3VLUA 4NF4B 1URSA 2THIA 3C9HA 3RUMA 1AL3A 4KYDA 3MUQA 1XC1A 4I1DA 2QS3A 1UIVA 4KQPA 4ELPA 4F1VA 2GHBA 1UIUA 3K2DA 4XKNA 5EHMA 3I6VA 1B2HA 4EF1A 5I2KB 4G68A 1ATGA 2UVHA 1LBBA 4LQ5A 1B4ZA 5JEIA 3IL1B 2PX1A 2F36A 3HN0A 5I57A 5M2VA 3FJMA 1XOCA 1Q35A 2AL4A 1LFGA 3IORA 5CBRA 1D9YA 3K1PA 3TELA 1GR2A 5B70A 4EXLA 2VP1A 1BP5A 3TODA 4IO7A 2FA7A 2R71A 4PFYA 1H45A 3QUFA 2E0SA 3TEPA 1HSEA 2O84X 4DXUA 4EUOA 3UK4A 3SEYA 3KSJA 1B05A 1PB8A 3FXUA 4DDDA 4LA9A 4KYEA 3OO7A 1B3LA 3N94A 1AMFA 4Z0IA 3PMXA 1B1HA 1R6ZA 2Y7PA 1OQGA 4F3BA 4LVQA 5ISUA 3RQTA 1NKXA 3LSLA 4DCXA 1SDXA 4F1UA 3CRBA 2DWIA 4HW8A 4C1TA 4OERA 1B3FA 2VD2A 1LFIA 4QSEA 3H6UA 1WODA 3KGCA 1LB8A 5I56A 1O64A 4F3GA 2Y7RA 4R73A 2DWJA 5HPQA 4RYAA 1QJMA 1JW1A 1EU8A 1FTOA 1MY3A 3U92A 3FZVA 3E13X 3B6QA 1B40A 1M5DA 2HEUA 3O6IA 2DE2A 3T9UA 3MVXA 1PB7A 1B5IA 4NF5A 1TFDA 4ZE9A 5JTYB 3CG1A 3OXNA 5CMBA 5TPAA 4AB5A 1R9LA 4U22A 3G3FA 1MY2A 2DXYA 3V83A 4OTEA 3FVKA 4YB7A 3UIFA 3U1OA 3C33A 5H8NB 1B7HA 1RKMA 1ZMGA 5H8SA 3K01A 3QIMA 1FQDA 1FQAA 3Q26A 3U72A 3ZKLA 4YMBA 2OWSA 1MS7A 4EQBA 2H99A 3KN3A 4F31B 3H03A 2V3TA 4YKIA 1NMUA 3FATA 4ZEKA 3O6HA 3K6UA 4PFWA 2A5TA 1DOTA 1IEJA 5L9SA 3OEKA 4WXJA 3ZKKA 4PFTA 3O9PA 1O63A 2XHDA 1P1UA 3V5AA 1ZTYA 2DSFA 3A09A 1B7UA 2UVJA 4AB6A 3S4UA 1DPEA 4M1VA 2NOOA 3I5OA 3KN8A 3PUWE 2GH9A 4IY6A 3QK6A 2PT1A 4ZEFA 1L5TA 3TTNA 4LQ2A 1VSOA 2Y7IA 3GLBA 1SW5A 5ICQA 1QUKA 4EF2A 1S9TA 3G3HA 5CBSA 5AA4B 3SETA 3OSRA 1IUDA 1US4A 3O29A 1QUJA 1MQIA 3GZGA 4GXSB 4TQUQ 1FTLA 3S2VA 5H8FB 1JVYA 3MC2A 2B65A 3IB2A 3MPLA 3CR9A 5DTBA 3O2AA 4RK9A 4QFKA 4OFLA 4M4GA 3VLVA 4U21A 3VLWA 3OO8A 2V3UA 4KR5A 1YAEA 1POTA 4QRZA 3TTRA 4ESWA 5KDTA 1Y3NA 1I69A 3O28A 3RNNA 4N6PA 3H7MA 4H8IA 3EHUA 2GRVA 3C34A 2Z8DA 1HSLA 3K6VA 4MH5A 1Q1KA 1FQFA 3T66A 3RGYA 3RT6B 4AQ4A 2P0SA 4BDRA 1B7ZA 3Q27A 3K1NA 1Y1ZA 4YB6A 1XVXA 3VFJA 4JWYA 4BLAA 3LUYA 4R74A 3OELA 3TTKA 3E4RA 2I4BA 2Y84A 4F2QA 1A99A 5FHMA 3PGFA 3IOWA 4F3PA 3H3GA 3MBPA 2AL5A 4JSDA 3H6VA 5L9OA 1Z7NE 5A5XB 4RA1A 4RXLA 3UP9A 2O1LA 4I9DA 1FTJA 3G3JA 4P0GA 2NUVA 2XX7A 1N0TA 4HCYA 4POWA 3LSFB 3VXBA 2XXRA 1H44A 4OYVA 4ZEDA 2ZNSA 3IR1A 4ZEIA 3MZ1A 2PVUA 4JBZA 4MFIA 5DYHA 1XT8A 1MM7A 3R6UA 5AA2B 4FAJA 3OENA 4IGRA 3E3KA 1B5HA 1B51A 1B4HA 3RLFE 4NF6B 1YPNA 2I0CA 3FASA 4KD5A 3CG3A 2Z22A 1URDA 5K2XA 4GWOA 1N84A 4NMYA 4OVJA 3U93A 3TAJA 2O69A 4QFNA 2NXOA 4R75A 4OETA 2RC8A 3N5LA 4GVOA 1EZ9A 5H8HA 3ECRA 3T9XB 2HQ0A 1Y20A 4O3CA 3TCGA 2O1MA 4EXKA 3USDA 1SW4A 2QJEA 4Q0CA 1LB9A 3JV9A 4R72A 3E9XA 2Q9TA 2HXWA 2XX9A 1NL5A 2DWAA 3ILUB 4OZ9A 2Y7KA 1GVCA 4FECA 1N3WA 1PB9A 1ZBMA 5CMKA 1MQGA 1N76A 1PDAA 3N6UA 1MDP1 3C31A 4ESXA 1A40A 3LBSA 2I0BA 1DPPA 4HTGA 4IO2A 3K00A 1A8EA 3UN6A 3SEUA 2XD2A 3H4ZA 3R26A 4K3FA 4KHZE 2YJPA 1UTBA 4XTCQ 4OESA 1MPBA 1MQJA 3IX1A 5TPAB 3TKDA 1QULA 2DWHA 3MP8A 1A54A 2CZLA 3CVGA 3KSXA 1WDNA 3PUYE 3S9LC 3SEVA 3G7WA 1KWHA 1NH7A 2BJJX 4QHQA 1TFAA 4G4PA 1JW5A 1Y9UA 1DMBA 2VD3A 1I6AA 1OVTA 4MF3A 3QAXA 1AH5A 4XKRA 4NE4A 1SQYA 4R2BA 4H0WA 2O7IA 3W15C 4YKKA 4X1BA 2F6PA 3MZBA 2ZYMA 3QUJA 1UTHA 3CFZA 4G8HA 2ALUA 2DOJA 4LP2B 2WKYA 2D21A 1JEUA 4R6YA 4Z7EA 4RNSA 4Q8RA 2Z8FA 1IXHA 1PEBA 4G77A 3KOTA 2YPNA 4G8NA 3CSBA 1LAGE 3IOUA 4GD5A 4Q30B 4ZZAA 3UORA 5IKBA 2UVGA 1S50A 3SESA 2W7YA 2HAUA 4XKQA 1IIWA 4G68C 3VV5A 3IJXB 5I2NA 2XXPA 2LAOA 4DLDA 1N04A 4DXCA 5CC2A 3LC8A 3LR1A 4DE8A 1I6QA 4EQ7A 3Q28A 5CMMA 1M5BA 2AYSA 1WVJA 1CE2A 4GL0A 3RTWB 1JETA 2XXTA 3KG2A 2D3IA 5I59B 2AIXA 1H3DA 4QFOA 3KBRA 4C0RA 4KYSA 5DEXB 2QRYA 4U23A 4KCCA 3M3FA 1LBCA 1Y3PA 2GFEA 1MQHA 3TYHA 4NF4A 2DP8A 3PMVA 3MP6A 4U1ZA 3V89B 5ITPA 1D4NA 3QSLA 3M3LA 4I62A 3H6TA 4GLIA 2KLFA 4ONYA 1LSTA 2YLNA 4JWOA 4NWDA 2XXUA 4O3BA 1P1OA 3HHFA 3SERA 5CI5A 3MVZA 1MXVA 1II5A 2X7QA 5I2KA 2I4CA 3T93B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OFO A;  4F18 A;  1JNF A;  3IB0 A;  2DS9 A;  3FGS A;  4NF8 B;  4F2O A;  4PFU A;  5KCJ B;  3OEM A;  1QW0 A;  2V84 A;  3TZA A;  1B0L A;  3ILT B;  2H25 A;  1A7L A;  5H8Q B;  4IB2 A;  1QKB A;  3TQW A;  2P1S A;  2RC7 A;  5AA3 A;  3B6T A;  4LZ5 A;  1Y3Q A;  4ISU A;  3T9H B;  2Q8J A;  1MXU A;  3PUX E;  3MVW A;  2OJT A;  1MXX A;  4MLQ A;  4ND9 A;  4YU0 A;  3MAM A;  4LAT A;  1SI0 A;  3DP6 A;  1LAF E;  3T9V A;  3FV2 A;  2F6G A;  2ABH A;  3TFL A;  2DQV A;  1MH3 A;  2HZL A;  4YIC A;  5JK4 A;  4F1Y A;  2VGQ A;  3K4U A;  4I8C A;  3N26 A;  2DVC A;  4WKM A;  4E0X A;  5ITO A;  3K6X A;  4MLV A;  3PPO A;  3C35 A;  3M8U A;  4FJP A;  4IO6 A;  1ZU0 A;  1PC3 A;  3RN8 A;  4ELQ A;  3ODB A;  1URG A;  1EH3 A;  2QMW A;  1FTK A;  1PBQ A;  2QSX A;  4KFQ A;  3W9V A;  3OMB A;  1SBP A;  4YMA A;  1B5J A;  3CI8 A;  3IOT A;  2CMO A;  1DTG A;  1NH8 A;  3K1M A;  2DYX A;  1MXY A;  3FV1 A;  1IXC A;  4H8J A;  3TUS A;  3RY3 A;  2XXV A;  1OIB A;  5JTY A;  3IO4 A;  1B3E A;  1FQC A;  2Q2C A;  4N13 A;  2QPQ A;  3MZ9 A;  3PUV E;  5I58 B;  3FJ7 A;  3IK6 B;  5H8N A;  3PPP A;  3TDJ A;  3TCF A;  2VOZ A;  4FAT A;  3A3C A;  3FJG A;  1B58 A;  1MRP A;  4QFL A;  5BWJ A;  2F8D A;  1AOV A;  3K6W A;  3S9N C;  1FCK A;  3VVD A;  3HCQ A;  5DVJ A;  5CMC A;  3MPK A;  1ZJL A;  1USY E;  1A8F A;  3FVG A;  1R1N A;  2I58 A;  1Y4C A;  1GTK A;  4R6H A;  1B3G A;  3O66 A;  4ZEC A;  2Q88 A;  3DP8 A;  1BTJ A;  4G68 B;  3T22 A;  1BIY A;  4TLL B;  1M5F A;  2NVU B;  5LOM A;  5I57 B;  1JW4 A;  3LSW A;  4G2Z A;  1MPD A;  3RTF B;  4LZ7 A;  4RY1 A;  1MM6 A;  4UA8 A;  1J1N A;  1VFD A;  1ZIU A;  2ONS A;  4EDP A;  1TT1 A;  5HM4 B;  2B3F A;  2H4I A;  3IO6 A;  4OEV A;  4F39 A;  1JVX A;  1B0H A;  2OLB A;  3R7X A;  4BDL A;  2RIN A;  5AA4 A;  4NWC A;  4F3S A;  1PBP A;  2DVZ A;  1P1W A;  1QUI A;  3HHG A;  4DXB A;  1O7T A;  2F7B A;  4PET A;  2G93 A;  2ZYN A;  4JWX A;  4BDM A;  1TXF A;  4XKP A;  1ELJ A;  4UAC A;  2VHA A;  2QS4 A;  3EHT A;  4F22 A;  2OZZ A;  5H8F A;  3FXR A;  4X9T A;  1N3X A;  4H67 A;  2I49 A;  5CM6 A;  3HO7 A;  4LZ8 A;  3TTM A;  2Q2A A;  3O6G A;  2X7P A;  1D3K A;  5I2N B;  1LAH E;  1US5 A;  3PD8 A;  5I56 B;  2B3B A;  3OD7 A;  2F34 A;  3OSQ A;  4JDF A;  3RPW A;  4DZ1 A;  3KJ7 A;  4ECF A;  4ZZE A;  5AA2 D;  2O7U A;  4BDQ A;  3CFL A;  3SEW A;  3O97 A;  4OMB A;  4WED A;  1EZO A;  1ZLQ A;  4THI A;  2UXA A;  4FIM A;  4WEP A;  2ANJ A;  4KCD A;  4O3A A;  3GBA A;  1XHY A;  4NF5 B;  4F29 A;  5HBC A;  3CFX A;  2REJ A;  4YKJ A;  4FE8 A;  3VVF A;  2REG A;  2I3W A;  3JYR A;  3OO9 A;  1OQH A;  4HS7 A;  3MQ9 A;  4R9F A;  3LSX A;  5A5X A;  2RCB A;  3G3I A;  4RK2 A;  3N6T A;  1P99 A;  2XX8 A;  3DP4 A;  2PYY A;  1LLS A;  4XIG Q;  3GXA A;  4YZZ A;  1EZP A;  1HSJ A;  1TWY A;  2OK2 A;  3PD9 A;  2D5W A;  1N7X A;  5F1Q A;  1B52 A;  3GBB A;  5AA2 A;  2R9J A;  3L6H A;  4BDO A;  3G3K A;  3RT8 A;  3KZG A;  1MDQ A;  2ZYO A;  3BFT A;  2F97 A;  2F5X A;  4BDN A;  4DIG A;  3VXC A;  4NF6 A;  2A5T B;  1M5E A;  1A55 A;  3IJO B;  1LFH A;  1ZKB A;  4LUB A;  5AA1 A;  4RPN A;  1H76 A;  1BLF A;  1MQD A;  4NED A;  5TP9 A;  2H98 A;  4LON B;  4IGT A;  1OVB A;  5I84 A;  3CSG A;  2G29 A;  3EPE A;  3B6W A;  2XXW A;  2XXI A;  3K02 A;  3IB1 A;  4DCY A;  2RC9 A;  3Q25 A;  4GXA A;  2DXR A;  4FOR A;  3QXM A;  2HAV A;  2X26 A;  4POX A;  4GFR A;  1IIT A;  4P0I A;  3FIR A;  4H1X A;  4G8M A;  3D4C A;  1SW2 A;  2IEE A;  2ZXT A;  1VFE A;  4GQO A;  2XXQ A;  2A5S A;  1P1N A;  2UYE A;  2QMX A;  4X48 A;  2ZYK A;  5FTI A;  4QF9 A;  2ZNU A;  4ZS9 A;  5KDT B;  1IZ1 A;  5EYF A;  1B3H A;  1OLA A;  3C36 A;  2XXH A;  3JZJ A;  4Q5T A;  1SVX B;  3BKI B;  5B7D A;  3OO6 A;  1NNT A;  2Q89 A;  3I3V A;  2Z8E A;  2OWT A;  1YTV A;  2QS2 A;  1Y1M A;  4R9G A;  3ZSF A;  2QL3 A;  3FVO A;  3TTL A;  5ICT A;  3IAZ A;  4YB5 A;  4OEU A;  2O6A A;  4H5F A;  1F9B A;  4TOZ A;  3EQ1 A;  4R6K A;  4H65 A;  3W9W A;  1VE4 A;  3PUZ E;  1NNK A;  1SD3 A;  2P2A A;  2OBG A;  3ONM A;  1VR5 A;  1NNP A;  2H5Y A;  2UYF A;  1NNF A;  3MJN A;  1RYX A;  3MW0 A;  3DM0 A;  2Z23 A;  1BKA A;  3PV0 E;  3WAE A;  4YAH X;  2OCU A;  1MG1 A;  3KFM A;  4FED A;  1QVS A;  4X1D A;  3PU5 A;  5DT6 A;  2H9B A;  1IXI A;  2DE3 A;  5CRY A;  1N7W A;  3HST A;  4OXV A;  1FW0 A;  1FQE A;  2E1S A;  4U1O A;  3TPA A;  1Y4T A;  5DVI A;  1M5C A;  3BBR A;  4IY5 A;  5FTH A;  3EN3 A;  3OOA A;  1MXZ A;  4EQ9 A;  3UGW A;  4JB7 A;  1JQF A;  3VVE A;  2I3V A;  3WAF A;  3C4M A;  5L9M A;  2XXX A;  5H8H B;  4JSO A;  1AIV A;  3VDF A;  4OFJ A;  1FTM A;  1XS5 A;  5J1D A;  3FD3 A;  4HCW A;  1DSN A;  2HCA A;  3EHS A;  3S9M C;  1SYI A;  2ZMB A;  1S7Y A;  3TQL A;  5I59 A;  5DVF A;  3IOV A;  1SYH A;  1GV8 A;  1LCF A;  2XD3 A;  2HZK A;  4RPO A;  5DEX A;  1D9V A;  3L6G A;  4L17 A;  4YKP A;  4H5G A;  5KZT A;  4H6D A;  1FQB A;  4ZE8 A;  3VE1 B;  5TU0 A;  3U94 A;  4E0W A;  4GOT A;  3MWB A;  4N07 A;  1MH4 A;  3PPR A;  4F19 A;  2ONK E;  3UA8 A;  2ONR A;  4MBP A;  3HPI A;  5F7V A;  4ZDM A;  1ANF A;  1UTB B;  3S9E A;  4IO5 A;  2R6G E;  3PPN A;  1IXG A;  2ZNT A;  4JXI A;  3P7I A;  1UQW A;  4FEB A;  4KPT A;  2F35 A;  1B32 A;  2RCA A;  4C1U A;  5EHS A;  4NF8 A;  2F7A A;  4ELO A;  1YCJ A;  3K0V A;  2O68 A;  2RKM A;  5KCJ A;  2V3Q A;  3TCH A;  2UVI A;  1DTZ A;  1IQ7 A;  4GIZ A;  1USY H;  2I6E A;  4QSC A;  4NTL A;  4TLM B;  1H43 A;  5H8Q A;  1JEV A;  4U4S A;  1B9J A;  2HFB A;  2PT2 A;  3C32 A;  2F7C A;  4U4X A;  2Y7W A;  2V93 A;  3FXQ A;  3BFU A;  1Z7M E;  3DEL B;  3SDF A;  3U8Q A;  1SW1 A;  5IAI A;  1B1X A;  4IO3 A;  2GHA A;  1B46 A;  3B7D A;  2ESN A;  4PQJ A;  1UTH B;  1I6B A;  1MPC A;  3F11 A;  3EF7 A;  1MY1 A;  1OLC A;  3KEI A;  4ZEB A;  1LAX A;  1QKA A;  3ZS6 A;  2QS1 A;  4OQO A;  3V8X B;  5TP9 B;  2V25 A;  3KN7 A;  2FYI A;  1MY0 A;  3AXF A;  2I48 A;  3Q29 A;  2XXY A;  1RYO A;  4GRK A;  2O51 A;  1LGB C;  5ELV A;  1MY4 A;  1SI1 A;  2PBW A;  5K2Y A;  1XVY A;  3KJT A;  4OHN A;  2RF1 A;  3TMG A;  3CIJ A;  1B6H A;  3T96 B;  4OWD A;  4R2F A;  1NFT A;  4QSD A;  2DE4 A;  5AE4 A;  4IO4 A;  3SKP A;  4U2R A;  3KOS A;  3SEX A;  4RJZ A;  4ELR A;  4PP0 A;  2PMS A;  4QFP A;  4GF8 A;  3A3U A;  1MXW A;  1R9Q A;  1POY 1;  2FNC A;  1OMP A;  1T0K A;  5I58 A;  2F78 A;  3QYT A;  1CB6 A;  4XXU A;  3FVN A;  2NWJ A;  4GL8 A;  4OEN A;  4P11 A;  3THI A;  3HV1 A;  3DLN A;  3D4G A;  3MP1 A;  3PPQ A;  2IA4 A;  2M8C A;  1P1Q A;  3G3G A;  3FUZ A;  3M3K A;  5FHN A;  3H6W A;  4PE5 B;  3H06 B;  3PMW A;  1GGG A;  4KI0 E;  5BUU A;  5FHO A;  3MVY A;  1LCT A;  5L8D A;  3VLU A;  4NF4 B;  1URS A;  2THI A;  3C9H A;  3RUM A;  1AL3 A;  4KYD A;  3MUQ A;  1XC1 A;  4I1D A;  2QS3 A;  1UIV A;  4KQP A;  4ELP A;  4F1V A;  2GHB A;  1UIU A;  3K2D A;  4XKN A;  5EHM A;  3I6V A;  1B2H A;  4EF1 A;  5I2K B;  4G68 A;  1ATG A;  2UVH A;  1LBB A;  4LQ5 A;  1B4Z A;  5JEI A;  3IL1 B;  2PX1 A;  2F36 A;  3HN0 A;  5I57 A;  5M2V A;  3FJM A;  1XOC A;  1Q35 A;  2AL4 A;  1LFG A;  3IOR A;  5CBR A;  1D9Y A;  3K1P A;  3TEL A;  1GR2 A;  5B70 A;  4EXL A;  2VP1 A;  1BP5 A;  3TOD A;  4IO7 A;  2FA7 A;  2R71 A;  4PFY A;  1H45 A;  3QUF A;  2E0S A;  3TEP A;  1HSE A;  2O84 X;  4DXU A;  4EUO A;  3UK4 A;  3SEY A;  3KSJ A;  1B05 A;  1PB8 A;  3FXU A;  4DDD A;  4LA9 A;  4KYE A;  3OO7 A;  1B3L A;  3N94 A;  1AMF A;  4Z0I A;  3PMX A;  1B1H A;  1R6Z A;  2Y7P A;  1OQG A;  4F3B A;  4LVQ A;  5ISU A;  3RQT A;  1NKX A;  3LSL A;  4DCX A;  1SDX A;  4F1U A;  3CRB A;  2DWI A;  4HW8 A;  4C1T A;  4OER A;  1B3F A;  2VD2 A;  1LFI A;  4QSE A;  3H6U A;  1WOD A;  3KGC A;  1LB8 A;  5I56 A;  1O64 A;  4F3G A;  2Y7R A;  4R73 A;  2DWJ A;  5HPQ A;  4RYA A;  1QJM A;  1JW1 A;  1EU8 A;  1FTO A;  1MY3 A;  3U92 A;  3FZV A;  3E13 X;  3B6Q A;  1B40 A;  1M5D A;  2HEU A;  3O6I A;  2DE2 A;  3T9U A;  3MVX A;  1PB7 A;  1B5I A;  4NF5 A;  1TFD A;  4ZE9 A;  5JTY B;  3CG1 A;  3OXN A;  5CMB A;  5TPA A;  4AB5 A;  1R9L A;  4U22 A;  3G3F A;  1MY2 A;  2DXY A;  3V83 A;  4OTE A;  3FVK A;  4YB7 A;  3UIF A;  3U1O A;  3C33 A;  5H8N B;  1B7H A;  1RKM A;  1ZMG A;  5H8S A;  3K01 A;  3QIM A;  1FQD A;  1FQA A;  3Q26 A;  3U72 A;  3ZKL A;  4YMB A;  2OWS A;  1MS7 A;  4EQB A;  2H99 A;  3KN3 A;  4F31 B;  3H03 A;  2V3T A;  4YKI A;  1NMU A;  3FAT A;  4ZEK A;  3O6H A;  3K6U A;  4PFW A;  2A5T A;  1DOT A;  1IEJ A;  5L9S A;  3OEK A;  4WXJ A;  3ZKK A;  4PFT A;  3O9P A;  1O63 A;  2XHD A;  1P1U A;  3V5A A;  1ZTY A;  2DSF A;  3A09 A;  1B7U A;  2UVJ A;  4AB6 A;  3S4U A;  1DPE A;  4M1V A;  2NOO A;  3I5O A;  3KN8 A;  3PUW E;  2GH9 A;  4IY6 A;  3QK6 A;  2PT1 A;  4ZEF A;  1L5T A;  3TTN A;  4LQ2 A;  1VSO A;  2Y7I A;  3GLB A;  1SW5 A;  5ICQ A;  1QUK A;  4EF2 A;  1S9T A;  3G3H A;  5CBS A;  5AA4 B;  3SET A;  3OSR A;  1IUD A;  1US4 A;  3O29 A;  1QUJ A;  1MQI A;  3GZG A;  4GXS B;  4TQU Q;  1FTL A;  3S2V A;  5H8F B;  1JVY A;  3MC2 A;  2B65 A;  3IB2 A;  3MPL A;  3CR9 A;  5DTB A;  3O2A A;  4RK9 A;  4QFK A;  4OFL A;  4M4G A;  3VLV A;  4U21 A;  3VLW A;  3OO8 A;  2V3U A;  4KR5 A;  1YAE A;  1POT A;  4QRZ A;  3TTR A;  4ESW A;  5KDT A;  1Y3N A;  1I69 A;  3O28 A;  3RNN A;  4N6P A;  3H7M A;  4H8I A;  3EHU A;  2GRV A;  3C34 A;  2Z8D A;  1HSL A;  3K6V A;  4MH5 A;  1Q1K A;  1FQF A;  3T66 A;  3RGY A;  3RT6 B;  4AQ4 A;  2P0S A;  4BDR A;  1B7Z A;  3Q27 A;  3K1N A;  1Y1Z A;  4YB6 A;  1XVX A;  3VFJ A;  4JWY A;  4BLA A;  3LUY A;  4R74 A;  3OEL A;  3TTK A;  3E4R A;  2I4B A;  2Y84 A;  4F2Q A;  1A99 A;  5FHM A;  3PGF A;  3IOW A;  4F3P A;  3H3G A;  3MBP A;  2AL5 A;  4JSD A;  3H6V A;  5L9O A;  1Z7N E;  5A5X B;  4RA1 A;  4RXL A;  3UP9 A;  2O1L A;  4I9D A;  1FTJ A;  3G3J A;  4P0G A;  2NUV A;  2XX7 A;  1N0T A;  4HCY A;  4POW A;  3LSF B;  3VXB A;  2XXR A;  1H44 A;  4OYV A;  4ZED A;  2ZNS A;  3IR1 A;  4ZEI A;  3MZ1 A;  2PVU A;  4JBZ A;  4MFI A;  5DYH A;  1XT8 A;  1MM7 A;  3R6U A;  5AA2 B;  4FAJ A;  3OEN A;  4IGR A;  3E3K A;  1B5H A;  1B51 A;  1B4H A;  3RLF E;  4NF6 B;  1YPN A;  2I0C A;  3FAS A;  4KD5 A;  3CG3 A;  2Z22 A;  1URD A;  5K2X A;  4GWO A;  1N84 A;  4NMY A;  4OVJ A;  3U93 A;  3TAJ A;  2O69 A;  4QFN A;  2NXO A;  4R75 A;  4OET A;  2RC8 A;  3N5L A;  4GVO A;  1EZ9 A;  5H8H A;  3ECR A;  3T9X B;  2HQ0 A;  1Y20 A;  4O3C A;  3TCG A;  2O1M A;  4EXK A;  3USD A;  1SW4 A;  2QJE A;  4Q0C A;  1LB9 A;  3JV9 A;  4R72 A;  3E9X A;  2Q9T A;  2HXW A;  2XX9 A;  1NL5 A;  2DWA A;  3ILU B;  4OZ9 A;  2Y7K A;  1GVC A;  4FEC A;  1N3W A;  1PB9 A;  1ZBM A;  5CMK A;  1MQG A;  1N76 A;  1PDA A;  3N6U A;  1MDP 1;  3C31 A;  4ESX A;  1A40 A;  3LBS A;  2I0B A;  1DPP A;  4HTG A;  4IO2 A;  3K00 A;  1A8E A;  3UN6 A;  3SEU A;  2XD2 A;  3H4Z A;  3R26 A;  4K3F A;  4KHZ E;  2YJP A;  1UTB A;  4XTC Q;  4OES A;  1MPB A;  1MQJ A;  3IX1 A;  5TPA B;  3TKD A;  1QUL A;  2DWH A;  3MP8 A;  1A54 A;  2CZL A;  3CVG A;  3KSX A;  1WDN A;  3PUY E;  3S9L C;  3SEV A;  3G7W A;  1KWH A;  1NH7 A;  2BJJ X;  4QHQ A;  1TFA A;  4G4P A;  1JW5 A;  1Y9U A;  1DMB A;  2VD3 A;  1I6A A;  1OVT A;  4MF3 A;  3QAX A;  1AH5 A;  4XKR A;  4NE4 A;  1SQY A;  4R2B A;  4H0W A;  2O7I A;  3W15 C;  4YKK A;  4X1B A;  2F6P A;  3MZB A;  2ZYM A;  3QUJ A;  1UTH A;  3CFZ A;  4G8H A;  2ALU A;  2DOJ A;  4LP2 B;  2WKY A;  2D21 A;  1JEU A;  4R6Y A;  4Z7E A;  4RNS A;  4Q8R A;  2Z8F A;  1IXH A;  1PEB A;  4G77 A;  3KOT A;  2YPN A;  4G8N A;  3CSB A;  1LAG E;  3IOU A;  4GD5 A;  4Q30 B;  4ZZA A;  3UOR A;  5IKB A;  2UVG A;  1S50 A;  3SES A;  2W7Y A;  2HAU A;  4XKQ A;  1IIW A;  4G68 C;  3VV5 A;  3IJX B;  5I2N A;  2XXP A;  2LAO A;  4DLD A;  1N04 A;  4DXC A;  5CC2 A;  3LC8 A;  3LR1 A;  4DE8 A;  1I6Q A;  4EQ7 A;  3Q28 A;  5CMM A;  1M5B A;  2AYS A;  1WVJ A;  1CE2 A;  4GL0 A;  3RTW B;  1JET A;  2XXT A;  3KG2 A;  2D3I A;  5I59 B;  2AIX A;  1H3D A;  4QFO A;  3KBR A;  4C0R A;  4KYS A;  5DEX B;  2QRY A;  4U23 A;  4KCC A;  3M3F A;  1LBC A;  1Y3P A;  2GFE A;  1MQH A;  3TYH A;  4NF4 A;  2DP8 A;  3PMV A;  3MP6 A;  4U1Z A;  3V89 B;  5ITP A;  1D4N A;  3QSL A;  3M3L A;  4I62 A;  3H6T A;  4GLI A;  2KLF A;  4ONY A;  1LST A;  2YLN A;  4JWO A;  4NWD A;  2XXU A;  4O3B A;  1P1O A;  3HHF A;  3SER A;  5CI5 A;  3MVZ A;  1MXV A;  1II5 A;  2X7Q A;  5I2K A;  2I4C A;  3T93 B; 
#chains in the Genus database with same CATH topology
 4OFO A;  4F18 A;  1JNF A;  3IB0 A;  2DS9 A;  3FGS A;  3SZP A;  4NF8 B;  4F2O A;  4PFU A;  5KCJ B;  3OEM A;  5I5P A;  1QW0 A;  2V84 A;  3TZA A;  1IME A;  1B0L A;  3ILT B;  1CNQ A;  2H25 A;  1A7L A;  5H8Q B;  5IGA A;  4IB2 A;  1QKB A;  3TQW A;  2P1S A;  2RC7 A;  5AA3 A;  3B6T A;  4LZ5 A;  1Y3Q A;  1LBW A;  4ISU A;  3T9H B;  2Q8J A;  1MXU A;  2P3V A;  3PUX E;  3MVW A;  2OJT A;  1MXX A;  4MLQ A;  4ND9 A;  4YU0 A;  3MAM A;  4LAT A;  1LBZ A;  1SI0 A;  3DP6 A;  1LAF E;  1Q9D A;  1G0I A;  4GX3 A;  3T9V A;  3FV2 A;  2F6G A;  2ABH A;  1FPG A;  3TFL A;  2DQV A;  1MH3 A;  2HZL A;  4YIC A;  5JK4 A;  4F1Y A;  2VGQ A;  3K4U A;  4I8C A;  3N26 A;  2DVC A;  4WKM A;  4E0X A;  5ITO A;  3K6X A;  4MLV A;  3PPO A;  3C35 A;  3M8U A;  4FJP A;  4IO6 A;  1NV6 A;  1ZU0 A;  4PFB A;  4QXD A;  1PC3 A;  3RN8 A;  4ELQ A;  3ODB A;  1URG A;  1EH3 A;  2QMW A;  1FTK A;  1AWB A;  1PBQ A;  2QSX A;  4KFQ A;  3W9V A;  3OMB A;  1SBP A;  4YMA A;  1B5J A;  3CI8 A;  3IOT A;  2CMO A;  1FTA A;  1DTG A;  1NH8 A;  3K1M A;  4PBH A;  2DYX A;  1MXY A;  2R8T A;  3FV1 A;  1IXC A;  4H8J A;  3TUS A;  3RY3 A;  2XXV A;  1OIB A;  3FXB A;  5JTY A;  5IZZ A;  3IO4 A;  1B3E A;  1FQC A;  2Q2C A;  2FBP A;  4N13 A;  2QPQ A;  3MZ9 A;  3PUV E;  4PBQ A;  5I58 B;  3FJ7 A;  3IK6 B;  5H8N A;  4PAK A;  3PPP A;  3TDJ A;  1FRP A;  3TCF A;  2VOZ A;  4FAT A;  3A3C A;  3FJG A;  1NV5 A;  1B58 A;  1MRP A;  4QFL A;  5BWJ A;  2F8D A;  3MST A;  1AOV A;  1YYZ A;  3K6W A;  3S9N C;  1FCK A;  3VVD A;  3HCQ A;  5DVJ A;  5CMC A;  3MPK A;  1ZJL A;  1USY E;  2QVR A;  1A8F A;  2B4L A;  3FVG A;  1R1N A;  2I58 A;  4OA4 A;  1Y4C A;  1GTK A;  2BJI A;  3PTY A;  1B3G A;  3O66 A;  4R6H A;  4ZEC A;  2Q88 A;  3DP8 A;  1BTJ A;  4G68 B;  3T22 A;  1BIY A;  4TLL B;  1M5F A;  2NVU B;  5LOM A;  5I57 B;  1JW4 A;  3LSW A;  4G2Z A;  1MPD A;  3ROJ A;  3RTF B;  4LZ7 A;  4O94 A;  4RY1 A;  1MM6 A;  4UA8 A;  1J1N A;  1VFD A;  1ZIU A;  2ONS A;  4EDP A;  1TT1 A;  5HM4 B;  2B3F A;  2QVU A;  2CZK A;  2H4I A;  3IO6 A;  4XF5 A;  4OEV A;  4F39 A;  1JVX A;  5EQ9 A;  1B0H A;  2OLB A;  3R7X A;  4I3Y A;  4BDL A;  2RIN A;  5AA4 A;  4NWC A;  4F3S A;  1PBP A;  2DVZ A;  4P1E A;  1P1W A;  4XFE A;  1QUI A;  3HHG A;  4DXB A;  2Y5L A;  2VPO A;  1O7T A;  2F7B A;  4PET A;  2G93 A;  2ZYN A;  4JWX A;  4BDM A;  1TXF A;  4XKP A;  1ELJ A;  4UAC A;  2VHA A;  2QS4 A;  3EHT A;  4N6K A;  2OZZ A;  4F22 A;  5H8F A;  1LBX A;  3FXR A;  4X9T A;  1N3X A;  4H67 A;  2I49 A;  5CM6 A;  3HO7 A;  4LZ8 A;  4AS5 A;  3TTM A;  2Q2A A;  3O6G A;  2WEF A;  2X7P A;  1D3K A;  5I2N B;  1LAH E;  1US5 A;  3PD8 A;  5I56 B;  2B3B A;  3OD7 A;  5EYG A;  2F34 A;  3OSQ A;  4JDF A;  3RPW A;  4DZ1 A;  3KJ7 A;  4ECF A;  4ZZE A;  5AA2 D;  2O7U A;  3RPL B;  4BDQ A;  3CFL A;  3SEW A;  3O97 A;  4OMB A;  4WED A;  4N17 A;  1EZO A;  1ZLQ A;  4THI A;  2UXA A;  4FIM A;  4WEP A;  2ANJ A;  4KCD A;  4O3A A;  2CEX A;  3GBA A;  1XHY A;  4NF5 B;  4F29 A;  5HBC A;  4HXV A;  3CFX A;  2REJ A;  4YKJ A;  4H45 A;  4FE8 A;  3VVF A;  2REG A;  2I3W A;  3JYR A;  4PC9 A;  2WYP A;  3OO9 A;  4GX4 A;  1OQH A;  4O8M A;  4HS7 A;  3MQ9 A;  4R9F A;  2MKZ A;  3NOH A;  3LSX A;  5A5X A;  2RCB A;  3G3I A;  4NN3 A;  4RK2 A;  3N6T A;  1P99 A;  2XX8 A;  3DP4 A;  2PYY A;  1LLS A;  4XIG Q;  3GXA A;  4YZZ A;  1EZP A;  1HSJ A;  1TWY A;  2OK2 A;  3PD9 A;  5EQ7 A;  2D5W A;  1N7X A;  5F1Q A;  1B52 A;  4P47 A;  1LEV A;  3GBB A;  5AA2 A;  2R9J A;  3L6H A;  4BDO A;  3G3K A;  3RT8 A;  3KZG A;  1MDQ A;  2ZYO A;  3BFT A;  2F97 A;  2F5X A;  4BDN A;  4DIG A;  3VXC A;  4NF6 A;  2A5T B;  4O7M A;  1M5E A;  1A55 A;  3IJO B;  2XWI A;  1LFH A;  1ZKB A;  4LUB A;  5AA1 A;  4RPN A;  1H76 A;  3E79 A;  1RDZ A;  1BLF A;  1MQD A;  4NED A;  5TP9 A;  2H98 A;  4LON B;  4IGT A;  1OVB A;  2PCR A;  5I84 A;  3CSG A;  2G29 A;  1FBH A;  3EPE A;  4PAI A;  3GYY A;  4N8G A;  3B6W A;  4UAB A;  2XXW A;  1NV4 A;  4MIJ A;  2XXI A;  1IMC A;  3K02 A;  3IB1 A;  4DCY A;  2RC9 A;  1QGX A;  3Q25 A;  4GWS A;  4GXA A;  2DXR A;  4FOR A;  1FPF A;  3QXM A;  2HAV A;  2X26 A;  4POX A;  4GFR A;  5I3S A;  4OVR A;  1IIT A;  4P0I A;  3FIR A;  4H1X A;  1FPB A;  4G8M A;  4LN5 A;  3D4C A;  1SW2 A;  2OX3 A;  2IEE A;  2ZXT A;  1VFE A;  1KA1 A;  4GQO A;  2XXQ A;  2A5S A;  1P1N A;  2UYE A;  1FBP A;  2V4C A;  2QMX A;  4X48 A;  2ZYK A;  5FTI A;  4QF9 A;  3QMF A;  4P8B A;  2HHM A;  1KZ8 A;  2ZNU A;  4ZS9 A;  5KDT B;  5EYH A;  1IZ1 A;  1SPI A;  4DI3 D;  5EYF A;  1B3H A;  4PF8 A;  1OLA A;  3C36 A;  2XXH A;  3JZJ A;  4Q5T A;  3KC1 A;  1SVX B;  3BKI B;  5B7D A;  3OO6 A;  1NNT A;  4GWW A;  2Q89 A;  3I3V A;  2Z8E A;  2OWT A;  1YTV A;  2QS2 A;  4AS4 A;  1Y1M A;  4R9G A;  3ZSF A;  2CZI A;  2QL3 A;  3FVO A;  3TTL A;  5ICT A;  3IAZ A;  4YB5 A;  4OEU A;  2O6A A;  4H5F A;  1F9B A;  4TOZ A;  3EQ1 A;  4R6K A;  4H65 A;  3W9W A;  1VE4 A;  3PUZ E;  1NNK A;  1SD3 A;  3LUZ A;  2P2A A;  2OBG A;  3ONM A;  1VR5 A;  1NNP A;  3BIH A;  2H5Y A;  1FSA A;  2UYF A;  1NNF A;  4HE2 A;  3MJN A;  1RYX A;  2WBB A;  3MW0 A;  3DM0 A;  4NAP A;  4N4U A;  2Z23 A;  2L5V A;  1BKA A;  3PV0 E;  3WAE A;  4YAH X;  2OCU A;  1MG1 A;  3KFM A;  4FED A;  1QVS A;  4X1D A;  1DK4 A;  3PU5 A;  5DT6 A;  2H9B A;  1IXI A;  2DE3 A;  5CRY A;  1N7W A;  3HST A;  4OXV A;  1FW0 A;  1FQE A;  2E1S A;  5IZ3 A;  4U1O A;  3TPA A;  1Y4T A;  2FIE A;  5DVI A;  1M5C A;  3BBR A;  4IY5 A;  5FTH A;  3EN3 A;  3OOA A;  1MXZ A;  4EQ9 A;  3UGW A;  4JB7 A;  1JQF A;  3VVE A;  2I3V A;  3WAF A;  3C4M A;  5L9M A;  3CHG A;  2XXX A;  5H8H B;  4JSO A;  3A29 A;  1AIV A;  3VDF A;  1NUX A;  4OFJ A;  1FTM A;  1XS5 A;  5J1D A;  3FD3 A;  4HCW A;  1DSN A;  2HCA A;  3EHS A;  3S9M C;  1SYI A;  2ZMB A;  2KQZ A;  1S7Y A;  3TQL A;  5I59 A;  5DVF A;  3IOV A;  1SYH A;  1GV8 A;  3ISP A;  1LCF A;  2XD3 A;  2HZK A;  4I40 A;  4RPO A;  5DEX A;  1D9V A;  5T3J A;  2XWV A;  3L6G A;  4L17 A;  4YKP A;  4H5G A;  5KZT A;  4H6D A;  1FQB A;  4ZE8 A;  3VE1 B;  5TU0 A;  3U94 A;  4GOT A;  4E0W A;  3MWB A;  4N07 A;  1MH4 A;  3PPR A;  4F19 A;  4I3E A;  2ONK E;  3UA8 A;  2ONR A;  4MBP A;  3HPI A;  5F7V A;  2XXK A;  4ZDM A;  1ANF A;  2FVZ A;  1UTB B;  3S9E A;  4IO5 A;  2R6G E;  1BK4 A;  3PPN A;  1IXG A;  2VT5 A;  4MHF A;  2ZNT A;  4JXI A;  3P7I A;  1FPL A;  1UQW A;  4FEB A;  4KPT A;  2F35 A;  1B32 A;  2RCA A;  3EKI A;  4C1U A;  5EHS A;  4NF8 A;  2F7A A;  5ET8 A;  4ELO A;  1YCJ A;  3K0V A;  2O68 A;  2RKM A;  4OVS A;  5KCJ A;  2V3Q A;  1NV1 A;  3TCH A;  2UVI A;  1DTZ A;  1IQ7 A;  4GIZ A;  1USY H;  2I6E A;  4QSC A;  4NTL A;  4TLM B;  1H43 A;  5H8Q A;  1JEV A;  4U4S A;  1B9J A;  2HFB A;  2QVV A;  2PT2 A;  3C32 A;  2F7C A;  4U4X A;  2Y7W A;  2V93 A;  3FXQ A;  3BFU A;  1Z7M E;  3DEL B;  1FBE A;  3SDF A;  3U8Q A;  1SW1 A;  5IAI A;  1B1X A;  4IO3 A;  2GHA A;  1B46 A;  1INP A;  3B7D A;  2ESN A;  4PQJ A;  1UTH B;  1I6B A;  1MPC A;  3F11 A;  3EF7 A;  1MY1 A;  4N91 A;  1OLC A;  3KEI A;  5ET6 A;  4ZEB A;  1LAX A;  1QKA A;  3ZS6 A;  2QS1 A;  4OQO A;  3V8X B;  5TP9 B;  2V25 A;  3KN7 A;  2FYI A;  4MCO A;  4DI4 B;  3BIG A;  1MY0 A;  3AXF A;  2I48 A;  3Q29 A;  2XXY A;  1RYO A;  4GRK A;  2O51 A;  1LGB C;  5ELV A;  1MY4 A;  1SI1 A;  2PBW A;  5K2Y A;  5F24 A;  1XVY A;  4MJO A;  3KJT A;  4OHN A;  2RF1 A;  3TMG A;  3CIJ A;  1B6H A;  3T96 B;  4OWD A;  4R2F A;  1NFT A;  4QSD A;  2DE4 A;  2ZZW A;  5AE4 A;  4IO4 A;  3SKP A;  4U2R A;  3KOS A;  4MNI A;  5EQA A;  3SEX A;  4RJZ A;  1G0H A;  4PGP A;  4ELR A;  4PAF A;  4PP0 A;  2PMS A;  4QFP A;  4GF8 A;  3A3U A;  1MXW A;  1YZ0 A;  1R9Q A;  1POY 1;  1NV0 A;  2FNC A;  1OMP A;  1T0K A;  5I58 A;  2F78 A;  3QYT A;  1CB6 A;  4XXU A;  3FVN A;  2NWJ A;  4GL8 A;  2CZH A;  4OEN A;  4P11 A;  3THI A;  3HV1 A;  3DLN A;  3D4G A;  3MP1 A;  3PPQ A;  2IA4 A;  2M8C A;  1P1Q A;  3G3G A;  3FUZ A;  3M3K A;  5FHN A;  3H6W A;  4PE5 B;  2P3N A;  3H06 B;  3PMW A;  1GGG A;  4KI0 E;  1DBZ A;  5BUU A;  3T0J A;  5FHO A;  3MVY A;  1LCT A;  5L8D A;  3VLU A;  4NF4 B;  2XWK A;  1K9Y A;  1URS A;  2THI A;  4MAG A;  3C9H A;  3RUM A;  1AL3 A;  4KYD A;  3MUQ A;  1XC1 A;  4I1D A;  2QS3 A;  1UIV A;  3KC0 A;  4KQP A;  4ELP A;  4F1V A;  2GHB A;  4HE0 A;  1UIU A;  4O7I A;  3K2D A;  4XKN A;  5EHM A;  1FJ6 A;  3I6V A;  1B2H A;  4MMP A;  4EF1 A;  5I2K B;  1EYK A;  4G68 A;  1ATG A;  2UVH A;  1LBB A;  1FBC A;  4LQ5 A;  1B4Z A;  5JEI A;  3IL1 B;  2PX1 A;  2F36 A;  4NG7 A;  3HN0 A;  5I57 A;  1FBG A;  5M2V A;  3FJM A;  1XOC A;  4KXP A;  1Q35 A;  2AL4 A;  1LFG A;  3IOR A;  5CBR A;  1D9Y A;  3K1P A;  3TEL A;  1GR2 A;  1NUZ A;  5B70 A;  4EXL A;  2Q8M A;  3E78 A;  2VP1 A;  1BP5 A;  3TOD A;  4PF6 A;  4IO7 A;  5A5L A;  2FA7 A;  2R71 A;  4PFY A;  1H45 A;  3QUF A;  2E0S A;  4NX1 A;  3TEP A;  1HSE A;  2O84 X;  2HXR A;  4DXU A;  4EUO A;  3UK4 A;  2WBD A;  3SEY A;  3KSJ A;  1B05 A;  1PB8 A;  3FXU A;  4DDD A;  4LA9 A;  4KYE A;  4OVQ A;  3OO7 A;  1B3L A;  3N94 A;  3KBZ A;  1AMF A;  4Z0I A;  3PMX A;  4XEQ A;  1B1H A;  1R6Z A;  2Y7P A;  1OQG A;  4F3B A;  4LVQ A;  5ISU A;  3RQT A;  4NGU A;  1NKX A;  3LSL A;  2WX9 A;  4DCX A;  1SDX A;  2WYK A;  4F1U A;  3CRB A;  2DWI A;  4HW8 A;  2PFZ A;  4C1T A;  1FJ9 A;  4OER A;  1B3F A;  2VD2 A;  1LFI A;  4QSE A;  3H6U A;  1FPD A;  1WOD A;  3KGC A;  1LB8 A;  5I56 A;  1KA0 A;  1O64 A;  3T1B A;  3HFU A;  5ET7 A;  4MX6 A;  4F3G A;  2Y7R A;  4MEV A;  4R73 A;  1RDY A;  2DWJ A;  5HPQ A;  4RYA A;  1JP4 A;  1QJM A;  3RPL A;  1JW1 A;  1EU8 A;  1FTO A;  4N8Y A;  4JVC A;  1MY3 A;  3U92 A;  3FZV A;  3E13 X;  3B6Q A;  1B40 A;  1M5D A;  2HEU A;  3O6I A;  2DE2 A;  3T9U A;  3MVX A;  1PB7 A;  1B5I A;  1VDW A;  4NF5 A;  1TFD A;  4ZE9 A;  4N6D A;  5JTY B;  3CG1 A;  3OXN A;  5CMB A;  5TPA A;  4AB5 A;  1R9L A;  2DDK A;  4U22 A;  3G3F A;  5LDZ A;  1MY2 A;  2DXY A;  3V83 A;  4OTE A;  3FVK A;  4YB7 A;  3UIF A;  3U1O A;  3C33 A;  5H8N B;  1B7H A;  1RKM A;  1ZMG A;  5H8S A;  3K01 A;  3QIM A;  1FQD A;  1FQA A;  3Q26 A;  4NHB A;  3U72 A;  2PFY A;  3ZKL A;  1FPI A;  4YMB A;  2OWS A;  1MS7 A;  4EQB A;  2H99 A;  3B8B A;  3KN3 A;  4F31 B;  2FIX A;  3H03 A;  2V3T A;  4YKI A;  1NMU A;  3FAT A;  4ZEK A;  4NQ8 A;  3O6H A;  3K6U A;  2F3D A;  4PFW A;  2A5T A;  1DOT A;  1IEJ A;  5L9S A;  3OEK A;  4WXJ A;  3ZKK A;  1IMB A;  4PFT A;  3O9P A;  1O63 A;  2XHD A;  1P1U A;  3V5A A;  1ZTY A;  4PGN A;  2DSF A;  3A09 A;  1B7U A;  2UVJ A;  4AB6 A;  3S4U A;  1DPE A;  4M1V A;  2XA5 A;  4PCD A;  2NOO A;  3I5O A;  3KN8 A;  3PUW E;  2GH9 A;  4IY6 A;  3QK6 A;  2PT1 A;  4ZEF A;  1L5T A;  3TTN A;  2ZZX A;  4PFR A;  4LQ2 A;  1VSO A;  2Y7I A;  2CEY A;  3GLB A;  1SW5 A;  4MNP A;  1IMA A;  5ICQ A;  1QUK A;  4EF2 A;  1S9T A;  3G3H A;  5CBS A;  5AA4 B;  4H46 A;  3SET A;  3OSR A;  1IUD A;  1US4 A;  3O29 A;  2XWO A;  1QUJ A;  1MQI A;  3GZG A;  4GXS B;  4TQU Q;  5I7I A;  1FTL A;  2B4M A;  5H8F B;  3S2V A;  1JVY A;  3MC2 A;  2B65 A;  3IB2 A;  3MPL A;  2ZZV A;  1LBY A;  1IMD A;  3CR9 A;  5DTB A;  3O2A A;  4RK9 A;  4QFK A;  4OFL A;  1RDX A;  4M4G A;  3VLV A;  4U21 A;  1NV3 A;  3OO8 A;  3VLW A;  2V3U A;  3U65 A;  4KR5 A;  1YAE A;  5ESY A;  1POT A;  4QRZ A;  3TTR A;  4ESW A;  1EYI A;  5KDT A;  1NUY A;  5DW8 A;  1FPJ A;  1Y3N A;  1XI6 A;  1I69 A;  3O28 A;  3RNN A;  4N6P A;  3H7M A;  4H8I A;  3EHU A;  2GRV A;  3C34 A;  5IZ1 A;  2Z8D A;  1HSL A;  4OVT A;  3K6V A;  4MH5 A;  1Q1K A;  1FQF A;  1NI9 A;  3T66 A;  3RGY A;  3RT6 B;  4AQ4 A;  2P0S A;  4BDR A;  1FPK A;  1B7Z A;  3Q27 A;  3K1N A;  1Y1Z A;  4YB6 A;  1XVX A;  3VFJ A;  4JWY A;  4BLA A;  3LUY A;  4R74 A;  3OEL A;  3TTK A;  3E4R A;  2I4B A;  2Y84 A;  4F2Q A;  1A99 A;  5FHM A;  1K9Z A;  3PGF A;  3IOW A;  4F3P A;  3H3G A;  3MBP A;  1D9Q A;  2AL5 A;  4PDH A;  4JSD A;  3H6V A;  5L9O A;  1Z7N E;  5A5X B;  4RA1 A;  4RXL A;  3UP9 A;  2O1L A;  4I9D A;  1FTJ A;  3G3J A;  4P0G A;  2NUV A;  2XX7 A;  1N0T A;  4HCY A;  4POW A;  3LSF B;  3VXB A;  2XXR A;  1H44 A;  4OYV A;  3IFC A;  4ZED A;  2ZNS A;  3IR1 A;  4ZEI A;  3MZ1 A;  4GWX A;  2PVU A;  4JBZ A;  4MFI A;  5DYH A;  1XT8 A;  1MM7 A;  3R6U A;  5AA2 B;  4FAJ A;  3OEN A;  4IGR A;  2FHY A;  3E3K A;  4JVD A;  1B5H A;  4NF0 A;  1B51 A;  1B4H A;  3RLF E;  2QFL A;  5EQ8 A;  4NF6 B;  1YPN A;  3D1R A;  2I0C A;  3FAS A;  4KD5 A;  3CG3 A;  2Z22 A;  1URD A;  5K2X A;  4GWO A;  1N84 A;  4NMY A;  4OVJ A;  3U93 A;  3TAJ A;  2O69 A;  4QFN A;  2NXO A;  4QBA A;  4R75 A;  4OET A;  1EYJ A;  2JJK A;  2RC8 A;  3N5L A;  4GVO A;  4JVI A;  4P1L A;  1EZ9 A;  5H8H A;  3ECR A;  3T9X B;  2HQ0 A;  1Y20 A;  4OVP A;  4O3C A;  4HE1 A;  3TCG A;  2O1M A;  4EXK A;  3USD A;  1SW4 A;  2QJE A;  4Q0C A;  1LB9 A;  3JV9 A;  4R72 A;  2GQ1 A;  3E9X A;  2Q9T A;  2HXW A;  2XX9 A;  4GBW A;  1NL5 A;  2DWA A;  3ILU B;  4IR8 A;  4OAN A;  4P3L A;  4OZ9 A;  2Y7K A;  3RYD A;  1GVC A;  4FEC A;  1N3W A;  1PB9 A;  1ZBM A;  5CMK A;  1MQG A;  1N76 A;  1PDA A;  3N6U A;  1MDP 1;  3C31 A;  4PFI A;  4ESX A;  1A40 A;  2Y5K A;  3LBS A;  2I0B A;  1DPP A;  4HTG A;  4IO2 A;  3K00 A;  1A8E A;  3UN6 A;  5J16 A;  4P9K A;  3SEU A;  2XD2 A;  3H4Z A;  3R26 A;  4N15 A;  4K3F A;  4KHZ E;  5ET5 A;  2YJP A;  1UTB A;  4XTC Q;  4OES A;  1MPB A;  1MQJ A;  3IX1 A;  5TPA B;  3TKD A;  1QUL A;  2DWH A;  3MP8 A;  4GBV A;  3LV0 A;  1A54 A;  2CZL A;  3CVG A;  3KSX A;  1WDN A;  3PUY E;  3S9L C;  3SEV A;  3G7W A;  1KWH A;  1NH7 A;  2BJJ X;  4QHQ A;  1TFA A;  4G4P A;  4GWZ A;  1JW5 A;  1Y9U A;  1DMB A;  2VPN A;  2VD3 A;  1I6A A;  1OVT A;  3B50 A;  4MF3 A;  3QAX A;  1FBF A;  1AH5 A;  4XKR A;  4GWY A;  4NE4 A;  1SQY A;  4R2B A;  4H0W A;  1NV2 A;  2O7I A;  4X04 A;  3W15 C;  4PDD A;  4YKK A;  4X1B A;  2F6P A;  3MZB A;  2ZYM A;  3QUJ A;  1UTH A;  3CFZ A;  4G8H A;  2ALU A;  2DOJ A;  4LP2 B;  2WKY A;  2D21 A;  1JEU A;  4R6Y A;  1LBV A;  4Z7E A;  4RNS A;  5FBP A;  4PE3 A;  4Q8R A;  2Z8F A;  1IXH A;  1PEB A;  4G77 A;  3KOT A;  2YPN A;  4G8N A;  3CSB A;  1FPE A;  1LAG E;  1YXI A;  3IOU A;  4GD5 A;  4Q30 B;  5IZ3 B;  4ZZA A;  3UOR A;  5IKB A;  2UVG A;  1S50 A;  3SES A;  2W7Y A;  2HAU A;  4XKQ A;  1IIW A;  4G68 C;  3IFA A;  3VV5 A;  3IJX B;  5I2N A;  2XXP A;  2LAO A;  4DLD A;  1N04 A;  4DXC A;  5CC2 A;  3LC8 A;  3LR1 A;  4DE8 A;  1I6Q A;  4EQ7 A;  3Q28 A;  4P56 A;  2KR0 A;  1NV7 A;  5LTC A;  5CMM A;  1M5B A;  2AYS A;  1WVJ A;  1CE2 A;  3FBP A;  4G61 A;  4GL0 A;  3RTW B;  1JET A;  2XXT A;  4PTK A;  3KG2 A;  2D3I A;  5I59 B;  2F3B A;  2AIX A;  1H3D A;  4QFO A;  3KBR A;  4C0R A;  4KYS A;  5DEX B;  2QRY A;  4U23 A;  1DCU A;  4KCC A;  3M3F A;  1LBC A;  1Y3P A;  4GWU A;  2GFE A;  4MNC A;  4X8R A;  1MQH A;  4N81 A;  3TYH A;  4NF4 A;  2DP8 A;  3PMV A;  3MP6 A;  4U1Z A;  1FBD A;  3V89 B;  5ITP A;  1D4N A;  3QSL A;  3M3L A;  4I62 A;  2HPG A;  3H6T A;  4GLI A;  2KLF A;  4ONY A;  1LST A;  2YLN A;  4JWO A;  4NWD A;  2XXU A;  4O3B A;  4GX6 A;  2Q74 A;  1P1O A;  3HHF A;  3SER A;  5CI5 A;  3MVZ A;  1MXV A;  4FBP A;  1II5 A;  2X7Q A;  2OWZ A;  1IMF A;  1NUW A;  5I2K A;  5IM2 A;  2I4C A;  3MYU A;  3T93 B; 
#chains in the Genus database with same CATH homology
 4OFO A;  4F18 A;  1JNF A;  3IB0 A;  2DS9 A;  3FGS A;  4NF8 B;  4F2O A;  4PFU A;  5KCJ B;  3OEM A;  1QW0 A;  2V84 A;  3TZA A;  1B0L A;  3ILT B;  2H25 A;  1A7L A;  5H8Q B;  4IB2 A;  1QKB A;  3TQW A;  2P1S A;  2RC7 A;  5AA3 A;  3B6T A;  4LZ5 A;  1Y3Q A;  4ISU A;  3T9H B;  2Q8J A;  1MXU A;  3PUX E;  3MVW A;  2OJT A;  1MXX A;  4MLQ A;  4ND9 A;  4YU0 A;  3MAM A;  4LAT A;  1SI0 A;  3DP6 A;  1LAF E;  3T9V A;  3FV2 A;  2F6G A;  2ABH A;  3TFL A;  2DQV A;  1MH3 A;  2HZL A;  4YIC A;  5JK4 A;  4F1Y A;  2VGQ A;  3K4U A;  4I8C A;  3N26 A;  2DVC A;  4WKM A;  4E0X A;  5ITO A;  3K6X A;  4MLV A;  3PPO A;  3C35 A;  3M8U A;  4FJP A;  4IO6 A;  1ZU0 A;  1PC3 A;  3RN8 A;  4ELQ A;  3ODB A;  1URG A;  1EH3 A;  2QMW A;  1FTK A;  1PBQ A;  2QSX A;  4KFQ A;  3W9V A;  3OMB A;  1SBP A;  4YMA A;  1B5J A;  3CI8 A;  3IOT A;  2CMO A;  1DTG A;  1NH8 A;  3K1M A;  2DYX A;  1MXY A;  3FV1 A;  1IXC A;  4H8J A;  3TUS A;  3RY3 A;  2XXV A;  1OIB A;  5JTY A;  3IO4 A;  1B3E A;  1FQC A;  2Q2C A;  4N13 A;  2QPQ A;  3MZ9 A;  3PUV E;  5I58 B;  3FJ7 A;  3IK6 B;  5H8N A;  3PPP A;  3TDJ A;  3TCF A;  2VOZ A;  4FAT A;  3A3C A;  3FJG A;  1B58 A;  1MRP A;  4QFL A;  5BWJ A;  2F8D A;  1AOV A;  3K6W A;  3S9N C;  1FCK A;  3VVD A;  3HCQ A;  5DVJ A;  5CMC A;  3MPK A;  1ZJL A;  1USY E;  1A8F A;  3FVG A;  1R1N A;  2I58 A;  1Y4C A;  1GTK A;  4R6H A;  1B3G A;  3O66 A;  4ZEC A;  2Q88 A;  3DP8 A;  1BTJ A;  4G68 B;  3T22 A;  1BIY A;  4TLL B;  1M5F A;  2NVU B;  5LOM A;  5I57 B;  1JW4 A;  3LSW A;  4G2Z A;  1MPD A;  3RTF B;  4LZ7 A;  4RY1 A;  1MM6 A;  4UA8 A;  1J1N A;  1VFD A;  1ZIU A;  2ONS A;  4EDP A;  1TT1 A;  5HM4 B;  2B3F A;  2H4I A;  3IO6 A;  4OEV A;  4F39 A;  1JVX A;  1B0H A;  2OLB A;  3R7X A;  4BDL A;  2RIN A;  5AA4 A;  4NWC A;  4F3S A;  1PBP A;  2DVZ A;  1P1W A;  1QUI A;  3HHG A;  4DXB A;  1O7T A;  2F7B A;  4PET A;  2G93 A;  2ZYN A;  4JWX A;  4BDM A;  1TXF A;  4XKP A;  1ELJ A;  4UAC A;  2VHA A;  2QS4 A;  3EHT A;  4F22 A;  2OZZ A;  5H8F A;  3FXR A;  4X9T A;  1N3X A;  4H67 A;  2I49 A;  5CM6 A;  3HO7 A;  4LZ8 A;  3TTM A;  2Q2A A;  3O6G A;  2X7P A;  1D3K A;  5I2N B;  1LAH E;  1US5 A;  3PD8 A;  5I56 B;  2B3B A;  3OD7 A;  2F34 A;  3OSQ A;  4JDF A;  3RPW A;  4DZ1 A;  3KJ7 A;  4ECF A;  4ZZE A;  5AA2 D;  2O7U A;  4BDQ A;  3CFL A;  3SEW A;  3O97 A;  4OMB A;  4WED A;  1EZO A;  1ZLQ A;  4THI A;  2UXA A;  4FIM A;  4WEP A;  2ANJ A;  4KCD A;  4O3A A;  3GBA A;  1XHY A;  4NF5 B;  4F29 A;  5HBC A;  3CFX A;  2REJ A;  4YKJ A;  4FE8 A;  3VVF A;  2REG A;  2I3W A;  3JYR A;  3OO9 A;  1OQH A;  4HS7 A;  3MQ9 A;  4R9F A;  3LSX A;  5A5X A;  2RCB A;  3G3I A;  4RK2 A;  3N6T A;  1P99 A;  2XX8 A;  3DP4 A;  2PYY A;  1LLS A;  4XIG Q;  3GXA A;  4YZZ A;  1EZP A;  1HSJ A;  1TWY A;  2OK2 A;  3PD9 A;  2D5W A;  1N7X A;  5F1Q A;  1B52 A;  3GBB A;  5AA2 A;  2R9J A;  3L6H A;  4BDO A;  3G3K A;  3RT8 A;  3KZG A;  1MDQ A;  2ZYO A;  3BFT A;  2F97 A;  2F5X A;  4BDN A;  4DIG A;  3VXC A;  4NF6 A;  2A5T B;  1M5E A;  1A55 A;  3IJO B;  1LFH A;  1ZKB A;  4LUB A;  5AA1 A;  4RPN A;  1H76 A;  1BLF A;  1MQD A;  4NED A;  5TP9 A;  2H98 A;  4LON B;  4IGT A;  1OVB A;  5I84 A;  3CSG A;  2G29 A;  3EPE A;  3B6W A;  2XXW A;  2XXI A;  3K02 A;  3IB1 A;  4DCY A;  2RC9 A;  3Q25 A;  4GXA A;  2DXR A;  4FOR A;  3QXM A;  2HAV A;  2X26 A;  4POX A;  4GFR A;  1IIT A;  4P0I A;  3FIR A;  4H1X A;  4G8M A;  3D4C A;  1SW2 A;  2IEE A;  2ZXT A;  1VFE A;  4GQO A;  2XXQ A;  2A5S A;  1P1N A;  2UYE A;  2QMX A;  4X48 A;  2ZYK A;  5FTI A;  4QF9 A;  2ZNU A;  4ZS9 A;  5KDT B;  1IZ1 A;  5EYF A;  1B3H A;  1OLA A;  3C36 A;  2XXH A;  3JZJ A;  4Q5T A;  1SVX B;  3BKI B;  5B7D A;  3OO6 A;  1NNT A;  2Q89 A;  3I3V A;  2Z8E A;  2OWT A;  1YTV A;  2QS2 A;  1Y1M A;  4R9G A;  3ZSF A;  2QL3 A;  3FVO A;  3TTL A;  5ICT A;  3IAZ A;  4YB5 A;  4OEU A;  2O6A A;  4H5F A;  1F9B A;  4TOZ A;  3EQ1 A;  4R6K A;  4H65 A;  3W9W A;  1VE4 A;  3PUZ E;  1NNK A;  1SD3 A;  2P2A A;  2OBG A;  3ONM A;  1VR5 A;  1NNP A;  2H5Y A;  2UYF A;  1NNF A;  3MJN A;  1RYX A;  3MW0 A;  3DM0 A;  2Z23 A;  1BKA A;  3PV0 E;  3WAE A;  4YAH X;  2OCU A;  1MG1 A;  3KFM A;  4FED A;  1QVS A;  4X1D A;  3PU5 A;  5DT6 A;  2H9B A;  1IXI A;  2DE3 A;  5CRY A;  1N7W A;  3HST A;  4OXV A;  1FW0 A;  1FQE A;  2E1S A;  4U1O A;  3TPA A;  1Y4T A;  5DVI A;  1M5C A;  3BBR A;  4IY5 A;  5FTH A;  3EN3 A;  3OOA A;  1MXZ A;  4EQ9 A;  3UGW A;  4JB7 A;  1JQF A;  3VVE A;  2I3V A;  3WAF A;  3C4M A;  5L9M A;  2XXX A;  5H8H B;  4JSO A;  1AIV A;  3VDF A;  4OFJ A;  1FTM A;  1XS5 A;  5J1D A;  3FD3 A;  4HCW A;  1DSN A;  2HCA A;  3EHS A;  3S9M C;  1SYI A;  2ZMB A;  1S7Y A;  3TQL A;  5I59 A;  5DVF A;  3IOV A;  1SYH A;  1GV8 A;  1LCF A;  2XD3 A;  2HZK A;  4RPO A;  5DEX A;  1D9V A;  3L6G A;  4L17 A;  4YKP A;  4H5G A;  5KZT A;  4H6D A;  1FQB A;  4ZE8 A;  3VE1 B;  5TU0 A;  3U94 A;  4E0W A;  4GOT A;  3MWB A;  4N07 A;  1MH4 A;  3PPR A;  4F19 A;  2ONK E;  3UA8 A;  2ONR A;  4MBP A;  3HPI A;  5F7V A;  4ZDM A;  1ANF A;  1UTB B;  3S9E A;  4IO5 A;  2R6G E;  3PPN A;  1IXG A;  2ZNT A;  4JXI A;  3P7I A;  1UQW A;  4FEB A;  4KPT A;  2F35 A;  1B32 A;  2RCA A;  4C1U A;  5EHS A;  4NF8 A;  2F7A A;  4ELO A;  1YCJ A;  3K0V A;  2O68 A;  2RKM A;  5KCJ A;  2V3Q A;  3TCH A;  2UVI A;  1DTZ A;  1IQ7 A;  4GIZ A;  1USY H;  2I6E A;  4QSC A;  4NTL A;  4TLM B;  1H43 A;  5H8Q A;  1JEV A;  4U4S A;  1B9J A;  2HFB A;  2PT2 A;  3C32 A;  2F7C A;  4U4X A;  2Y7W A;  2V93 A;  3FXQ A;  3BFU A;  1Z7M E;  3DEL B;  3SDF A;  3U8Q A;  1SW1 A;  5IAI A;  1B1X A;  4IO3 A;  2GHA A;  1B46 A;  3B7D A;  2ESN A;  4PQJ A;  1UTH B;  1I6B A;  1MPC A;  3F11 A;  3EF7 A;  1MY1 A;  1OLC A;  3KEI A;  4ZEB A;  1LAX A;  1QKA A;  3ZS6 A;  2QS1 A;  4OQO A;  3V8X B;  5TP9 B;  2V25 A;  3KN7 A;  2FYI A;  1MY0 A;  3AXF A;  2I48 A;  3Q29 A;  2XXY A;  1RYO A;  4GRK A;  2O51 A;  1LGB C;  5ELV A;  1MY4 A;  1SI1 A;  2PBW A;  5K2Y A;  1XVY A;  3KJT A;  4OHN A;  2RF1 A;  3TMG A;  3CIJ A;  1B6H A;  3T96 B;  4OWD A;  4R2F A;  1NFT A;  4QSD A;  2DE4 A;  5AE4 A;  4IO4 A;  3SKP A;  4U2R A;  3KOS A;  3SEX A;  4RJZ A;  4ELR A;  4PP0 A;  2PMS A;  4QFP A;  4GF8 A;  3A3U A;  1MXW A;  1R9Q A;  1POY 1;  2FNC A;  1OMP A;  1T0K A;  5I58 A;  2F78 A;  3QYT A;  1CB6 A;  4XXU A;  3FVN A;  2NWJ A;  4GL8 A;  4OEN A;  4P11 A;  3THI A;  3HV1 A;  3DLN A;  3D4G A;  3MP1 A;  3PPQ A;  2IA4 A;  2M8C A;  1P1Q A;  3G3G A;  3FUZ A;  3M3K A;  5FHN A;  3H6W A;  4PE5 B;  3H06 B;  3PMW A;  1GGG A;  4KI0 E;  5BUU A;  5FHO A;  3MVY A;  1LCT A;  5L8D A;  3VLU A;  4NF4 B;  1URS A;  2THI A;  3C9H A;  3RUM A;  1AL3 A;  4KYD A;  3MUQ A;  1XC1 A;  4I1D A;  2QS3 A;  1UIV A;  4KQP A;  4ELP A;  4F1V A;  2GHB A;  1UIU A;  3K2D A;  4XKN A;  5EHM A;  3I6V A;  1B2H A;  4EF1 A;  5I2K B;  4G68 A;  1ATG A;  2UVH A;  1LBB A;  4LQ5 A;  1B4Z A;  5JEI A;  3IL1 B;  2PX1 A;  2F36 A;  3HN0 A;  5I57 A;  5M2V A;  3FJM A;  1XOC A;  1Q35 A;  2AL4 A;  1LFG A;  3IOR A;  5CBR A;  1D9Y A;  3K1P A;  3TEL A;  1GR2 A;  5B70 A;  4EXL A;  2VP1 A;  1BP5 A;  3TOD A;  4IO7 A;  2FA7 A;  2R71 A;  4PFY A;  1H45 A;  3QUF A;  2E0S A;  3TEP A;  1HSE A;  2O84 X;  4DXU A;  4EUO A;  3UK4 A;  3SEY A;  3KSJ A;  1B05 A;  1PB8 A;  3FXU A;  4DDD A;  4LA9 A;  4KYE A;  3OO7 A;  1B3L A;  3N94 A;  1AMF A;  4Z0I A;  3PMX A;  1B1H A;  1R6Z A;  2Y7P A;  1OQG A;  4F3B A;  4LVQ A;  5ISU A;  3RQT A;  1NKX A;  3LSL A;  4DCX A;  1SDX A;  4F1U A;  3CRB A;  2DWI A;  4HW8 A;  4C1T A;  4OER A;  1B3F A;  2VD2 A;  1LFI A;  4QSE A;  3H6U A;  1WOD A;  3KGC A;  1LB8 A;  5I56 A;  1O64 A;  4F3G A;  2Y7R A;  4R73 A;  2DWJ A;  5HPQ A;  4RYA A;  1QJM A;  1JW1 A;  1EU8 A;  1FTO A;  1MY3 A;  3U92 A;  3FZV A;  3E13 X;  3B6Q A;  1B40 A;  1M5D A;  2HEU A;  3O6I A;  2DE2 A;  3T9U A;  3MVX A;  1PB7 A;  1B5I A;  4NF5 A;  1TFD A;  4ZE9 A;  5JTY B;  3CG1 A;  3OXN A;  5CMB A;  5TPA A;  4AB5 A;  1R9L A;  4U22 A;  3G3F A;  1MY2 A;  2DXY A;  3V83 A;  4OTE A;  3FVK A;  4YB7 A;  3UIF A;  3U1O A;  3C33 A;  5H8N B;  1B7H A;  1RKM A;  1ZMG A;  5H8S A;  3K01 A;  3QIM A;  1FQD A;  1FQA A;  3Q26 A;  3U72 A;  3ZKL A;  4YMB A;  2OWS A;  1MS7 A;  4EQB A;  2H99 A;  3KN3 A;  4F31 B;  3H03 A;  2V3T A;  4YKI A;  1NMU A;  3FAT A;  4ZEK A;  3O6H A;  3K6U A;  4PFW A;  2A5T A;  1DOT A;  1IEJ A;  5L9S A;  3OEK A;  4WXJ A;  3ZKK A;  4PFT A;  3O9P A;  1O63 A;  2XHD A;  1P1U A;  3V5A A;  1ZTY A;  2DSF A;  3A09 A;  1B7U A;  2UVJ A;  4AB6 A;  3S4U A;  1DPE A;  4M1V A;  2NOO A;  3I5O A;  3KN8 A;  3PUW E;  2GH9 A;  4IY6 A;  3QK6 A;  2PT1 A;  4ZEF A;  1L5T A;  3TTN A;  4LQ2 A;  1VSO A;  2Y7I A;  3GLB A;  1SW5 A;  5ICQ A;  1QUK A;  4EF2 A;  1S9T A;  3G3H A;  5CBS A;  5AA4 B;  3SET A;  3OSR A;  1IUD A;  1US4 A;  3O29 A;  1QUJ A;  1MQI A;  3GZG A;  4GXS B;  4TQU Q;  1FTL A;  3S2V A;  5H8F B;  1JVY A;  3MC2 A;  2B65 A;  3IB2 A;  3MPL A;  3CR9 A;  5DTB A;  3O2A A;  4RK9 A;  4QFK A;  4OFL A;  4M4G A;  3VLV A;  4U21 A;  3VLW A;  3OO8 A;  2V3U A;  4KR5 A;  1YAE A;  1POT A;  4QRZ A;  3TTR A;  4ESW A;  5KDT A;  1Y3N A;  1I69 A;  3O28 A;  3RNN A;  4N6P A;  3H7M A;  4H8I A;  3EHU A;  2GRV A;  3C34 A;  2Z8D A;  1HSL A;  3K6V A;  4MH5 A;  1Q1K A;  1FQF A;  3T66 A;  3RGY A;  3RT6 B;  4AQ4 A;  2P0S A;  4BDR A;  1B7Z A;  3Q27 A;  3K1N A;  1Y1Z A;  4YB6 A;  1XVX A;  3VFJ A;  4JWY A;  4BLA A;  3LUY A;  4R74 A;  3OEL A;  3TTK A;  3E4R A;  2I4B A;  2Y84 A;  4F2Q A;  1A99 A;  5FHM A;  3PGF A;  3IOW A;  4F3P A;  3H3G A;  3MBP A;  2AL5 A;  4JSD A;  3H6V A;  5L9O A;  1Z7N E;  5A5X B;  4RA1 A;  4RXL A;  3UP9 A;  2O1L A;  4I9D A;  1FTJ A;  3G3J A;  4P0G A;  2NUV A;  2XX7 A;  1N0T A;  4HCY A;  4POW A;  3LSF B;  3VXB A;  2XXR A;  1H44 A;  4OYV A;  4ZED A;  2ZNS A;  3IR1 A;  4ZEI A;  3MZ1 A;  2PVU A;  4JBZ A;  4MFI A;  5DYH A;  1XT8 A;  1MM7 A;  3R6U A;  5AA2 B;  4FAJ A;  3OEN A;  4IGR A;  3E3K A;  1B5H A;  1B51 A;  1B4H A;  3RLF E;  4NF6 B;  1YPN A;  2I0C A;  3FAS A;  4KD5 A;  3CG3 A;  2Z22 A;  1URD A;  5K2X A;  4GWO A;  1N84 A;  4NMY A;  4OVJ A;  3U93 A;  3TAJ A;  2O69 A;  4QFN A;  2NXO A;  4R75 A;  4OET A;  2RC8 A;  3N5L A;  4GVO A;  1EZ9 A;  5H8H A;  3ECR A;  3T9X B;  2HQ0 A;  1Y20 A;  4O3C A;  3TCG A;  2O1M A;  4EXK A;  3USD A;  1SW4 A;  2QJE A;  4Q0C A;  1LB9 A;  3JV9 A;  4R72 A;  3E9X A;  2Q9T A;  2HXW A;  2XX9 A;  1NL5 A;  2DWA A;  3ILU B;  4OZ9 A;  2Y7K A;  1GVC A;  4FEC A;  1N3W A;  1PB9 A;  1ZBM A;  5CMK A;  1MQG A;  1N76 A;  1PDA A;  3N6U A;  1MDP 1;  3C31 A;  4ESX A;  1A40 A;  3LBS A;  2I0B A;  1DPP A;  4HTG A;  4IO2 A;  3K00 A;  1A8E A;  3UN6 A;  3SEU A;  2XD2 A;  3H4Z A;  3R26 A;  4K3F A;  4KHZ E;  2YJP A;  1UTB A;  4XTC Q;  4OES A;  1MPB A;  1MQJ A;  3IX1 A;  5TPA B;  3TKD A;  1QUL A;  2DWH A;  3MP8 A;  1A54 A;  2CZL A;  3CVG A;  3KSX A;  1WDN A;  3PUY E;  3S9L C;  3SEV A;  3G7W A;  1KWH A;  1NH7 A;  2BJJ X;  4QHQ A;  1TFA A;  4G4P A;  1JW5 A;  1Y9U A;  1DMB A;  2VD3 A;  1I6A A;  1OVT A;  4MF3 A;  3QAX A;  1AH5 A;  4XKR A;  4NE4 A;  1SQY A;  4R2B A;  4H0W A;  2O7I A;  3W15 C;  4YKK A;  4X1B A;  2F6P A;  3MZB A;  2ZYM A;  3QUJ A;  1UTH A;  3CFZ A;  4G8H A;  2ALU A;  2DOJ A;  4LP2 B;  2WKY A;  2D21 A;  1JEU A;  4R6Y A;  4Z7E A;  4RNS A;  4Q8R A;  2Z8F A;  1IXH A;  1PEB A;  4G77 A;  3KOT A;  2YPN A;  4G8N A;  3CSB A;  1LAG E;  3IOU A;  4GD5 A;  4Q30 B;  4ZZA A;  3UOR A;  5IKB A;  2UVG A;  1S50 A;  3SES A;  2W7Y A;  2HAU A;  4XKQ A;  1IIW A;  4G68 C;  3VV5 A;  3IJX B;  5I2N A;  2XXP A;  2LAO A;  4DLD A;  1N04 A;  4DXC A;  5CC2 A;  3LC8 A;  3LR1 A;  4DE8 A;  1I6Q A;  4EQ7 A;  3Q28 A;  5CMM A;  1M5B A;  2AYS A;  1WVJ A;  1CE2 A;  4GL0 A;  3RTW B;  1JET A;  2XXT A;  3KG2 A;  2D3I A;  5I59 B;  2AIX A;  1H3D A;  4QFO A;  3KBR A;  4C0R A;  4KYS A;  5DEX B;  2QRY A;  4U23 A;  4KCC A;  3M3F A;  1LBC A;  1Y3P A;  2GFE A;  1MQH A;  3TYH A;  4NF4 A;  2DP8 A;  3PMV A;  3MP6 A;  4U1Z A;  3V89 B;  5ITP A;  1D4N A;  3QSL A;  3M3L A;  4I62 A;  3H6T A;  4GLI A;  2KLF A;  4ONY A;  1LST A;  2YLN A;  4JWO A;  4NWD A;  2XXU A;  4O3B A;  1P1O A;  3HHF A;  3SER A;  5CI5 A;  3MVZ A;  1MXV A;  1II5 A;  2X7Q A;  5I2K A;  2I4C A;  3T93 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...