1IJ8A

Crystal structure of lite avidin-bni complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
118
Chain Sequence
b'KCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYTTAVTNEIKESPLHGTENTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AVIDIN
publication title Chicken avidin exhibits pseudo-catalytic properties. Biochemical, structural, and electrostatic consequences.
pubmed doi rcsb
molecule tags Unknown function
total genus 24
structure length 118
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1ij8A00
1SWJA 2C4IA 1SWKA 1MM9A 1MK5A 5JD2A 2FHLA 1LCVA 3WZNA 4BX6B 2FHNX 4Z27A 3MM0A 1N43A 1RXJA 2RTKA 4CPIA 2RTNB 1N9MA 3SZIA 2IZJA 5L3YA 1SWRA 2RTAA 3WYQA 2F01A 2RTRB 4CPHA 2IZGB 2UZ2A 4BBOA 1VWFB 2G5LA 4GD9A 2IZLB 1RSTB 5F2BA 1MOYA 1VWJB 2AVIA 3RE5A 3RY1A 4CPFA 1N4JA 5B5GA 4Z2VA 4Z2OA 2RTFB 3PK2A 2RTQB 1SWOA 2ZSCA 4JO6A 1SWLA 4CPHB 4Z6JA 3WZOA 1AVEA 1KL5A 4BCSA 1PTSA 4IRWA 4Z2PA 3RE6A 4U46A 5K67A 1SWSA 1VWPB 1KFFA 1VWQB 2GH7A 2IZFB 3VHMA 1VWAB 3FDCA 5CHKA 1SWFA 4Y5DA 1SWDA 4GJSA 1STSB 2RTMA 3T6FA 1KL4A 1SWCA 2Y32A 1SLFB 2OF8A 1RXHA 2IZDB 3RY2A 2RTHB 3RDXA 2C1SA 4OKAA 2RTGB 2Y3EA 1SWBA 5B5FA 2RTDB 4YVBA 2RTEB 2RTCB 1VWKB 2IZHB 1VWGB 4GJVA 1SRFA 2OF9A 1LUQA 1SWNA 1SRIA 2IZBA 1STRB 2BC3A 2RTBB 4Y59A 2RTLA 3SZHA 3RDMA 1RAVA 1WBIA 2IZCB 3MG5A 4BX5B 1VWBB 4DNEA 2Y3FA 4GGTA 1Y55X 1SREA 4EKVA 1SWPA 3EW2A 5IRUA 1N7YA 1SLGB 1NDJA 2OFBA 2CAMA 2IZAA 2WPUA 1LELA 1AVDA 2IZEB 1SWQA 4CPEA 5IRAA 1SLEB 1STPA 1HXZA 3WYPA 1Y52X 1Y53X 1VWLB 2A8GA 1HY2A 1VWOB 3SZJA 3WZPA 3RDUA 4I60A 1VWNB 1IJ8A 1SRGA 1VWHB 3VHHA 3X00A 4BX5A 1VWRB 1LDOA 1SWGA 2IZIA 3EW1A 1LCZA 3T2WA 5IRWA 1MEPA 4BJ8A 1I9HA 1SWAA 1SWUA 1VWMB 1VYOA 1VWCB 3RDQA 3VHIA 3RDOA 2IZKA 4GGZA 4JHQA 1RXKA 2OFAA 1SWHA 4BX7A 1DF8A 2RTIB 2C1QA 2QCBA 2RTPB 4JNJA 3T2XA 1N9YA 1LDQA 3T6LA 1NQMA 1VWDB 1HXLA 1NC9A 1RSUB 1LCWA 2MF6A 4Z28A 5K68A 1HQQA 1SWEA 3RDSA 1SRJA 4BX7B 1NQNA 4GDAA 1SWTA 1VWEB 1SRHA 2A5CA 2RTJA 1KL3A 2RTOB 1NBXA 2A5BA 1SLDB 1VWIB 2JGSA 4BX6A 5CSEA 2UYWA 4GGRA 3WZQA 3VGWA
chains in the Genus database with same CATH superfamily
5B29A 4AZPA 3S5XA 3WXQA 5JD2A 3P24A 2QOMA 1FEMA 1G7NA 3FELA 1I78A 3RKGA 3TGBA 2NNQA 2FHNX 1G85A 3PDFA 2NNDA 3MM0A 2RQ0A 5DPQA 4NYQA 1U18A 2RTKA 1BSQA 3NPOA 4C5PA 2X45A 4YBPA 1X8UA 4KC7A 2LBVA 3WYQA 4EXZA 4MEEA 4EQAC 1DZKA 1AQBA 2Q9SA 4GD9A 4XMEA 1YWCA 1KT3A 1MOYA 1VWJB 3APXA 4CPFA 4EEJA 5HZ9A 1OBQA 4Z2VA 2RTQB 1EIIA 4JO6A 2PI3O 3PEDA 1BEBA 1SWLA 2OVEA 4CPHB 4O49A 3P6CA 1AVEA 1KL5A 4I6SA 4D6BA 2GTLN 1NP4A 1PTSA 1E2TA 3LHNA 2CBRA 4Z2PA 2RD7C 5AQ6A 4QYPA 5LJKA 1KFFA 4LQZA 2GH7A 3FDCA 1AB0A 1IFCA 3O2YA 1TVQA 4Y5DA 1L6MA 1SWDA 4ZCBA 5HBSA 2CM9A 1X8OA 4YGGA 5D48A 2GTLM 3P6GA 5F6BA 1PMPA 3T6FA 4CV7A 3BX7A 4KH8A 2A13A 4K19A 5HA0A 3RY2A 1TXLA 1SA8A 1ZNLA 2KTSA 2L68A 2QMIA 2RTGB 3TF6A 4RUNA 1KT4A 3I0AA 4AZQA 4ZHHA 2L5PA 2HLVA 1HBPA 5DG4A 1T68X 3U03A 3V8UA 1KZXA 1EI5A 3I17A 4YCHA 5FQ8E 4OEMA 1SRFA 2DJFA 3CQRA 4DQ3A 3D97A 3VG2A 1CBIA 4GDZA 3E3CA 3MBTA 4PJ2A 3APVA 4YBUA 1GGLA 1WBIA 2IZCB 3MG5A 3PQSA 1VWBB 2Y3FA 5B10O 4GGTA 1Y55X 1SREA 4O3WA 4EKVA 3STNA 3EW2A 3BU9A 4MISA 1N7YA 1H91A 1SLGB 3FA7A 4IB7A 4WHIA 2WPUA 1GX8A 5LJGA 1SY1A 3D4RA 3GE2A 1E02A 1AVDA 5IXGA 4CPEA 4MVKA 5IRAA 3DSZA 2WSJA 3ELXA 1Y53X 4I3BA 4GNWA 4ORRA 1DZPA 4AYHA 4U3QA 1VWNB 1SRGA 2W2BA 3CKGA 4QGXA 3X00A 4YFRA 2ZAGA 4XMDA 3T2WA 2A0AA 2ALLX 3G7XA 4ORYA 4GKCA 4ALBA 2L9CA 4CDEA 4ZR2A 1D2UA 4XMHA 3VHIA 3NP1A 1JYJA 4XMCA 5L8OA 1IW2A 4WFVA 4JHQA 1RXKA 1O1VA 4O4SA 5H8TA 1QQSA 2Q39A 3B2IA 4TKHA 4YGZA 1JZUA 1DF8A 2RTIB 3CMPA 3N91A 5LJBA 4IB9A 3VU1A 1ZNHA 1GT5A 1LCWA 2I5VO 3KFHA 4Y0PA 4Z28A 3TGAA 4ORUA 1EXSA 5F7GA 4NW4A 1HQQA 4GETA 5BVSA 5L8IA 2AMMX 1JYDA 3FYFA 3JS1A 2XSTA 3LV4A 4CSBA 1AVGI 4QGWA 5AJCA 2JU8A 2VFBA 1NBXA 2JMBA 1KZWA 4ODDA 4EDEA 1QABE 4IMOA 3ZW1B 3STMX 1LIBA 3FEKA 2X4MA 2C4IA 3HPEA 4ORWA 1SWKA 1MM9A 3FEPA 3AUMO 1ZNDA 2E4JA 3APUA 3BX8A 1LFOA 5D45A 1Z24A 2FHLA 3VE2A 2FWVA 4GK9A 1LKEA 4OELA 3CBCA 3CKFA 3HWDA 3MVFA 4Z27A 4EFGA 1RXJA 2X46A 3SLJA 4DQ4A 2GTLO 5FAZA 3FENA 2X8FA 1N9MA 1BRQA 1OBUA 4CDDA 1ML7A 4YDAA 2RTAA 4CPHA 4QZUA 3WOVA 2UZ2A 4BBOA 1VWFB 2G5LA 4OMXA 5IO6A 1IKEA 2AVIA 1OBPA 3UEXA 1DZMA 3RY1A 2NP1A 4PSQA 1N4JA 2BSZA 2RTFB 3PK2A 4AZNA 4Z2OA 1Y9TA 5KHPA 2MWHA 4Y0QA 2OL6O 2QO6A 4Z6JA 1G5WA 5EEDA 3RWXA 4WFUA 1ICNA 3WJFA 1N0SA 4A1HA 4A1YA 1XKIA 1DV9A 4XMGA 4NNSA 1OEJA 5K67A 1KT7A 1ZRYA 3UAQA 2AT5X 4QAEA 3VHMA 4BGFA 2QO4A 5CHKA 5HCCC 5AJBA 4ZH9A 4HFOA 3P02A 2WWPA 5EZ2A 3AEHA 1SLFB 3S5VA 2OF8A 2VFCA 3S26A 1RXHA 1JV4A 3D95A 1LPJA 3RDXA 1GT4A 5LJCA 2C1SA 4OKAA 1SWBA 1A2DA 3JQOA 2ACOA 4O4OA 5HA1A 1JMZA 4YKOA 1QY0A 2RTDB 3KQ0A 2ACPX 4NLJA 1GT1A 4ES7A 1GX9A 4YVBA 5F6ZA 3HWGA 4BVMA 1VWGB 2FT9A 4ZFXA 1SXWA 1SRIA 1SWNA 2G8CO 2K23A 2IZBA 2RTLA 4I9SA 3SLTA 3RDMA 4BX5B 1S2PA 3HWEA 4QYNA 4DNEA 2GC9A 2QO5A 3VG6A 2AT0X 1UYNX 5EEEA 4IAXA 2OFRX 1FJ1E 2FS6A 3FMZA 4GRJA 2CAMA 1FDQA 1NGLA 2BHVA 2F09A 3B2HA 4YKMA 2WUTA 2WQAE 5D8JA 5FFHA 1SWQA 1LIEA 3NX2A 1SLEB 2FLJA 1HXZA 3P6EA 4GE1A 5B3MO 3VG5A 2Q4NA 3BDRA 2K62A 4ID2A 1VWLB 2A8GA 1VWOB 5CYBA 4QGVA 3CQNA 3NQ9A 3WZPA 1JJJA 2HYSA 4I60A 1QY1A 1X8QA 3FW5A 1VWRB 1LDOA 1SWGA 4MVLA 3EW1A 1LCZA 4NV8A 1HMRA 2HZRA 2JN3A 3FIQA 1BM5A 4HWMA 1MEPA 4TKBA 1UREA 1SWUA 1GX3A 1VWMB 2HNXA 3MX7A 1VWCB 4ZHGA 2MHDA 3F6ZB 4I9RA 2BLGA 2IZKA 1KXOA 4XMFA 5H9LA 5B27A 2OL7A 2OFAA 5BVQA 2OYBO 3ZWEA 1HN2A 5H9KA 1MX7A 2RA6A 3SOTA 1FELA 1Y0GA 1LNMA 1OEKA 3EBKA 4INNA 3C76X 2A3FX 2WEWA 1MVGA 3CBSA 1N9YA 2OZQA 1LDQA 2AT6X 1T8VA 3FIDA 1NQMA 3O22A 1IIUA 4WBKA 2MF6A 2EU7X 1QFTA 4IB6A 5K68A 3GAQA 1IFBA 3WJBA 5CE4A 5L8NA 1EPAA 1K3BA 3ZQ3A 1PEEA 1SRJA 1X71A 3FW4A 3D9WA 1SRHA 3HOLA 3ZW1A 1DC9A 1GT3A 2YMSA 2A5CA 1FTPA 2OY5O 3ZW0B 4ZGUA 3PH5A 5K06A 1CBSA 1LIFA 5EDCA 1X8PA 1SLDB 3BSZE 4M6SA 3U9PC 2JGSA 1YWBA 2CM4A 2AF5A 5LJEA 4GGRA 4NLIA 4NV7A 1LICA 3VGWA 1SWJA 3Q34A 3EM0A 1E06A 1MK5A 1HMTA 3WBGA 4DCBA 5IO5A 2KW1A 1ERXA 3BRNA 3U0DA 3WZNA 1CBRA 4QNIA 1WUBA 2Z4HA 4O4XA 1N43A 3PPTA 1A57A 5FQ6E 1FE3A 4OS0A 3SZIA 1SWRA 5L3YA 1BLRA 2X8TA 2HMBA 1Y9LA 2R74A 4LZUA 4N7CA 2IZGB 3ELZA 4YH0A 5JR8A 2LA7A 4LZVA 1E00A 2RCTA 4BOEA 5BVTA 1RSTB 3NBXX 1PBYA 3RE5A 5F58A 2Z4IA 3HOEA 4U9CA 1ERBA 5B5GA 3UEUA 2OVAA 5HAEA 2VDFA 2ZSCA 4BQUA 5LJHA 4I3CA 5FQ7E 1YP6A 1DF3A 4YDBA 3NX1A 1X8NA 4I3DA 4QQ1A 3VG3A 4BCSA 2A2GA 4O9SA 4U46A 3RE6A 1SWSA 1JJUA 3C78X 1CRBA 3OE3A 5HCEC 1QG5A 2BT9A 1EPBA 2XKLA 2RTMA 4GJSA 5EDBA 5LKFA 1KL4A 2Y32A 4KC8A 4D6AA 4L3RA 4IABA 1BWYA 1BJ7A 2RTHB 2X32A 5EPQA 1D3SA 1A3YA 3IFBA 1K24A 4RUUA 2RTEB 2RTCB 4U8UN 2IZHB 2FTBA 1GM6A 3PQUA 1TOWA 2Q2MA 3K3LA 4GJVA 2FS7A 3VG7A 2P8GA 4HPAA 2BS6A 2YG2A 1MUPA 2MO5A 1ZNGA 3QKGA 1STRB 2RTBB 5HTDA 3UEVA 3TGCA 1RAVA 2POAA 3KFFA 4U8UM 4O3XB 5HCDC 4AZMA 4GZVA 4ORXA 1B0OA 3BS2A 1BRPA 5IRUA 3PH6A 1CJ5A 2OFBA 2OVSA 2IZAA 2ZAIA 2OY8A 4TJZA 3WVMA 1OSPO 2JW1A 3WJEA 1LELA 2IZEB 1QWDA 1X89A 3LTWA 1STPA 3WYPA 1SXUA 1Y52X 1GXAA 4FBOA 2G79A 4YCEA 1GKAB 2WR6A 5C0NA 2LKKA 1MX8A 2AT3X 1A18A 3CWKA 1HMSA 1IJ8A 1VWHB 2AL0X 4LKTA 4QZTA 3VHHA 3ZUIA 5AEOA 4IBAA 1ZNKA 4YFQA 3D96A 3ZI8A 3CR6A 5HZ5A 4OMWA 5HZ6A 5IRWA 3FR2A 3BLGA 4TLJA 5KICA 3BY0A 4UU3A 1I4UA 1UZ2X 4GGZA 2ANSA 3ZUOA 1B56A 4CDFA 1SWHA 1KT6A 3B2LA 1YIVA 4O4UA 2X8SA 2DJGA 3L4RA 2C1QA 2L67A 2RTPB 3FA6A 4JNJA 3ZW0A 3JSQA 3WJGA 3T6LA 2FKJA 4N7DA 1EQDA 1HXLA 1RSUB 2N93A 3H3IA 4KT5A 1JQPA 4AZRA 1SWEA 2A2UA 3RDSA 3F8AA 4Y0RA 1OPAA 4BX7B 1NQNA 1SWTA 2G78A 2DM5A 4MIRA 3FR4A 3QQ2A 4ARHA 1JMXA 1KL3A 1OPBA 1RLBE 2RTOB 1KQXA 4ORSA 1KT5A 1S44A 1B8EA 2RN4A 3Q6LA 2G7BA 2HZQA 4LKPA 4GU8A 3PP6A 3EYCA 2AKQA 1BBPA 4IAWA 4CDCA 1O1UA 3KFGA 3WZQA 5H9AA 1KOIA 2JU7A 4FQBB 3TZSA 4Y0SA 1B4MA 4FBVA 3T1DA 5B2AO 2CZUA 1LCVA 5D4AA 4BX6B 1BSOA 4JGLA 4O3YA 4TKJA 1IKJA 1W4TA 4QRLA 3DTQA 5IO7A 4R0BA 2RTNB 4CPIA 3B2KA 1SMPI 2IZJA 1DZJA 4UU2A 4YGHA 2F01A 2RTRB 1EIOA 1VYFA 2MJIA 2JOZA 4AW8A 4ZH6A 3P6DA 2IZLB 1XCAA 3EMMA 4KCAA 5F2BA 3PECA 1JJXA 2FR3A 2KD2A 4MVIA 3KZAA 3VPJE 4FGIB 1SWOA 3S60A 5HWZA 3RBYA 3ZZVA 1ZNEA 1VYGA 3NR3A 1KGLA 3WZOA 4IRWA 4CK4A 2ASNX 4U8UO 1AELA 5FENA 1KQWA 2Q2PA 4B55A 1VWPB 4L1NA 1VWQB 1PM1X 2IZFB 1HQPA 2W2AA 1VWAB 1TOUA 2OVDA 1BSYA 1SWFA 3HWFA 4YMYA 4O3ZA 1S7DA 1STSB 2OY7A 3WJCA 1SWCA 5D47A 2LFOA 4OS8A 4ZJ0A 4KIIA 1ALBA 3SAOA 2IZDB 3STKA 2F73A 1YUPA 2OFMX 4IB8A 2Y3EA 2GJ5A 4COTA 5B5FA 2FKGA 1ADLA 3O19A 1G74A 5BYPA 3WJDA 1CBQA 1LIDA 4GH7A 4ZGFA 4ZHDA 1VWKB 5H9NA 2RCQA 1MDCA 2CZTA 2R73A 1EALA 2OF9A 3UEWA 1LUQA 2KT4B 2X56A 3FA8A 2BS5A 1UYOX 2BC3A 2OY1O 2AT8X 3C77X 3FLLA 2GTFX 4Y59A 1O8VA 3SZHA 1E5PA 1R0UA 1QFVA 4ALOA 2FR2A 2NNEA 3RSWA 1OEEA 5B11O 2AH7X 4ZHCA 4ZHFA 1SWPA 1EW3A 3OJYC 2O62A 3NQ3A 4GUZA 1GKAA 4NYRA 4OS3A 4YFPA 3SLOA 4AZOA 1YWDA 3BU1A 4HPBA 1NDJA 4I95A 2I5ZO 3AKMA 3FR5A 5F1EA 2PY1A 2FRSA 1SXXA 2HKDA 2IFBA 3OBLA 3IA8A 3HTYA 4ML7B 3VG4A 1YWAA 2R56A 2LBAA 2LB6A 1ICMA 1HY2A 3SZJA 1FENA 4TQ2A 3EC5A 3RDUA 1U0XA 1SY0A 1VPRA 3FA9A 5HTEA 1P6PA 4HPDA 5HZQA 3RZYA 4BX5A 2IZIA 1I04A 1QY2A 1PBOA 2M4LA 4FBRA 2KTDA 4GNYA 1I06A 2X34A 3NADA 3F9DA 4TNNA 3P6HA 1I9HA 1LF7A 3OD9A 1SWAA 4BJ8A 1YP7A 3B2JA 1VYOA 3RDQA 4MVEA 3RDOA 4NP1A 1ACDA 3VE1A 2FGSA 1SY3A 5HZ8A 5LJDA 4BX7A 2X55A 4A60A 1HBQA 2QCBA 2W2FA 4NNTA 4ON1A 3T2XA 4IMNA 1NP1A 4A8ZA 1VWDB 1I05A 1NC9A 2WQ9A 3EBWA 4M7MA 5LKEA 2OL8O 2QM9A 1DFVA 1SY2A 1SXYA 3P6FA 2MM3A 3AKNA 3HK1A 4HPCA 1U17A 3ZW2A 1JIWI 2QOSC 4GDAA 1VWEB 3APWA 1T0VA 1TW4A 2RTJA 1RBPA 2JU3A 2A5BA 1W6FA 3KVNA 2CBSA 1VWIB 1EUOA 3NQKA 4BX6A 5KIDA 1JBHA 1W5RA 2WEXA 5CSEA 2UYWA 3KFIA
chains in the Genus database with same CATH topology
1SWJA 2C4IA 1SWKA 1MM9A 1MK5A 5JD2A 2FHLA 1LCVA 3WZNA 4BX6B 2FHNX 4Z27A 3MM0A 1N43A 1RXJA 2RTKA 4CPIA 2RTNB 1N9MA 3SZIA 2IZJA 5L3YA 1SWRA 2RTAA 3WYQA 2F01A 2RTRB 4CPHA 2IZGB 2UZ2A 4BBOA 1VWFB 2G5LA 4GD9A 2IZLB 1RSTB 5F2BA 1MOYA 1VWJB 2AVIA 3RE5A 3RY1A 4CPFA 1N4JA 5B5GA 4Z2VA 4Z2OA 2RTFB 3PK2A 2RTQB 1SWOA 2ZSCA 4JO6A 1SWLA 4CPHB 4Z6JA 3WZOA 1AVEA 1KL5A 4BCSA 1PTSA 4IRWA 4Z2PA 3RE6A 4U46A 5K67A 1SWSA 1VWPB 1KFFA 1VWQB 2GH7A 2IZFB 3VHMA 1VWAB 3FDCA 5CHKA 1SWFA 4Y5DA 1SWDA 4GJSA 1STSB 2RTMA 3T6FA 1KL4A 1SWCA 2Y32A 1SLFB 2OF8A 1RXHA 2IZDB 3RY2A 2RTHB 3RDXA 2C1SA 4OKAA 2RTGB 2Y3EA 1SWBA 5B5FA 2RTDB 4YVBA 2RTEB 2RTCB 1VWKB 2IZHB 1VWGB 4GJVA 1SRFA 2OF9A 1LUQA 1SWNA 1SRIA 2IZBA 1STRB 2BC3A 2RTBB 4Y59A 2RTLA 3SZHA 3RDMA 1RAVA 1WBIA 2IZCB 3MG5A 4BX5B 1VWBB 4DNEA 2Y3FA 4GGTA 1Y55X 1SREA 4EKVA 1SWPA 3EW2A 5IRUA 1N7YA 1SLGB 1NDJA 2OFBA 2CAMA 2IZAA 2WPUA 1LELA 1AVDA 2IZEB 1SWQA 4CPEA 5IRAA 1SLEB 1STPA 1HXZA 3WYPA 1Y52X 1Y53X 1VWLB 2A8GA 1HY2A 1VWOB 3SZJA 3WZPA 3RDUA 4I60A 1VWNB 1IJ8A 1SRGA 1VWHB 3VHHA 3X00A 4BX5A 1VWRB 1LDOA 1SWGA 2IZIA 3EW1A 1LCZA 3T2WA 5IRWA 1MEPA 4BJ8A 1I9HA 1SWAA 1SWUA 1VWMB 1VYOA 1VWCB 3RDQA 3VHIA 3RDOA 2IZKA 4GGZA 4JHQA 1RXKA 2OFAA 1SWHA 4BX7A 1DF8A 2RTIB 2C1QA 2QCBA 2RTPB 4JNJA 3T2XA 1N9YA 1LDQA 3T6LA 1NQMA 1VWDB 1HXLA 1NC9A 1RSUB 1LCWA 2MF6A 4Z28A 5K68A 1HQQA 1SWEA 3RDSA 1SRJA 4BX7B 1NQNA 4GDAA 1SWTA 1VWEB 1SRHA 2A5CA 2RTJA 1KL3A 2RTOB 1NBXA 2A5BA 1SLDB 1VWIB 2JGSA 4BX6A 5CSEA 2UYWA 4GGRA 3WZQA 3VGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SWJ A;  2C4I A;  1SWK A;  1MM9 A;  1MK5 A;  5JD2 A;  2FHL A;  1LCV A;  3WZN A;  4BX6 B;  2FHN X;  4Z27 A;  3MM0 A;  1N43 A;  1RXJ A;  2RTK A;  4CPI A;  2RTN B;  1N9M A;  3SZI A;  2IZJ A;  5L3Y A;  1SWR A;  2RTA A;  3WYQ A;  2F01 A;  2RTR B;  4CPH A;  2IZG B;  2UZ2 A;  4BBO A;  1VWF B;  2G5L A;  4GD9 A;  2IZL B;  1RST B;  5F2B A;  1MOY A;  1VWJ B;  2AVI A;  3RE5 A;  3RY1 A;  4CPF A;  1N4J A;  5B5G A;  4Z2V A;  4Z2O A;  2RTF B;  3PK2 A;  2RTQ B;  1SWO A;  2ZSC A;  4JO6 A;  1SWL A;  4CPH B;  4Z6J A;  3WZO A;  1AVE A;  1KL5 A;  4BCS A;  1PTS A;  4IRW A;  4Z2P A;  3RE6 A;  4U46 A;  5K67 A;  1SWS A;  1VWP B;  1KFF A;  1VWQ B;  2GH7 A;  2IZF B;  3VHM A;  1VWA B;  3FDC A;  5CHK A;  1SWF A;  4Y5D A;  1SWD A;  4GJS A;  1STS B;  2RTM A;  3T6F A;  1KL4 A;  1SWC A;  2Y32 A;  1SLF B;  2OF8 A;  1RXH A;  2IZD B;  3RY2 A;  2RTH B;  3RDX A;  2C1S A;  4OKA A;  2RTG B;  2Y3E A;  1SWB A;  5B5F A;  2RTD B;  4YVB A;  2RTE B;  2RTC B;  1VWK B;  2IZH B;  1VWG B;  4GJV A;  1SRF A;  2OF9 A;  1LUQ A;  1SWN A;  1SRI A;  2IZB A;  1STR B;  2BC3 A;  2RTB B;  4Y59 A;  2RTL A;  3SZH A;  3RDM A;  1RAV A;  1WBI A;  2IZC B;  3MG5 A;  4BX5 B;  1VWB B;  4DNE A;  2Y3F A;  4GGT A;  1Y55 X;  1SRE A;  4EKV A;  1SWP A;  3EW2 A;  5IRU A;  1N7Y A;  1SLG B;  1NDJ A;  2OFB A;  2CAM A;  2IZA A;  2WPU A;  1LEL A;  1AVD A;  2IZE B;  1SWQ A;  4CPE A;  5IRA A;  1SLE B;  1STP A;  1HXZ A;  3WYP A;  1Y52 X;  1Y53 X;  1VWL B;  2A8G A;  1HY2 A;  1VWO B;  3SZJ A;  3WZP A;  3RDU A;  4I60 A;  1VWN B;  1IJ8 A;  1SRG A;  1VWH B;  3VHH A;  3X00 A;  4BX5 A;  1VWR B;  1LDO A;  1SWG A;  2IZI A;  3EW1 A;  1LCZ A;  3T2W A;  5IRW A;  1MEP A;  4BJ8 A;  1I9H A;  1SWA A;  1SWU A;  1VWM B;  1VYO A;  1VWC B;  3RDQ A;  3VHI A;  3RDO A;  2IZK A;  4GGZ A;  4JHQ A;  1RXK A;  2OFA A;  1SWH A;  4BX7 A;  1DF8 A;  2RTI B;  2C1Q A;  2QCB A;  2RTP B;  4JNJ A;  3T2X A;  1N9Y A;  1LDQ A;  3T6L A;  1NQM A;  1VWD B;  1HXL A;  1NC9 A;  1RSU B;  1LCW A;  2MF6 A;  4Z28 A;  5K68 A;  1HQQ A;  1SWE A;  3RDS A;  1SRJ A;  4BX7 B;  1NQN A;  4GDA A;  1SWT A;  1VWE B;  1SRH A;  2A5C A;  2RTJ A;  1KL3 A;  2RTO B;  1NBX A;  2A5B A;  1SLD B;  1VWI B;  2JGS A;  4BX6 A;  5CSE A;  2UYW A;  4GGR A;  3WZQ A;  3VGW A; 
#chains in the Genus database with same CATH topology
 5B29 A;  4AZP A;  3S5X A;  3WXQ A;  5JD2 A;  3P24 A;  2QOM A;  1FEM A;  1G7N A;  3FEL A;  1I78 A;  3RKG A;  3TGB A;  2NNQ A;  2FHN X;  1G85 A;  3PDF A;  2NND A;  3MM0 A;  2RQ0 A;  5DPQ A;  4NYQ A;  1U18 A;  2RTK A;  1BSQ A;  3NPO A;  4C5P A;  2X45 A;  4YBP A;  1X8U A;  4KC7 A;  2LBV A;  3WYQ A;  4EXZ A;  4MEE A;  4EQA C;  1DZK A;  1AQB A;  2Q9S A;  4GD9 A;  4XME A;  1YWC A;  1KT3 A;  1MOY A;  1VWJ B;  3APX A;  4CPF A;  4EEJ A;  5HZ9 A;  1OBQ A;  4Z2V A;  2RTQ B;  1EII A;  4JO6 A;  2PI3 O;  3PED A;  1BEB A;  1SWL A;  2OVE A;  4CPH B;  4O49 A;  3P6C A;  1AVE A;  1KL5 A;  4I6S A;  4D6B A;  2GTL N;  1NP4 A;  1PTS A;  1E2T A;  3LHN A;  2CBR A;  4Z2P A;  2RD7 C;  5AQ6 A;  4QYP A;  5LJK A;  1KFF A;  4LQZ A;  2GH7 A;  3FDC A;  1AB0 A;  1IFC A;  3O2Y A;  1TVQ A;  4Y5D A;  1L6M A;  1SWD A;  4ZCB A;  5HBS A;  2CM9 A;  1X8O A;  4YGG A;  5D48 A;  2GTL M;  3P6G A;  5F6B A;  1PMP A;  3T6F A;  4CV7 A;  3BX7 A;  4KH8 A;  2A13 A;  4K19 A;  5HA0 A;  3RY2 A;  1TXL A;  1SA8 A;  1ZNL A;  2KTS A;  2L68 A;  2QMI A;  2RTG B;  3TF6 A;  4RUN A;  1KT4 A;  3I0A A;  4AZQ A;  4ZHH A;  2L5P A;  2HLV A;  1HBP A;  5DG4 A;  1T68 X;  3U03 A;  3V8U A;  1KZX A;  1EI5 A;  3I17 A;  4YCH A;  5FQ8 E;  4OEM A;  1SRF A;  2DJF A;  3CQR A;  4DQ3 A;  3D97 A;  3VG2 A;  1CBI A;  4GDZ A;  3E3C A;  3MBT A;  4PJ2 A;  3APV A;  4YBU A;  1GGL A;  1WBI A;  2IZC B;  3MG5 A;  3PQS A;  1VWB B;  2Y3F A;  5B10 O;  4GGT A;  1Y55 X;  1SRE A;  4O3W A;  4EKV A;  3STN A;  3EW2 A;  3BU9 A;  4MIS A;  1N7Y A;  1H91 A;  1SLG B;  3FA7 A;  4IB7 A;  4WHI A;  2WPU A;  1GX8 A;  5LJG A;  1SY1 A;  3D4R A;  3GE2 A;  1E02 A;  1AVD A;  5IXG A;  4CPE A;  4MVK A;  5IRA A;  3DSZ A;  2WSJ A;  3ELX A;  1Y53 X;  4I3B A;  4GNW A;  4ORR A;  1DZP A;  4AYH A;  4U3Q A;  1VWN B;  1SRG A;  2W2B A;  3CKG A;  4QGX A;  3X00 A;  4YFR A;  2ZAG A;  4XMD A;  3T2W A;  2A0A A;  2ALL X;  3G7X A;  4ORY A;  4GKC A;  4ALB A;  2L9C A;  4CDE A;  4ZR2 A;  1D2U A;  4XMH A;  3VHI A;  3NP1 A;  1JYJ A;  4XMC A;  5L8O A;  1IW2 A;  4WFV A;  4JHQ A;  1RXK A;  1O1V A;  4O4S A;  5H8T A;  1QQS A;  2Q39 A;  3B2I A;  4TKH A;  4YGZ A;  1JZU A;  1DF8 A;  2RTI B;  3CMP A;  3N91 A;  5LJB A;  4IB9 A;  3VU1 A;  1ZNH A;  1GT5 A;  1LCW A;  2I5V O;  3KFH A;  4Y0P A;  4Z28 A;  3TGA A;  4ORU A;  1EXS A;  5F7G A;  4NW4 A;  1HQQ A;  4GET A;  5BVS A;  5L8I A;  2AMM X;  1JYD A;  3FYF A;  3JS1 A;  2XST A;  3LV4 A;  4CSB A;  1AVG I;  4QGW A;  5AJC A;  2JU8 A;  2VFB A;  1NBX A;  2JMB A;  1KZW A;  4ODD A;  4EDE A;  1QAB E;  4IMO A;  3ZW1 B;  3STM X;  1LIB A;  3FEK A;  2X4M A;  2C4I A;  3HPE A;  4ORW A;  1SWK A;  1MM9 A;  3FEP A;  3AUM O;  1ZND A;  2E4J A;  3APU A;  3BX8 A;  1LFO A;  5D45 A;  1Z24 A;  2FHL A;  3VE2 A;  2FWV A;  4GK9 A;  1LKE A;  4OEL A;  3CBC A;  3CKF A;  3HWD A;  3MVF A;  4Z27 A;  4EFG A;  1RXJ A;  2X46 A;  3SLJ A;  4DQ4 A;  2GTL O;  5FAZ A;  3FEN A;  2X8F A;  1N9M A;  1BRQ A;  1OBU A;  4CDD A;  1ML7 A;  4YDA A;  2RTA A;  4CPH A;  4QZU A;  3WOV A;  2UZ2 A;  4BBO A;  1VWF B;  2G5L A;  4OMX A;  5IO6 A;  1IKE A;  2AVI A;  1OBP A;  3UEX A;  1DZM A;  3RY1 A;  2NP1 A;  4PSQ A;  1N4J A;  2BSZ A;  2RTF B;  3PK2 A;  4AZN A;  4Z2O A;  1Y9T A;  5KHP A;  2MWH A;  4Y0Q A;  2OL6 O;  2QO6 A;  4Z6J A;  1G5W A;  5EED A;  3RWX A;  4WFU A;  1ICN A;  3WJF A;  1N0S A;  4A1H A;  4A1Y A;  1XKI A;  1DV9 A;  4XMG A;  4NNS A;  1OEJ A;  5K67 A;  1KT7 A;  1ZRY A;  3UAQ A;  2AT5 X;  4QAE A;  3VHM A;  4BGF A;  2QO4 A;  5CHK A;  5HCC C;  5AJB A;  4ZH9 A;  4HFO A;  3P02 A;  2WWP A;  5EZ2 A;  3AEH A;  1SLF B;  3S5V A;  2OF8 A;  2VFC A;  3S26 A;  1RXH A;  1JV4 A;  3D95 A;  1LPJ A;  3RDX A;  1GT4 A;  5LJC A;  2C1S A;  4OKA A;  1SWB A;  1A2D A;  3JQO A;  2ACO A;  4O4O A;  5HA1 A;  1JMZ A;  4YKO A;  1QY0 A;  2RTD B;  3KQ0 A;  2ACP X;  4NLJ A;  1GT1 A;  4ES7 A;  1GX9 A;  4YVB A;  5F6Z A;  3HWG A;  4BVM A;  1VWG B;  2FT9 A;  4ZFX A;  1SXW A;  1SRI A;  1SWN A;  2G8C O;  2K23 A;  2IZB A;  2RTL A;  4I9S A;  3SLT A;  3RDM A;  4BX5 B;  1S2P A;  3HWE A;  4QYN A;  4DNE A;  2GC9 A;  2QO5 A;  3VG6 A;  2AT0 X;  1UYN X;  5EEE A;  4IAX A;  2OFR X;  1FJ1 E;  2FS6 A;  3FMZ A;  4GRJ A;  2CAM A;  1FDQ A;  1NGL A;  2BHV A;  2F09 A;  3B2H A;  4YKM A;  2WUT A;  2WQA E;  5D8J A;  5FFH A;  1SWQ A;  1LIE A;  3NX2 A;  1SLE B;  2FLJ A;  1HXZ A;  3P6E A;  4GE1 A;  5B3M O;  3VG5 A;  2Q4N A;  3BDR A;  2K62 A;  4ID2 A;  1VWL B;  2A8G A;  1VWO B;  5CYB A;  4QGV A;  3CQN A;  3NQ9 A;  3WZP A;  1JJJ A;  2HYS A;  4I60 A;  1QY1 A;  1X8Q A;  3FW5 A;  1VWR B;  1LDO A;  1SWG A;  4MVL A;  3EW1 A;  1LCZ A;  4NV8 A;  1HMR A;  2HZR A;  2JN3 A;  3FIQ A;  1BM5 A;  4HWM A;  1MEP A;  4TKB A;  1URE A;  1SWU A;  1GX3 A;  1VWM B;  2HNX A;  3MX7 A;  1VWC B;  4ZHG A;  2MHD A;  3F6Z B;  4I9R A;  2BLG A;  2IZK A;  1KXO A;  4XMF A;  5H9L A;  5B27 A;  2OL7 A;  2OFA A;  5BVQ A;  2OYB O;  3ZWE A;  1HN2 A;  5H9K A;  1MX7 A;  2RA6 A;  3SOT A;  1FEL A;  1Y0G A;  1LNM A;  1OEK A;  3EBK A;  4INN A;  3C76 X;  2A3F X;  2WEW A;  1MVG A;  3CBS A;  1N9Y A;  2OZQ A;  1LDQ A;  2AT6 X;  1T8V A;  3FID A;  1NQM A;  3O22 A;  1IIU A;  4WBK A;  2MF6 A;  2EU7 X;  1QFT A;  4IB6 A;  5K68 A;  3GAQ A;  1IFB A;  3WJB A;  5CE4 A;  5L8N A;  1EPA A;  1K3B A;  3ZQ3 A;  1PEE A;  1SRJ A;  1X71 A;  3FW4 A;  3D9W A;  1SRH A;  3HOL A;  3ZW1 A;  1DC9 A;  1GT3 A;  2YMS A;  2A5C A;  1FTP A;  2OY5 O;  3ZW0 B;  4ZGU A;  3PH5 A;  5K06 A;  1CBS A;  1LIF A;  5EDC A;  1X8P A;  1SLD B;  3BSZ E;  4M6S A;  3U9P C;  2JGS A;  1YWB A;  2CM4 A;  2AF5 A;  5LJE A;  4GGR A;  4NLI A;  4NV7 A;  1LIC A;  3VGW A;  1SWJ A;  3Q34 A;  3EM0 A;  1E06 A;  1MK5 A;  1HMT A;  3WBG A;  4DCB A;  5IO5 A;  2KW1 A;  1ERX A;  3BRN A;  3U0D A;  3WZN A;  1CBR A;  4QNI A;  1WUB A;  2Z4H A;  4O4X A;  1N43 A;  3PPT A;  1A57 A;  5FQ6 E;  1FE3 A;  4OS0 A;  3SZI A;  1SWR A;  5L3Y A;  1BLR A;  2X8T A;  2HMB A;  1Y9L A;  2R74 A;  4LZU A;  4N7C A;  2IZG B;  3ELZ A;  4YH0 A;  5JR8 A;  2LA7 A;  4LZV A;  1E00 A;  2RCT A;  4BOE A;  5BVT A;  1RST B;  3NBX X;  1PBY A;  3RE5 A;  5F58 A;  2Z4I A;  3HOE A;  4U9C A;  1ERB A;  5B5G A;  3UEU A;  2OVA A;  5HAE A;  2VDF A;  2ZSC A;  4BQU A;  5LJH A;  4I3C A;  5FQ7 E;  1YP6 A;  1DF3 A;  4YDB A;  3NX1 A;  1X8N A;  4I3D A;  4QQ1 A;  3VG3 A;  4BCS A;  2A2G A;  4O9S A;  4U46 A;  3RE6 A;  1SWS A;  1JJU A;  3C78 X;  1CRB A;  3OE3 A;  5HCE C;  1QG5 A;  2BT9 A;  1EPB A;  2XKL A;  2RTM A;  4GJS A;  5EDB A;  5LKF A;  1KL4 A;  2Y32 A;  4KC8 A;  4D6A A;  4L3R A;  4IAB A;  1BWY A;  1BJ7 A;  2RTH B;  2X32 A;  5EPQ A;  1D3S A;  1A3Y A;  3IFB A;  1K24 A;  4RUU A;  2RTE B;  2RTC B;  4U8U N;  2IZH B;  2FTB A;  1GM6 A;  3PQU A;  1TOW A;  2Q2M A;  3K3L A;  4GJV A;  2FS7 A;  3VG7 A;  2P8G A;  4HPA A;  2BS6 A;  2YG2 A;  1MUP A;  2MO5 A;  1ZNG A;  3QKG A;  1STR B;  2RTB B;  5HTD A;  3UEV A;  3TGC A;  1RAV A;  2POA A;  3KFF A;  4U8U M;  4O3X B;  5HCD C;  4AZM A;  4GZV A;  4ORX A;  1B0O A;  3BS2 A;  1BRP A;  5IRU A;  3PH6 A;  1CJ5 A;  2OFB A;  2OVS A;  2IZA A;  2ZAI A;  2OY8 A;  4TJZ A;  3WVM A;  1OSP O;  2JW1 A;  3WJE A;  1LEL A;  2IZE B;  1QWD A;  1X89 A;  3LTW A;  1STP A;  3WYP A;  1SXU A;  1Y52 X;  1GXA A;  4FBO A;  2G79 A;  4YCE A;  1GKA B;  2WR6 A;  5C0N A;  2LKK A;  1MX8 A;  2AT3 X;  1A18 A;  3CWK A;  1HMS A;  1IJ8 A;  1VWH B;  2AL0 X;  4LKT A;  4QZT A;  3VHH A;  3ZUI A;  5AEO A;  4IBA A;  1ZNK A;  4YFQ A;  3D96 A;  3ZI8 A;  3CR6 A;  5HZ5 A;  4OMW A;  5HZ6 A;  5IRW A;  3FR2 A;  3BLG A;  4TLJ A;  5KIC A;  3BY0 A;  4UU3 A;  1I4U A;  1UZ2 X;  4GGZ A;  2ANS A;  3ZUO A;  1B56 A;  4CDF A;  1SWH A;  1KT6 A;  3B2L A;  1YIV A;  4O4U A;  2X8S A;  2DJG A;  3L4R A;  2C1Q A;  2L67 A;  2RTP B;  3FA6 A;  4JNJ A;  3ZW0 A;  3JSQ A;  3WJG A;  3T6L A;  2FKJ A;  4N7D A;  1EQD A;  1HXL A;  1RSU B;  2N93 A;  3H3I A;  4KT5 A;  1JQP A;  4AZR A;  1SWE A;  2A2U A;  3RDS A;  3F8A A;  4Y0R A;  1OPA A;  4BX7 B;  1NQN A;  1SWT A;  2G78 A;  2DM5 A;  4MIR A;  3FR4 A;  3QQ2 A;  4ARH A;  1JMX A;  1KL3 A;  1OPB A;  1RLB E;  2RTO B;  1KQX A;  4ORS A;  1KT5 A;  1S44 A;  1B8E A;  2RN4 A;  3Q6L A;  2G7B A;  2HZQ A;  4LKP A;  4GU8 A;  3PP6 A;  3EYC A;  2AKQ A;  1BBP A;  4IAW A;  4CDC A;  1O1U A;  3KFG A;  3WZQ A;  5H9A A;  1KOI A;  2JU7 A;  4FQB B;  3TZS A;  4Y0S A;  1B4M A;  4FBV A;  3T1D A;  5B2A O;  2CZU A;  1LCV A;  5D4A A;  4BX6 B;  1BSO A;  4JGL A;  4O3Y A;  4TKJ A;  1IKJ A;  1W4T A;  4QRL A;  3DTQ A;  5IO7 A;  4R0B A;  2RTN B;  4CPI A;  3B2K A;  1SMP I;  2IZJ A;  1DZJ A;  4UU2 A;  4YGH A;  2F01 A;  2RTR B;  1EIO A;  1VYF A;  2MJI A;  2JOZ A;  4AW8 A;  4ZH6 A;  3P6D A;  2IZL B;  1XCA A;  3EMM A;  4KCA A;  5F2B A;  3PEC A;  1JJX A;  2FR3 A;  2KD2 A;  4MVI A;  3KZA A;  3VPJ E;  4FGI B;  1SWO A;  3S60 A;  5HWZ A;  3RBY A;  3ZZV A;  1ZNE A;  1VYG A;  3NR3 A;  1KGL A;  3WZO A;  4IRW A;  4CK4 A;  2ASN X;  4U8U O;  1AEL A;  5FEN A;  1KQW A;  2Q2P A;  4B55 A;  1VWP B;  4L1N A;  1VWQ B;  1PM1 X;  2IZF B;  1HQP A;  2W2A A;  1VWA B;  1TOU A;  2OVD A;  1BSY A;  1SWF A;  3HWF A;  4YMY A;  4O3Z A;  1S7D A;  1STS B;  2OY7 A;  3WJC A;  1SWC A;  5D47 A;  2LFO A;  4OS8 A;  4ZJ0 A;  4KII A;  1ALB A;  3SAO A;  2IZD B;  3STK A;  2F73 A;  1YUP A;  2OFM X;  4IB8 A;  2Y3E A;  2GJ5 A;  4COT A;  5B5F A;  2FKG A;  1ADL A;  3O19 A;  1G74 A;  5BYP A;  3WJD A;  1CBQ A;  1LID A;  4GH7 A;  4ZGF A;  4ZHD A;  1VWK B;  5H9N A;  2RCQ A;  1MDC A;  2CZT A;  2R73 A;  1EAL A;  2OF9 A;  3UEW A;  1LUQ A;  2KT4 B;  2X56 A;  3FA8 A;  2BS5 A;  1UYO X;  2BC3 A;  2OY1 O;  2AT8 X;  3C77 X;  3FLL A;  2GTF X;  4Y59 A;  1O8V A;  3SZH A;  1E5P A;  1R0U A;  1QFV A;  4ALO A;  2FR2 A;  2NNE A;  3RSW A;  1OEE A;  5B11 O;  2AH7 X;  4ZHC A;  4ZHF A;  1SWP A;  1EW3 A;  3OJY C;  2O62 A;  3NQ3 A;  4GUZ A;  1GKA A;  4NYR A;  4OS3 A;  4YFP A;  3SLO A;  4AZO A;  1YWD A;  3BU1 A;  4HPB A;  1NDJ A;  4I95 A;  2I5Z O;  3AKM A;  3FR5 A;  5F1E A;  2PY1 A;  2FRS A;  1SXX A;  2HKD A;  2IFB A;  3OBL A;  3IA8 A;  3HTY A;  4ML7 B;  3VG4 A;  1YWA A;  2R56 A;  2LBA A;  2LB6 A;  1ICM A;  1HY2 A;  3SZJ A;  1FEN A;  4TQ2 A;  3EC5 A;  3RDU A;  1U0X A;  1SY0 A;  1VPR A;  3FA9 A;  5HTE A;  1P6P A;  4HPD A;  5HZQ A;  3RZY A;  4BX5 A;  2IZI A;  1I04 A;  1QY2 A;  1PBO A;  2M4L A;  4FBR A;  2KTD A;  4GNY A;  1I06 A;  2X34 A;  3NAD A;  3F9D A;  4TNN A;  3P6H A;  1I9H A;  1LF7 A;  3OD9 A;  1SWA A;  4BJ8 A;  1YP7 A;  3B2J A;  1VYO A;  3RDQ A;  4MVE A;  3RDO A;  4NP1 A;  1ACD A;  3VE1 A;  2FGS A;  1SY3 A;  5HZ8 A;  5LJD A;  4BX7 A;  2X55 A;  4A60 A;  1HBQ A;  2QCB A;  2W2F A;  4NNT A;  4ON1 A;  3T2X A;  4IMN A;  1NP1 A;  4A8Z A;  1VWD B;  1I05 A;  1NC9 A;  2WQ9 A;  3EBW A;  4M7M A;  5LKE A;  2OL8 O;  2QM9 A;  1DFV A;  1SY2 A;  1SXY A;  3P6F A;  2MM3 A;  3AKN A;  3HK1 A;  4HPC A;  1U17 A;  3ZW2 A;  1JIW I;  2QOS C;  4GDA A;  1VWE B;  3APW A;  1T0V A;  1TW4 A;  2RTJ A;  1RBP A;  2JU3 A;  2A5B A;  1W6F A;  3KVN A;  2CBS A;  1VWI B;  1EUO A;  3NQK A;  4BX6 A;  5KID A;  1JBH A;  1W5R A;  2WEX A;  5CSE A;  2UYW A;  3KFI A; 
#chains in the Genus database with same CATH homology
 1SWJ A;  2C4I A;  1SWK A;  1MM9 A;  1MK5 A;  5JD2 A;  2FHL A;  1LCV A;  3WZN A;  4BX6 B;  2FHN X;  4Z27 A;  3MM0 A;  1N43 A;  1RXJ A;  2RTK A;  4CPI A;  2RTN B;  1N9M A;  3SZI A;  2IZJ A;  5L3Y A;  1SWR A;  2RTA A;  3WYQ A;  2F01 A;  2RTR B;  4CPH A;  2IZG B;  2UZ2 A;  4BBO A;  1VWF B;  2G5L A;  4GD9 A;  2IZL B;  1RST B;  5F2B A;  1MOY A;  1VWJ B;  2AVI A;  3RE5 A;  3RY1 A;  4CPF A;  1N4J A;  5B5G A;  4Z2V A;  4Z2O A;  2RTF B;  3PK2 A;  2RTQ B;  1SWO A;  2ZSC A;  4JO6 A;  1SWL A;  4CPH B;  4Z6J A;  3WZO A;  1AVE A;  1KL5 A;  4BCS A;  1PTS A;  4IRW A;  4Z2P A;  3RE6 A;  4U46 A;  5K67 A;  1SWS A;  1VWP B;  1KFF A;  1VWQ B;  2GH7 A;  2IZF B;  3VHM A;  1VWA B;  3FDC A;  5CHK A;  1SWF A;  4Y5D A;  1SWD A;  4GJS A;  1STS B;  2RTM A;  3T6F A;  1KL4 A;  1SWC A;  2Y32 A;  1SLF B;  2OF8 A;  1RXH A;  2IZD B;  3RY2 A;  2RTH B;  3RDX A;  2C1S A;  4OKA A;  2RTG B;  2Y3E A;  1SWB A;  5B5F A;  2RTD B;  4YVB A;  2RTE B;  2RTC B;  1VWK B;  2IZH B;  1VWG B;  4GJV A;  1SRF A;  2OF9 A;  1LUQ A;  1SWN A;  1SRI A;  2IZB A;  1STR B;  2BC3 A;  2RTB B;  4Y59 A;  2RTL A;  3SZH A;  3RDM A;  1RAV A;  1WBI A;  2IZC B;  3MG5 A;  4BX5 B;  1VWB B;  4DNE A;  2Y3F A;  4GGT A;  1Y55 X;  1SRE A;  4EKV A;  1SWP A;  3EW2 A;  5IRU A;  1N7Y A;  1SLG B;  1NDJ A;  2OFB A;  2CAM A;  2IZA A;  2WPU A;  1LEL A;  1AVD A;  2IZE B;  1SWQ A;  4CPE A;  5IRA A;  1SLE B;  1STP A;  1HXZ A;  3WYP A;  1Y52 X;  1Y53 X;  1VWL B;  2A8G A;  1HY2 A;  1VWO B;  3SZJ A;  3WZP A;  3RDU A;  4I60 A;  1VWN B;  1IJ8 A;  1SRG A;  1VWH B;  3VHH A;  3X00 A;  4BX5 A;  1VWR B;  1LDO A;  1SWG A;  2IZI A;  3EW1 A;  1LCZ A;  3T2W A;  5IRW A;  1MEP A;  4BJ8 A;  1I9H A;  1SWA A;  1SWU A;  1VWM B;  1VYO A;  1VWC B;  3RDQ A;  3VHI A;  3RDO A;  2IZK A;  4GGZ A;  4JHQ A;  1RXK A;  2OFA A;  1SWH A;  4BX7 A;  1DF8 A;  2RTI B;  2C1Q A;  2QCB A;  2RTP B;  4JNJ A;  3T2X A;  1N9Y A;  1LDQ A;  3T6L A;  1NQM A;  1VWD B;  1HXL A;  1NC9 A;  1RSU B;  1LCW A;  2MF6 A;  4Z28 A;  5K68 A;  1HQQ A;  1SWE A;  3RDS A;  1SRJ A;  4BX7 B;  1NQN A;  4GDA A;  1SWT A;  1VWE B;  1SRH A;  2A5C A;  2RTJ A;  1KL3 A;  2RTO B;  1NBX A;  2A5B A;  1SLD B;  1VWI B;  2JGS A;  4BX6 A;  5CSE A;  2UYW A;  4GGR A;  3WZQ A;  3VGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...