1IJEA

Nucleotide exchange intermediates in the eef1a-eef1ba complex
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
438
structure length
438
Chain Sequence
EKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of nucleotide exchange intermediates in the eEF1A-eEF1Balpha complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords elongation factor 1-alpha
total genus 127
structure length 438
sequence length 438
ec nomenclature
pdb deposition date 2001-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ijeA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ijeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ijeA01
2OFOA 3G71B 1G6OA 1TTTA 2FEOA 1QHNA 2W0SA 1E9AA 1BQEA 2B7CA 2CHQA 4A2PA 3W6OA 1IHUA 2PZGA 1LVGA 3LW8A 1VMAA 1U0JA 3U7EB 4ZI2A 4FN5A 3U3RA 1Q82D 1B0UA 2G6BA 1YR6A 4LJYA 2QN6A 2NOAA 1KKMA 1E2QA 1Z6TA 4MUAA 4TYYA 2ZSDA 4DCUA 5H1YA 1K73D 2B21A 1XEXB 2JLUA 1TF5A 2GBLA 4MGIR 4PX9A 3WMEA 4BFWA 4CT4B 2CRVA 4GDFA 4Y0AA 4P4UA 1ZNWA 1N5LA 2D2FA 3P1JA 5C1BA 4PAQA 2C9YA 5FUYA 2MSEB 1E99A 4GFDA 2EWWA 1GO2A 2CNDA 4O25A 1BX1A 1VQOB 3A1VA 4UNPA 1VCOA 4AYTA 1S9DA 1LF0A 4BRWA 5FH9A 1CU1A 3SHWA 2WOOA 4M9QA 1N6KA 1OKKA 2BEJA 2I1VB 2OK8A 1KDTA 4P3YA 3D7MA 5KDDA 4FI3C 1XTKA 3MSXA 3Q7PA 4M1SA 4EPXA 2VNJA 5EP2A 1GWNA 3NBZC 4Q9KA 1BYUA 1VYTA 2RMKA 1VPLA 3W2EA 2AWOA 4YMUA 2FFHA 2JDID 2ZJZA 4IJMA 4HSEA 1G21E 2JJ2D 3MWKA 5JMTA 2QRNA 5AJWA 3OFNA 4UQOA 1E32A 1YJ5A 3ZGXA 4PO8A 4FK8A 1NN5A 1TAGA 2JASA 5BN4A 2Q9AA 5GJBA 1ANKA 1TUEA 3AGQA 3IUYA 3GFPA 5K8LA 1UEJA 3J81k 1NP6A 2ZE7A 2BMFA 3ONWA 4MYCA 2Z5FA 3OZWA 8OHMA 1Q57A 3U3JA 1DG3A 1LS1A 4KHZA 4V0KA 1AZTA 1ZD9A 3AUYA 3AP2A 5CJ2A 3VR5A 2IYXA 3AGPA 1E0JA 3BERA 1E6CA 1G7TA 4XTCS 3FDIA 2EFHB 5FBRB 2QMUA 2BPOA 4O2RA 4Y9RA 2A5GA 2KB0A 4MKHA 3MWLA 4HYYA 4NTZA 3VQTA 1OB5A 4UNNA 5FBLB 3QIAA 2A5JA 2X2FA 4FWIB 4HE5A 3L0IB 4MKIA 4MYUA 3WYGA 4JL6A 5G3ZA 5BYKA 4WIAA 1TQ4A 4DKXA 1CS4C 2VNKA 3CBQA 2VF8A 1QRAA 3I92A 3TW8B 4GPTA 3ADBA 2F43B 1T0HB 1R0YA 1Z3IX 4JBYA 1HEIA 1JQLB 2PH1A 5AUPB 5LD2C 1P2TA 2J9RA 2AHOA 1TMKA 2J3EA 1QG0A 3NH9A 4JT4A 5DHFA 5CM9C 2QGNA 3HR7A 4F4JA 2HJGA 3QKUA 3AB3A 4PSAA 2GA8A 1CBUA 2OEPA 2ZRMA 1OT3A 1JA0A 3C7KA 4HZUA 4PHGA 3FHCB 3T1TA 1E2KA 1WE2A 1W2GA 1TQ6A 4DLUA 1XD2B 1VKJA 2JLQA 3AF3A 4G5QA 3GLFA 4A0GA 2GCOA 3VTKA 4KODA 2JATA 1BMFA 3S1AB 1G3RA 2VP2A 5SZKB 3M0EA 4MITA 3NBFA 1GVHA 5IRCD 5DI3B 1CULC 5H70A 2CK3A 4C7OA 2WZQA 1MV5A 3IEVA 121PA 4L4UA 4P31A 3UWKA 3H0KA 3TUIC 1SQ5A 1NVVR 4ARZA 2QPOA 4QC2A 1YZKA 3KKQA 2PMDA 5HZKA 1L4UA 3SOPA 2AX4A 2JIZA 3CF6R 3HR8A 3W3ZB 3CLVA 2GQFA 4L15A 4MRVA 4TSFD 4AYWA 1D8TA 4B74A 4B73A 1R5OA 1NNEA 1KO1A 3H86A 4P33A 3ZC3A 4NYMR 2YWHA 1Z07A 4DIEA 1SKYE 2DFKB 5EUQB 3KKMA 1K8AD 4D0LB 3QKSB 3AUXA 4KBGA 3TR0A 3D6TB 5JHHB 1Q81D 1R5BA 2VRWA 3C5HA 3UANA 4B35A 2DERA 4L16A 4PTLA 5JI3E 1UKVY 4WA7A 1TF2A 4NCNA 1ZINA 3PJRA 4EKDA 3D31A 1R8QA 4UXJA 2GXSA 4FMCB 2DFTA 4DDWA 5K8UA 1EFHA 1Q12A 2CL6X 5SZJA 4KLZA 1Z6XA 1DBSA 4UJ3A 5E7IA 5CB8A 1FNMA 1G7RA 1XPUA 3AKDA 1MO5A 3ZVMA 2OESA 1LB1B 3CRMA 3FPAA 1A5TA 4M53A 1JJ7A 3D3QA 5KYKA 4BFXA 4CGZA 4Z8XA 2BBTA 5A0FA 1G7SA 2REOA 3CC7B 1KK1A 5AUQA 2V54A 4BLQA 1VDZA 3A1WA 3QXJA 1AS0A 3K70B 4Q1AA 1NLZA 3SU8A 2ODWA 4TTPA 4C0JA 2ASEA 2BBWA 5AN9A 2PX0A 2O8BA 1SKQA 4Q4JA 3DVLA 2FFAA 1F3OA 3W2GA 1G8GA 1F2UA 3NDPA 5TY0A 3CZPA 4Q01A 3DZ8A 5E4FA 2DPXA 4Q4LA 1DELA 4RFVA 2C95A 1G8PA 1V43A 4CT5A 3RWMB 3QBVA 3QKRB 1JR3E 3I62A 3E20A 1VG1A 2CHVA 1KGDA 1AKYA 2W00A 4KSBA 3CXCB 5KSZA 2OM2A 2ORWA 3EAQA 5JI2E 2JJ8A 2ZSEA 4M1KA 5JJIA 1H85A 3KQHA 3W90A 2WV9A 5G3YA 4KBFA 1H8HA 2AWNA 4ZIRB 2IW3A 4TN1A 3IIMA 1CIPA 1ZU5A 2Q6TA 2WVJA 2YV5A 3BD9A 4Q00A 5KTYA 4YAOA 5DNYB 4LV6A 421PA 3AF4A 1QHGA 1EFUA 1VG0B 1WCV1 3QI2A 1UKZA 4RSGA 1OXVA 5BW8A 5D3MB 3A4LA 3CCRB 2BN4A 3GLHB 1UJ2A 3CKLA 4GT1A 4LWZA 2OUKA 1UKYA 5D3QA 4AK9A 4IDQA 3H1TA 2RC5A 1KI2A 2A5DA 2ZI7A 1E0SA 1ZP6A 5AJVB 4LHZA 3EZ9A 2YYZA 4I4LA 4LOAA 4G3XA 4KJZA 3I73A 2F3RA 1J8YF 3QVVA 1R8SA 2WWWA 5C4MA 2JLZA 4K1XA 2F1HA 3EA0A 4B6FA 2C99A 1KI6A 1DTSA 4A36A 1GNRA 1E69A 3RDPA 1KI9A 1DAIA 3FTQA 2OG2A 4Q47A 3R7WB 4M4SA 1XTSA 4GBMA 4DQKA 4F91B 5HE9A 2FDCA 1ZNZA 2HMAA 1VQ5B 4ILEA 4DB2A 1GAWA 4ABYA 3TRFA 1MRNA 3K0CA 3K9GA 3LX5A 3OE7D 1QGZA 4R71A 4LJ5A 3FMPB 4YHBA 1T3SA 2H57A 5TVKA 3VU9A 3CNNA 3QEOA 1CR2A 4DT1A 2IYQA 4YXWD 4NCIA 2QG6A 1ZU4A 5KSYA 1JR3A 1F60A 4OHVA 1JA1A 2IUUA 3VR4A 2RGGA 3OW2B 4QNRA 1OHHD 5L3SA 2ZRFA 4IFBA 2JEOA 2GHIA 1UMKA 3JQPA 1E2GA 1N0VC 3KJIA 3CPJB 4DUGA 2BKEA 1IB0A 1KDOA 4RD2A 2ZS9A 3E2IA 4P6VF 3P32A 5G53C 1JXMA 1GITA 4IXMA 2QTHA 2GJ9A 4IHQA 5J40A 1A2KC 1COWD 1G5PA 1VQ8B 1K8RA 3PEVA 4PPGA 1KDRA 2CDNA 4TT3A 3PG5A 1P2SA 2B6HA 1NN3A 2GXAA 4NHOA 1RFLA 3VO2A 4XVUA 5FA6A 1IN8A 2DHRA 2PCJA 4A0RA 1L2TA 4JZKA 3K8YA 5L3RA 1C9KA 2FOLA 2OTJB 4US1R 2OT3B 2GEVA 2XZOA 1FMLA 4OHYA 2P5SA 4HE6A 1OIVA 3UPUA 3GJ3A 5L3QA 2FE4A 3W8NA 2BCGY 1JNYA 1YR7A 3ZVLA 3CCSB 2R6GA 5HPYB 5AJYA 3K09A 5KU1A 3TKLA 5BN5A 1XJCA 1LTQA 3ZDQA 1DDGA 5GV8A 2ZVPX 3CPEA 3GLHA 2Q3HA 3BFXA 4V0MA 4L5BA 4TT3D 4B34A 4IFEA 3QF7A 2QPTA 4ZV4A 1IXSB 4B6EA 5CIQA 4LGMA 1P62B 4PSVA 3TR5A 2NTYC 1DAKA 1QHXA 4F38A 1DARA 3VR2A 2ODEA 1R6BX 3THXB 1KO8A 1K5DA 5EP4A 1GKUB 2KBFA 2W58A 1NIPA 2IK8A 1YIJB 3MRSA 4D6PA 2CCJA 1ELOA 2XB4A 3ZZTA 2ZI3A 4W5WA 4AC9A 3PEWA 4QHYA 1KSJA 1ZNXA 5FR2A 1RC8A 1GUAA 3L43A 2VHUA 1ZVQA 3VKWA 1JB9A 3GJ4A 3U3OA 1AK2A 4EJSC 4OI0A 4QBFA 4D82A 4HLUA 1D5CA 1NRJB 1P9RA 2AXNA 1ZMXA 2N1BA 5CLLA 2GKSA 3BE4A 3K0FB 3ZD6A 4B76A 1Z2CA 3WRXC 1TUIA 2ECKA 5P21A 1SHKA 5EP3A 1G3IA 1OW3B 1ESMA 5EXTA 2A9KA 5J47A 3ZS8A 3UWOA 1NLFA 2YOHA 4IW3B 5FBQB 3ZZUA 4AG6A 5AWFC 2B8TA 2WAXA 2XTZA 1AJEA 4BFVA 4HB4A 4XVQA 2WKRA 2J0VA 2J59A 2GXQA 4CZ2A 1GL9B 1G20E 5KSPA 1CP2A 4EH1A 3G5UA 1G8FA 2CBZA 1WDTA 4IXNA 1W0KD 1XEFA 4PC2A 2NO0A 1ZCBA 1U94A 1SKYB 3BJIC 4O3MA 1YZQA 3QFCA 1W44A 3CO5A 3P20A 3REFA 1E0KA 1HURA 1S1MA 4D4LA 4QKQA 5DE3A 3AVXA 2RGBA 2WWGA 4NCHA 2QENA 1P9WA 4KXFB 1TL7C 4IDPA 2V8OA 5AR1A 3VNVA 4TMVA 3GLIB 4JLAA 3JVVA 2VPPA 3B8HA 4U02A 3EPJA 1EGAA 1JEDA 2ZI6A 3AH8A 4BUJA 3CZQA 3GPLA 2DWPA 3WMFA 4RD1A 2OXCA 3LW7A 1TLLA 2PMKA 3NC1C 3IDQA 4V0NA 5G41A 4I1SA 3KQNA 3A6PC 3AEZA 2FJUA 5JZVA 521PA 4I99A 2XSZA 1X8JA 1E9CA 3X1WA 2IT1A 3FHTA 5TB5A 2JLSA 2NIPA 1PUIA 1NJID 1GTVA 4H1VA 2Q21A 4TMWA 4KVGA 3TSWA 3DDCA 3IGFA 4M8NE 4NH0A 2Q3MA 1G3MA 4XWKA 3OJXA 2CE7A 2LCFA 2UZIR 5TDHA 2EFEB 6Q21A 1Q3TA 1L4YA 1XXHB 1Z0KA 1OH7A 1XJ0A 5JRJA 2OFWA 2WWHA 3LLUA 2X19A 3Q72A 5GJVC 3BC1A 4LBVA 4P4SB 4MKFA 2ORIA 4OQXA 3T5GA 2ZTSA 2ZRLA 3CCQB 4TL9A 1OB2A 2RCNA 3DM5A 1YZUA 2XJ9A 1IONA 2ZR7A 3W3AA 2RGAA 4P32A 2VF7A 4LRWA 4D26A 1OIWA 1IXZA 4NKRA 2ZROA 2VP4A 3DKVA 3NHBA 4PC7A 1IN4A 1EXMA 1IM2A 3QJYA 2YWFA 2VP0A 3FMFA 2XITA 4GZLA 4ON9A 5BWMA 4HATA 3DMDA 4A2WA 3GD7A 1G4UR 1NMXA 3RS5A 2GVZC 2MSCB 1Z63A 1FZQA 3QE0A 1VQKB 3V00A 5JS8A 1NSTA 4Q9JA 1J7KA 2IUTA 1M6NA 4NYJQ 1NVWQ 4DSTA 2WPDA 1Y3AA 3THYA 1GNQA 5HCNA 3A36A 5JLJA 2J45A 3K9HA 1G16A 3AKEA 3AVUA 2OSBA 5CDFA 1OFUX 4FCWA 5TV2A 4GOJA 4X8LA 1IJFA 3EIEA 1Z22A 3BH0A 2DETA 2H18A 3IIJA 2ODNA 2NQ2C 1XB2A 1MRSA 3KTAA 1E62A 1OIXA 3CC2B 1TF7A 3FWYA 4JMPA 1GSIA 4GOKA 1J99A 3R9IA 2CLCX 3PQCA 3GJ6A 4ZIRA 1NJFA 3LD9A 1Q0UA 2OILA 3ADKA 2YHSA 3W34A 1JALA 4HDQB 5FBWB 3HPQA 1QVGB 3CR8A 3RRMA 1P6XA 3ICQB 2W2TA 3AVQA 4MDFA 4Q7JB 3MWYW 3IBYA 2QEXB 2V7QA 3QG1A 2NO7A 3PFIA 3OZVA 4PHFA 4LBWA 4HLDA 1TX4B 4NP6A 3RYTC 1I2MA 3T35A 1N3BA 4G1BA 3K70C 2WJGA 1ZD1A 3D8BA 1LW7A 4E03A 2R6CA 3CX7A 1Z8FA 5FUVA 1U98A 4LZZA 2PBRA 1E1RA 2HCJB 1ZJ6A 1E9EA 4RD3A 5JJKA 2RGNA 1XX6A 1RZ3A 3C16C 3OFND 3RVBA 4IRUB 2XZPA 1ZD8A 3GLIE 3MCAA 3DEFA 1QFYA 4LC0A 1Q22A 3UG7A 1US8A 3U4QB 1KNQA 3A37A 2WSSA 1P9NA 3EZ2A 5H68A 1JJVA 4WOPA 5B64A 1GM5A 2FH5B 1MABA 3BFKA 4TL8A 3WYFA 3EC1A 1KYIA 4DWJA 1XMVA 4LJ4A 2FZ4A 3U7FB 1J2JA 1UBGA 1GNPA 2CLSA 2AK3A 3L0OA 1DDIA 1YI2B 3NIBA 4C0AC 4TMKA 1QG2A 3K0CC 3H84A 2BM1A 4KITB 2HV8A 3W5VA 1WBBA 2OBNA 4QJ3A 1NBMA 3GEIA 2WJHA 2QMEA 3UMFA 2QE7D 2HT1A 3N2IA 2R6AA 1JB1A 2OBMA 2VHCA 2WPDD 4HAYA 2GAAA 1WB9A 5JBQA 2F6RA 2XZLA 4DLZA 1EP3B 4WXPA 3X1YA 1KOFA 4M21A 2P65A 2KI5A 3K0AB 2BWJA 1OFHA 1QHYA 1YZNA 1SXJE 1KMQA 4MKGA 3QF4B 3PENA 3SFZA 4URWR 2AFHE 1XCPA 1ZUHA 1FDRA 1NBMD 3WY9A 3BK7A 5FPSA 3R8CA 3GLGB 4W7SA 3U60B 1SVMA 1F48A 4A82A 5DN6A 2OAQ1 2FGKA 3GJXC 4BFTA 5KOYA 1NVXQ 1NN1A 2V1XA 2ZU6A 4OHWA 1HQYE 2VYQA 2R62A 4BRUA 1CJKC 1JECA 2HXYA 4LV5B 5DYGA 2RKOA 3A1SA 1E9RA 3HWSA 4N0DA 3SN6A 4D4JA 1NKTA 5TXGA 1OHHA 3U44A 1P2VA 2BDTA 2DWOA 2IHYA 3KKOA 4Q03A 1CRPA 1A2BA 3CF2A 3VKGA 1CR1A 1K9MD 4C43A 4LHXA 4YXWA 4N3GA 1ZM3A 4G1UC 4E5UA 1AM4D 4UNRA 2JLRA 1EK0A 3THOA 3AQ4A 3B1WA 2IWRA 3K53A 2WMOB 3L0PA 4BFZA 1IY2A 2XNDA 4GI7A 4HLCA 4TQ9A 4YQFA 4BGDA 3LVRE 2IYYA 2C8VA 2N46A 1J70A 1UBCA 3MG9A 4QGAA 4HEJA 1ESNA 3ETLA 3LBHA 2C04A 2PZFA 1OJLA 4PHTA 3NBXX 5AUNB 2J41A 3SR0A 3C41J 3LBIA 1G18A 1RKBA 3B82A 4Q48A 3BFVA 3O8DA 1ZRHA 2G77B 2V9PA 3ZBUA 2VHJA 3W2HA 2TMKA 1YZLA 3PCRB 1BS1A 2ATXA 3TAUA 1GRRA 2D2EA 3C15C 4ARZB 2GRJA 2QNRA 4IVRA 1XBTA 3QF4A 3BB1A 1OXTA 4NCKA 1D9XA 4YLGA 3WRYC 3DM9B 4XSGA 3HU1A 2F3TA 4QFMA 1XEXA 4URZR 1R0WA 3IPYA 2WKQA 4ERNA 4QGFA 4BZPA 1HV8A 1MT0A 3CRRA 1G41A 4G5GA 2ZAOA 3L0SA 5KNBA 1YKSA 4EUNA 4HB2A 4BEJA 3R8FA 3JZMA 1XD8A 4U7DA 4LHWA 4RZ2A 2OTLB 3H4MA 2IYUA 4YAUA 4JJKA 2VQSA 5FOTA 4A6XA 4F92B 2OCPA 1E2IA 1TU4A 5HXBA 2WWYA 2QP4A 2QMHA 4MGYR 4PO9A 4DBLC 4I1OA 1G17A 3MLEA 1A1VA 4IVPA 1OLOA 2EYUA 4BLSA 3GEEA 4B2PA 1C4OA 4JYBA 5G40A 4LC1A 4B3CA 4JBXA 1XXHE 1ZM9A 3NC0C 2H8KA 1MABB 3KDSE 3I72A 1VQLB 2A30A 5BXQC 3NHAA 2JA1A 5J4VA 3GCGA 4R2IA 3K0AA 3QPWA 3WNBA 4ZO4A 3OIVA 5DGXA 2OE2A 4WAUA 5C46F 2ZVQX 4B3FX 3CX6A 1Z0DA 2B8WA 4MRSA 1SVKA 3HYRA 1ZW6A 3R20A 1FQKA 2O8EB 3OIWA 1Z83A 2EW1A 2O5VA 4YMWA 5B57C 1S2MA 1GZSA 1D6JA 4KLNA 2OK7A 2BMJA 4B4DA 3A4MA 3GJ8A 2ZXUA 2FSFA 3LO5A 3HDTA 5EE3A 2VTKA 3SI7A 4EQ6A 3AF0A 3DKPA 3ADDA 1KTVA 3U61B 1E2DA 5LBIA 4LJ9A 3EZFA 3PV0A 4PGOA 3BS4A 2G1KA 1E3MA 4B2IA 5FTKA 1KI8A 3JVUA 1N5IA 2WJVA 1OKKD 4EDHA 2F1IA 1Z08A 3AP1A 1NJGA 4HAUA 1I2DA 1JI0A 2DBYA 4KFSA 4QNMA 4ZGNB 1U90A 4U5XA 1S0UA 1X8LA 2H17A 3CWZA 4P4SA 5DH9A 3X1DA 1VQPB 4LJ7A 4LYFA 4QGHA 3W8RA 4V0ME 2XAUA 3PUVA 2DYKA 4D2IA 2VSFA 3GJ5A 4DLWA 2ONKA 2GBLC 3R9WA 3CCEB 4TMZA 1COWA 3PVSA 4ZKEA 3BWDD 4GRAA 3ES9A 2GCNA 2W6ID 4PHHA 3CCJB 1V5WA 4V0OA 4CF7A 4NYIR 4LJ8A 5CM8B 4MRRA 2NO9A 5HKKD 4D4KA 1YRAA 2OAP1 1BIFA 4EPYA 1R2QA 1E2PA 1Z6GA 2WIAA 4JLBA 4PQYA 4WW0A 2FFQA 5JEDA 2P0EA 3SBDA 1EFRA 4MH0R 1FNNA 2QA5A 5FBVB 1E1RD 2BVNA 2VNIA 2EWVA 2VBCA 5HCIA 2Z83A 3DO6A 3OAAD 1KI6B 3CF0A 2QSYA 1QFJA 3W5UA 3THWA 2V55B 4PPNA 3PEYA 4RVCA 3Q7QA 2RH5A 5C4GB 1E94E 2VSOA 2PLRA 4B3XA 2O8CB 3AVOA 4XOIA 3GP8A 5CYOA 3RRYA 2PT5A 2EIXA 1G7CA 2GCOB 4H1UA 4M9SA 3WP0A 4RZXA 1VG9B 3RLFA 5ELXA 4PQRA 5EE1A 4AKGA 1L7VC 2ZRHA 1CJVC 1OSNA 5E95A 2LWIA 4JSTA 1FMJA 5L3SB 1RRPA 3ZD7A 1FTSA 4DLTA 2ZE8A 1W2BB 4QGGA 2X77A 4G5OA 4TLCA 3SEAA 1QZXA 5KSWB 3OEHD 1W1WA 1N6NA 1W4AA 3T34A 3B85A 1UBEA 3Q9LA 1AS3A 4E09A 3KFXA 3TJZA 2QTFA 2GNOA 1N5KA 3FMIA 5JWOA 1I4TD 4LPKA 3K9LA 1I7PA 4RD6A 1ZUNB 2QDXA 4LBZA 1KNXA 2WICA 1XZPA 2ZR0A 4NDZA 3NXSA 3THXA 4PPFA 3CD6B 2BIFA 3I32A 1RE0A 1UDXA 4BZQA 4LHVA 2EU8A 5KSOA 2Z4RA 4RCZA 5EUMA 3W2IA 1CJUC 4NL4H 5FOVA 1R0XA 4QBIA 2OO7A 2IXEA 4N1AA 3RC8A 1BKDR 3VR6A 2XNSA 2JLVA 1RPZA 5B58C 3SJZA 1YJ9B 2Z43A 3U2QA 2O8CA 1EESA 3AVVA 2PLFA 3T1QA 3TVDA 3FE2A 1E9FA 3P4YA 1GRNA 2FWRA 2ZPTX 2MSDB 4Q66C 3TLXA 2F1RA 1TEVA 4KO8A 2NG1A 2QUZA 1TQ2A 4AG5A 2V1UA 3FB4A 3FJOA 1KJWA 2DR3A 1W87A 2VO1A 1JAHA 1XD9A 4Q7LA 1Z0IA 2WHXA 2J46A 1GAJA 4FINA 1Q7YD 4PAOA 5HZHA 3IHLA 5JEEA 2I4IA 1Z0JA 1S9HA 4KI0A 3QKSA 3UK6A 2FV8A 4Y0VA 5E7MA 2ODBA 2DFLA 1GKIA 2WSSD 4Q4HA 1OGJA 3OE7A 1UPTA 5J5CA 4M1OA 5IK2D 4GSYA 3CX8A 3MJRA 5E3HA 4BPRA 2VZLA 3V76A 3K0EA 2V4ZA 1Q3HA 5LDDC 2ZYVX 2F7SA 4Q4JB 1WMSA 1G9XA 4RD0A 5D3MA 5J4YA 2ZI5A 2WIBA 5KHOC 1OYYA 2WAYA 1IN7A 1KRHA 3OEED 5KNDA 1PVOA 1Q1QA 2IS1A 1IBRA 1Q44A 2HJVA 4HUQA 2YJTD 1P73A 1DEKA 1E2JA 4AIIA 2G1JA 4M9XA 4D4MA 1AGPA 2Q0HA 4JLDA 4XWAA 1BYIA 5JWHA 2GK7A 2YC4C 2V7QD 1YR9A 3KB2A 4WBSA 4US2R 4DLRA 5JCZA 3X1XA 4C0KA 1AKEA 4C0LA 1NVVQ 1W49A 3V4RA 4DCSA 5ANRB 1G8YA 4PZLA 1SVLA 3BOSA 3BGWA 1KK2A 4BLPA 1CR4A 1DS6A 1FFHA 1ZYUA 2AL7A 1PJRA 1KO7A 2R44A 4D0NA 4YMVA 1OH8A 1W36C 1OFIA 1ZBDA 2G3YA 3PUYA 3E1YE 4CEIB 1YQTA 1SVWA 2DWQA 3CIOA 2EQBA 4W5HA 1E96A 4KAXA 4QL3A 3SE0A 4TYQA 3ND8A 1YZTA 3QNUA 3LXRA 3FHOA 3ZJYA 1G3UA 3B5JA 1QHIA 1X86B 2AD1A 2JIZD 1H65A 4OK5A 3OF5A 2XTNA 2G9NA 2FPMA 2QPAA 4C3ZA 1M90D 1ZCAA 4DSOA 4R7ZA 3TUJC 1F5NA 2FGJA 1II8B 1NKSA 4JLOA 5EXSA 4IVQA 1Q1EA 4DEXA 4NBSA 3PITA 5CDFE 3TW4A 4KYUA 3RAPR 1RJ9B 2BMDA 1WP9A 1AZSC 1VYUA 5HTKA 4URUR 1JJ2B 4CEJA 3RS0A 2QA4B 2NO1A 1CXZA 4Q21A 3SDZA 2LKCA 2ZU0C 2FEMA 1SM4A 4QOSA 1EP2B 2AXPA 4ZCMA 4DRZA 5JSZA 4OHXA 3LO8A 4OHZA 1HQCA 2NGRA 1RIFA 1HE1C 1Z6YA 1A4RA 1KSHA 4ACAA 2EYQA 3KUDA 4KV9A 2FSIA 2EFGA 3KB1A 4IKEA 1A8PA 1T6NA 2AN9A 2AKAB 4BE7B 3KUCA 2F55A 4UNSA 3IO3A 4WVFA 3PIRA 3QOFA 2P3SA 1R5NA 3RANA 4F4CA 3EXAA 3U6KA 5FPYA 3RRNA 4Z51A 5B30A 5KDOA 4FMCF 1OH6A 4BLTA 3QG5A 1X1SA 2H16A 3QXHA 3L82B 1II9A 2XNDD 4A0HA 4G5RA 5FTJA 2IEYA 4MA4A 2QAGB 3A1TA 3M4YA 4FMDF 5LPNA 3CMEB 2OHFA 3EPLA 2JJ1A 1KJZA 1KO4A 4TTRA 2BGIA 4II7A 3B1ZA 2IYRA 2QGZA 3CNOA 4Z54A 1M74A 3VR1A 1E9DA 3TGPA 1AIPA 2AK2A 3DZDA 3IPXA 4BLOA 4D81A 1NG1A 2QEQA 2WWXA 3FKQA 2ZJ2A 4IEIA 4V03A 3N5CA 3CM0A 4OK3A 1FOEB 3BBPA 1M7GA 3T06B 2ZM5A 1QGAA 2VSXA 4N3NA 3DL0A 1KZ7B 2BGJA 2XX3A 1UADA 5CITA 2QZ4A 2Q9CA 1VQ7B 4G0NA 1GILA 2KSQA 5BYJA 4DEYA 4Y7CA 4OQNA 2C03A 4Q7MB 1G1MA 3ZVNA 1FX0B 2GETA 4RZ3A 2BC9A 4PO1A 1JEEA 1YJWB 4JVSB 3U5ZB 1W0JA 2KJQA 3CCMB 1KKLA 4MQBA 1SZPA 3VKHA 2YWGA 2CL0X 2Q3FA 4RFSA 1GL7A 4Z8YA 2HLDA 1BH2A 1KY2A 4JLPA 3SJCA 1HYQA 1LFDB 4M1TA 3CRZA 1KD1D 1G19A 1XEWY 2QORA 4RCYA 4HB3A 3VHXA 3UATA 2HLDD 2WMNB 5K8IA 4HDCA 4CIDA 3TNFA 5DHAA 1E2FA 4DDVA 3QXCA 1QX4A 1X3SA 3AF1A 4DCVA 2XGJA 3EZ7A 1KI4A 3E70C 2REBA 4GOXA 3SHFA 3GMTA 4M1YA 1EWRA 2RGEA 1D1NA 3B7GA 4UXIA 1KAGA 2F1JA 2YOGA 4URYR 1FQJA 2IXGA 4C0HA 1N0UA 3HPRA 4B43A 3I3SR 1IAQA 1T8UA 4JSYA 2VEDA 1NLYA 2CMKA 1UDWA 3I8XA 3LFUA 4XWOA 3CC4B 1RJ9A 2FFBA 3MJHA 1U99A 1E9SA 1XF9A 1FRQA 1YU9A 2ANBA 1VHLA 1OXXK 2J7KA 4ESVA 3LAWA 1YVDA 1KHTA 4NYIQ 3M6AA 4QG7A 4DSUA 1KDPA 4HB0A 2R6FA 4P4TA 4Q1BA 5FPTA 3KQUA 3KJEA 4A15A 2E1RA 3KZ1E 2ZJOA 1TADA 3GEHA 1AS2A 3ZIAD 1VYVA 3B1XA 5DIFA 4PANA 1LF5A 5JS7A 1NL3A 4DT1B 4LK2A 1E2LA 5AJZA 2GZDA 1VCNA 1T3LA 4AF7A 1II0A 5GVRA 4OJQA 5A4JA 4F93B 4FW9A 2R2AA 1XWIA 4C0QC 1US8B 2FN4A 4M22A 2WWIA 1W7AA 3THWB 3N70A 5JECA 3C8UA 1KO5A 2AD5A 3LXXA 5DO9A 4XD7D 4JVMA 3UIEA 1U8ZA 5SZHB 1EX7A 2W6IA 2R6HA 4HZIA 4AYXA 2A2ZA 2O8FB 5J4KA 1TPZA 1VTKA 1EX6A 3U44B 1KI7A 3GLFE 1G6HA 621PA 2ZUCA 2CXXA 2ZIAA 3WYAA 2VH5R 1G8HA 3I56B 2BM0A 4G01B 4Z1MD 3QFTA 4DIDA 2PJRA 1QHSA 2BJVA 1GRQA 1SULA 2RHDA 1QG4A 2OBLA 4QJ5A 4HAXA 3RS7A 1XCGB 1HT1E 2CEAA 2O0KA 1MKYA 2D62A 1R10A 1M7HA 4PR0A 4WZAE 1VECA 4CYMA 1IQPA 1CJMA 1B23P 4M0LA 2D7CA 2HDNB 2MMGA 3T15A 3PUWA 2V6IA 1RYHA 3DOFA 4U00A 2R6DA 5FFMA 2J5XA 2VHQA 1K6MA 4BPBA 4K81B 2O8DB 1MR3F 4MYHA 2I3BA 4HAVA 2ZQ5A 2YKGA 5DYIA 2QT1A 2SHKA 3C14C 4MRNA 1H8HD 4B44A 3QFRA 3QBTA 4LX0A 5KO2A 1BO6A 2K5UA 2QRZA 4BEBA 2J0SA 1AQYA 2WSMA 3WXMA 1F6BA 4V0LA 3VAAA 2N42A 4LUCA 2ZI4A 3KTAB 1W35A 4KCGA 2XJ4A 5FI1B 2QP3A 4KFUA 4B3DA 4YDHB 3MAAC 4KYIB 5IT5A 1CF4A 3Q8XB 1QBKC 5L3QB 3LWNA 5KPJA 2QL6A 4WZ6A 3I4LA 2XEXA 2W6JA 4JLKA 4FXPA 4CW7A 2YZ2A 3B13B 4BFYA 3GLGE 1M1KD 4JT2A 5AK0A 1WA5A 5FTMA 1R0ZA 2GAOA 2O8EA 4ACBA 3IO5A 1SXJD 1LNZA 4CEHA 3I1FA 1P72A 4C30A 2NMVA 2HF9A 3MGCA 4IOJA 3FFBA 4UJ5A 4MGZR 1AMOA 3T61A 3G0HA 5H8WA 5THXA 1IN6A 1F20A 1SVIA 2GZAA 3WHLA 2C78A 4HLUC 4V02A 3U7GA 1U9IC 4GMXA 4DXAA 3DPUA 2GK6A 4BZXA 1NY5A 2W6JD 5F9FA 1Q20A 1MO6A 4PSKA 2IHBA 3ZZ0A 5DN6D 2A7QA 4HZUB 3O8CA 3GQBA 3X1ZA 3W6PA 1D2EA 2B7BA 1IN5A 1G3QA 3CWQA 3FYHA 2B92A 4JLNA 4YMSA 1XU4A 1CTQA 3WMGA 1XEWX 1XMIA 4TYWA 3ZQ6A 3U3MA 3ZYCA 3OIUA 3VO1A 1Q1ZA 2R9VA 4TWZA 4RD4A 4NPHA 5HE8A 3UXMA 3TAHA 4DLSA 5JCPA 2QTVB 3PXGA 3QY0A 3G4SB 2RAPA 4KSCA 5F9HA 3MHPA 1D9ZA 2G0NA 4A92A 1IY0A 4QM6A 1UKEA 3SQXA 221PA 2C5LA 4C2TA 4POAA 5GVSA 2UKDA 3LH5A 3TE6A 5JHGB 2VA8A 1QHHB 4JS0A 3ZLJA 3EX7C 1UBFA 4ZDIA 2ZUDA 1QUEA 4L8GA 1KAOA 4OQMA 4TLBA 3SNHA 3VR3A 3ZVRA 2PIAA 2HYIC 2ZSAA 2OCAA 1QDEA 2UZ3A 5F98A 1U9IA 1W46A 1WXQA 1HY3A 3N2EA 5DI9A 3W5IA 4DLYA 1SXJC 2P6UA 1XDBA 4EJSB 4LY6A 2EFCB 3TK1A 3NDBB 4LYJA 4M1WA 3I8SA 1OF1A 1P2UA 3PUZA 1QVAA 5JRZA 2JLXA 3KX2A 2QT0A 1G5TA 3VNUA 3EZ6A 4B71A 1S3GA 2O0HA 2RGDA 2A5YB 2IYTA 3PEUA 1RRCA 2QROA 2CJWA 3EPKA 5JJLA 2D3WA 3BB3A 5FTLA 1VCMA 1YITB 4XH9B 3CPWB 3TMKA 1N6OA 1QVRA 4OK6A 5M04A 3K0FA 5FOUA 3K0SA 2CCGA 4Y9UA 3NWJA 2QTZA 3QSYA 2BF4A 2HYDA 2YWEA 4YONB 1JBKA 1BX0A 2NPIA 2CVFA 2I1QA 1FW6A 4B33A 1IXRC 3IHWA 4CDGA 2CCKA 3CRW1 1DAFA 1Y63A 2GEDA 1NN0A 1HTWA 1ZC4A 4A8JA 1B2RA 1P5ZB 2Y8EA 3RHFA 1NMZA 2LKDA 1Z28A 2FX3A 1AA9A 2FSHA 2X3UA 1SVOA 1VCIA 1WRBA 2IYLD 1WQ1R 2J87A 2QQ0A 2WWFA 2YC2C 3KKPA 3T1VA 2ERYA 1T9HA 3OZUA 1XPOA 1VIYA 4LJAA 5E7JA 2R65A 4C7OB 5CLQA 3AVYA 2ZETA 2RGNC 3RSOA 4JLMA 1ZIPA 1TU3A 3BB4A 3BORA 4C0BA 3O8BA 1T91A 3LQQA 1XFAA 1T4GA 3BXZA 1C1YA 2QY9A 2BCJQ 4KFTA 1GKYA 2VNHA 1U81A 2VP5A 3AP3A 3VX4A 4ZDKA 1S4QA 1U0LA 2FA9A 1T0JB 2O52A 4W5JA 4PAMA 1E79D 2JGNA 2BJWA 1FL9A 4A2QA 4C4PA 1G64A 2J1LA 1SGWA 3LNCA 4OI1A 4JLVA 4QHTA 1DADA 4Q1CA 4I81A 4XSHA 4IOKA 821PA 2W0MA 3MUFA 1U0HC 1HUQA 1VIAA 4DLVA 2QMOA 4PC3A 4AKIA 4FMBB 1QVFB 2D7DA 3QPUA 4EJSA 1NVUQ 2JCSA 2IS6A 1RRGA 4Q9LA 4Q4AA 1S1CA 4BFUA 4GL2A 1UM8A 1N6RA 1XP8A 3G82C 2DY1A 2HUPA 3PUXA 1J9ZA 5GADl 2DEUA 5CYPA 1FP6A 3EWAA 2JJ1D 3SC3A 2Z0MA 1XNJA 1O87A 1XTQA 3BH6A 3UKDA 3A1UA 5FL7D 5C18A 3ADCA 1EWQA 1XTIA 1JPJA 4TQAA 4DDUA 3I55B 1QH0A 2BBOA 2J0UB 2IF2A 3QFSA 4GMDA 4QHSA 2QU8A 2GJ8A 3W6NA 2IXFA 5C2JB 4LYHA 2BMEA 4BASA 1W48A 1E1QA 2NPFA 1E63A 1VG8A 2ZYTX 1W34A 2GESA 2CNWA 4TLAA 5CK5A 1PV4A 1W4CA 2ZEJA 4Z1MA 3L2OB 4B2LA 3OESA 2D74A 4MDEA 2ZYUX 4TQUS 2IA5A 1XMSA 2ZJ8A 3NVAA 2G0TA 3QKRA 1VQ9B 3HU2A 5FI0B 2Q9BA 4A4DA 3FOZA 5TMPA 2H92A 4NONA 5SZIA 3I61A 2OZEA 5HKKA 4BWYA 4A6PA 2FF7A 3LDAA 3DMNA 1AGRA 2ORVA 1XTRA 4OI4A 4Q7KA 1G4AE 4OJKA 3SZRA 2X2EA 5KPDA 2CE2X 4JLJA 3ZBTA 3UMSA 2ZJ5A 2O8BB 1E0AA 5IF9A 2ZREA 1KZGB 1XJQA 3CCLB 3B60A 2C96A 3FKSD 3H2YA 2Z6VA 3U4QA 4MYTA 2YINC 4Q4HB 3CR7A 4TMTA 1OFTA 2FU5C 2EFDB 2QSZA 4FCTA 3GLGA 4NCJA 2YNMA 2BEKA 3TQCA 3IQXA 3SS8A 2CLDX 1OYWA 2ZRJA 2IEZA 2EVWX 1GJRA 4B75A 4A0FA 1ZUIA 4Q18A 5EE5B 1GDDA 4S2EA 1VHTA 1GAQA 3AV0B 1ODFA 2RGCA 2ZI9A 2QBYA 2R8RA 2OLJA 4Q1EA 4WXRA 2PL3A 3NBYC 2HCBA 2W83A 3B1VA 3CMAB 3U6BA 1S72B 1FPMA 4XTRA 3P4XA 2OCYC 2DB3A 2BKUA 4Q1DA 3O8RA 1Q1BA 2V6JA 4JYCA 4DLXA 2OFXA 3CUEF 1ZM2A 1HA3A 4JJZA 4JKIA 4NMMA 2AKYA 2OCBA 3KKNA 1P61B 4ITRC 1OGIA 3RS4A 4HUTA 1Z5ZA 1XMJA 4D80A 1FNCA 1RRFA 1QUFA 2WJYA 1E2HA 4Q9IA 1EG7A 4HAZA 1F2UB 2GPJA 2VP6A 3WHKA 1VQNB 2X8AA 3IBGA 4CRWB 2V3CC 3OIYA 1DPFA 4G1VA 3CB4A 1P7CA 3Q5DA 1DVRA 3QVUA 2ZANA 3F5FA 3CRVA 4B32A 3GJ0A 4JVLA 1CR0A 2H7VA 2J0QA 4B48A 1HT2E 3NG1A 2IL1A 3O47A 1CQXA 3V9PA 4TSFA 1KMHB 3JQQA 2QAGA 4HLQB 2GWHA 1JPNA 1CJTC 3MFYA 3GLIA 1ZNYA 4O0MA 3S1AA 5L3VA 4ZPXA 1E2EA 3OZXA 1Z29A 1NSFA 2ZE6A 2J7PD 1VQ4B 2NZJA 5CIWA 1YZGA 3B2EA 3V4FA 3SFVA 3CW2A 1N6LA 2YOFA 2ZRIA 3I5XA 2IYWA 4PZZA 1UAAA 3LX8A 4Q5IA 1OXUA 3WP1B 2W2VA 2DFNA 2XXAB 4ASUA 4KVAA 1P3JA 1MH1A 4AF6A 2KWIA 3LV8A 2OLKA 3QQ5A 4RFSB 2GVDC 4YMTA 1PUJA 2WTUA 2KBEA 1N25A 1X1RA 2MMCA 1H8ED 1S8FA 1SXJB 2F43A 2JLWA 4OQFA 5DSZA 1KQSB 1GP2A 3SBEA 4FD2A 3WBJA 2ZJAA 1DAMA 3BH7A 1EFCA 2ANCA 4K8OA 5FUXA 5BN3A 4NU0A 1GIAA 2IWHA 2G88A 3EW9A 3P26A 3AKCA 3ECCA 1D2NA 1Q86D 3CNLA 3EIQA 3PR1A 3NEJA 1U2RA 4HDOB 5LD2B 5FL3A 1IJEA 4FIDA 5TARA 4TYPA 4UKDA 4IOLA 4N0EA 3X2SA 4A8JB 2WM9B 1KK0A 1W47A 1YHNA 3OJWA 1T3HA 2VLIA 3TBKA 1DE0A 4O2LA 4LPSA 1QF9A 1W4BA 5KNCA 2BHRA 3ZS9A 1EWYA 2CNWD 4URVR 4I1VA 1FTNA 4YAWA 4EFNA 3QXSA 1CRQA 2E9SA 2WJIA 4TLDA 1M8PA 4M1MA 1YJNB 1T5LA 3AVWA 1N2CE 5EE9A 2P2LA 4H9GA 3Q85A 1N6HA 4LCBA 5L8VA 2ZYWX 3NH6A 1DG1G 5EXXA 3RS3A 3TVTA 4EPWA 5GJCA 5UKDA 2X1VA 2FMXA 4RJLA 4OQLA 3KXKA 1NG9A 2P6RA 3KFVA 2O8DA 1MO3A 1F2TB 1PLJA 2HXSA 5LB2A 3ICEA 2ZITA 4ESHA 1MOZA 4D25A 1BOFA 3VMFA 2FSGA 2CJWB 4HUQB 4KU4A 5J4HA 1LY1A 4EFMA 3K09C 3QE2A 1ONBA 3RC3A 1SHZA 1XTJA 1GL6A 4C0SA 3RWOA 2ZRPA 3VX3A 4CVNA 4DZZA 3IILA 5TR9A 2GF9A 2ZJBA 4EIWA 4UNQA 2VL7A 4DVGA 3KQKA 3EIHA 4LI0A 721PA 3F0TA 1RW4A 4RY2A 2XNCA 4AY2A 1IY1A 5EJEA 4XD7A 3TIFA 4A8JC 2RC6A 3FPKA 1ZC3A 4DCTA 4IDNA 1DO2A 1Z06A 4XVRA 4YAFA 2VYFA 1E98A 1PLKA 4TMXA 4TLEA 2XNJA 1Q21A 4DB4A 4TYNA 4UAJA 2HT6A 2IYZA 3ZQJA 1KSFX 1N8RD 1H8EA 3KXIA 4AWXA 4CEHB 1Z0AA 3BIFA 2DCUA 1N5JA 1GOTA 3FVQA 2GF0A 4BECA 2IS4A 3JZAA 4EAQA 5GJWC 3RABA 4DUGD 2JLYA 4QXAA 1KIMA 3WBKA 1W36D 4ZKDA 4WQMA 1UF9A 2IUSA 2QBYB 2QAJA 4E07A 4JKYA 1NBME 3EPHA 2AFIE 2BBSA 3CRQA 3OHMA 4Q02A 5DI3A 1N0WA 1YE8A 1D2MA 3C4JA 2AR7A 2FG5A 3SJBA 2GTPA 2ZRKA 4B3GA 3QENA 4ZDWA 3JQRA 2J7PA 2F9MA 2IYSA 1TNDA 5FPKA 1Z6AA 1FRNA 1A82A 4HI0E 4IDHA 1CKEA 2Z4SA 1NF3A 4DHEA 4OBEA 2FPKA 3UMRA 2RB4A 1W5TA 3ZH9B 4A9AA 2O0JA 2XXAA 2D4HA 2XOKD 4K46A 1P75A 2UVQA 4MUBA 3REGA 1N6IA 2JAQA 2ZSBA 5JFGA 2ZUBA 3LVBA 1R7RA 3L8YA 3Q3JB 2A3RA 3VFDA 5GV7A 1M34E 1EP1B 3RRZA 1XPRA 1CNFA 5CB6A 4LYAA 4GZMA 3MWJA 4LBYA 1II8A 2P5TB 2QAGC 1W4RA 3QUSA 2CHGA 1J90A 1M1YE 4QJ4A 5FOXA 4I1UA 5EZ6B 1TEXA 1GFIA 3GFTA 3B9QA 5FOWA 2ZS7A 4PZYA 1X8KA 4A1FA 4UXHA 1ETUA 4PFSA 3HJNA 4EPVA 4R2HA 2O8FA 3LBNA 5EZ5A 5CK4A 1W0JD 1FUUA 1CLUA 3KJHA 4GNKA 4GP7A 1KY3A 2HF8A 2NZ8A 2J0UA 3LY5A 3K1JA 3TH5A 2C77A 4W9MC 3SJAA 2F9LA 4ZGQB 3NEYA 2GXUA 1PLLA 4L9WA 4BLRA 4QM7A 1JR6A 4R9UC 2CL7X 3THYB 4PXAA 4M2LA 2B5OA 2D06A 3AVTA 3AM1A 4EPTA 5EMNA 4DSNA 1FP7A 1R4AA 1I4LD 3FKSA 4NYMQ 1M2OB 4CEJB 2PT7A 2ERXA 2RHMA 3ASZA 5FUWA 5AJXA 2REXB 1BMFD 1K5GA 3K9NA 4Q1FA 4WZBE 2QP9X 4FWTA 1E2MA 1G5RA 1YRBA 3MMPA 3LQRA 2XTMA 4OL0A 4R98A 3W5HA 1XXHA 1OH5A 3WNCA 4IOMA 1AN0A 2E87A 3CONA 4OI2A 5EP1A 2QM7A 1DAHA 1KI3A 1H42A 4LV8B 4AI6A 4QBHA 4J0QA 3R7WA 1YR8A 5IDVA 1W36B 1L8QA 2BOVA 4GP6A 5EQTA 1XE1A 2GCPA 4TL6A 2BSAA 3DHWC 4S35A 3LA6A 4PQFA 4IEEA 1G291 2QQEA 2WKPA 2BV3A 3EARA 2ZRCA 3ZIAA 3W5JA 3ASYA 4JBWA 5A5GA 3RNLA 1E9BA 1P4SA 3TSOA 1J8MF 3IEUA 1ZAKA 3RSLA 4L9SA 1NI3A 1LS6A 1KJYA 3GLHE 1KSGA 4OKSA 3OEEA 3W9YA 5FOSA 3GLFB 2ONJA 1XD2A 5DISB 2A5FA 1T8TA 2GJAA 2ZRDA 3B6EA 3B9PA 4C9BA 1IOZA 2L0XA 1VQMB 4FMDB 1HH4A 3QEJA 5IK2A 4AURA 5H59A 4FCVA 4RZUA 2IX3A 4AKHA 5JWRA 3BRWD 4QRHA 2ZS8A 2ZR9A 4NZYA 4TL7A 4Q19A 2C98A 3B78A 1E4YA 1ZM7A 4Q9HA 1TQDA 4RKEA 2ZJYA 3E5HA 2XSZD 2ZRAA 3CCVB 2GZHA 1W2HA 3U7HB 3OAAA 5F2EA 2IYVA 4F7WA 4B47A 1Z0FA 3TUZC 4PPQA 3LRPA 1DAEA 4C2UA 1XCMA 1OE0A 2WJJA 5EXPA 1TVCA 3CH4B 2GDJA 3Q5EA 3KQLA 3IKJA 3T12A 3CPHA 2W2XA 3E1SA 4TTQA 3TSZA 4TZ6A 3AKYA 1YHQB 1NIJA 2G83A 1XRJA 1U8AA 3T1OA 3F8TA 5K8TA 1E79A 1KMHA 4LDJA 4DCNA 2QE7A 1P60A 3K70D 5F3WB 4CEIA 1FUKA 2WOJA 5BQ5A 1QHHA 2GEUA 3P27A 2FNAA 3ND9A 1DO0A 2IS2A 1E64A 1O3YA 5DLQC 4QBGB 1Z47A 2CVHA 1GVNB 2ZE5A 1F2TA 1N6PA 3FGNA 4TZ0A 4KFRA 5AUOB 3T5DA 4F4IA 1I4DD 5FR1A 4YDSA 2RGXA 1JR3D 1MO4A 2H5EA 1OV4A 3EA5A 1SXJA 1U8YA 4JL8A 4EQ6B 3BAFA 3OEHA 2CK3D 5CJPA 4US0R 4BFSA 3DOEA 1NMYA 3EWSA 4RKFA 4AD8A 5IHPA 2PEZA 4MGKR 3GJ7A 1QGYA 4DQLA 1DOAA 1JAIA 1VQ6B 2P67A 2VHTA 4X8MA 5FTNA 1RYFA 1S3SA 5B2ZA 4EPRA 5KUTA 3M1IA 4OYHA 1CEEA 3IQWA 2IC5A 4Q4AB 2KE5A 3QKTA 1CNEA 4U9UA 1X6VA 2VIIA 3FFAA 3RS2A 3U3KA 2GJSA 3EC2A 4E22A 1T5IA 3A4NA 3SYKA 5J4LA 4XIGS 3UG6A 3LLMA 3C5CA 3LVQE 1NDHA 1HE8B 2FPLA 3AVPA 1GG2A 4NE2A 5FPHA 2YVUA 4URXR 1KC8D 1NY6A 4X8HA 4ZCLA 2P6NA 2VP9A 1Z2AA 1QFZA 2ATVA 3SYNA 2C9OA 4P0TA 3WNDA 1DAGA 2JJ2A 4ZDJA 3A58B 2IBMA 3QPVA 4ZCIA 4PC1A 1WF3A 2JDIA 2QM8A 1AQUA 2QTLA 1ZIOA 1UEIA 1OXSC 3AF2A 3MD0A 2PJZA 3HU3A 1E4VA 4LJ6A 2ZAMA 4X8OA 5KDLA 2FZLA 4XJXA 3B1YA 4ASUD 3NTUA 4NYJR 4G5SA 4DC9A 2GILA 1GR1A 5H5JA 1W0KA 1W5SA 2ZSFA 3KL4A 3NKVA 1XZQA 5JSZB 3IIKA 1EFTA 4LHYA 3EASA 3QXXA 5HR5A 1A7JA 4EFLA 2XB2A 1FNBA 2WBLC 3HYTA 1FX0A 1E1QD 1KK3A 1JXOA 3I5YA 1LV7A 2ZRGA 3HP1A 3F3YA 3R9XA 1WBDA 1RVDA 3VHLB 1PZNA 1SVSA 1E2NA 2OV2A 3G6EB 3W2FA 4YALA 2C2HA 3GFOA 5FL7A 3SQWA 4IDOA 2IF0A 2PCLA 2ZRBA 3VU9B 4YC7A 2PEYA 3A8TA 4JVNA 1JQJC 4HAWA 1OPXA 3L8ZA 4JL5A 5LB4A 4F7DA 4DJTA 3CCUB 3FMOB 3SYLA 2A78A 1KI1A 3KXLA 2QI9C 1BJKA 1M7BA 3EG5A 2ZRNA 2H1LA 1ZM4A 2C9CA 4MRPA 2PX3A 4LSGA 2HEIA 1UFQA 4D0GA 4JIMA 2GJKA 4DDTA 2OXRA 1S96A 4AKEA 4B3BA 3TQFA 2NO6A 2BMWA 4BQSA 4PC6A 1EFRD 5EE0A 4M9ZA 3KJGA 1FNDA 2PZEA 2XOKA 4ZI3A 3CH5A
chains in the Genus database with same CATH superfamily
2Q0SA 3G9QA 2OFOA 2BZSA 1EAMA 1TTTA 2IZ7A 1QHNA 4IDBA 1E9AA 2HF2A 2JHCA 2RIPA 2XUHA 3W6OA 1FJGB 2P4UA 4RJ2A 3VPGA 2G9QA 4V0RA 1KKUA 1VMAA 2HDHA 1QYXA 3U3RA 2X9LA 4DMKA 1V96A 3BE8A 2QN6A 1H0KA 1P9OA 2R87A 9LDBA 3ER9A 2R66A 4J6EA 3O2NA 2V7VA 4V39A 2ZSDA 4YCSA 1MTZA 4G36A 5U9CA 2OTCA 2R1TB 5LU8A 5JNWA 1Q7RA 1J39A 1MEJA 2BSXA 4BFWA 4CT4B 4X06A 2Y9PB 2OVBA 3IAXA 3B7PA 2OD2A 4I4TA 2AG8A 4Y0AA 4GDFA 1H2YA 3DEIA 3P1JA 2UAGA 1AGNA 1NXPA 4PAQA 2H2AA 5FUYA 3DHVA 4CF3A 4FUQA 2JFXA 5AVYA 5JCOC 2EWWA 3HLYA 1FNSA 4BMOB 2DLDA 2Y4OA 2HU2A 2IIVA 2E4YA 2WYIA 4AYTA 2V7PA 1LF0A 1Y8QA 3EVTA 3S55A 3SHWA 1TI7A 1N36B 1GTRA 1MJFA 1OKKA 1Y4SA 4G23A 1SKAA 3BCRA 4MGEA 1M8GA 3JWEA 4P3YA 3O6VA 3R24A 4PU0A 3MTGA 1EP9A 4UBOA 5KDDA 1Y48E 1DPGA 2GK4A 3Q7PA 5CDHA 4KNYA 1ULUA 2FZEA 2VNJA 3PNVA 3DL7A 5TRDA 1WG8A 1M67A 1PWXA 2QR5A 4C14A 2QXUA 1Z4IA 3R5FA 4Y6LA 4PTYA 4Q9KA 4HGOA 4EGQA 1BYUA 1OILA 3W2EA 2QWXA 3RI3A 2FFHA 3DONA 3IKTA 4HSEA 3VMMA 1UD2A 2QRNA 3VH2A 2ZT7A 1CZLA 1U9YA 3HZHA 4KMOA 5AJWA 1ISIA 4B0OA 3W6ZA 1WBJB 3WGUA 1YJ5A 1H2EA 3M5PA 1NN5A 1TAGA 2JASA 3H9JA 4PO8A 2O54A 2Q9AA 3UJ9A 4MWOA 1TUEA 1KEWA 3GFPA 2XVYA 1NP6A 3A3YA 4G1FA 1D09A 2C3PA 5G2OA 3FRHA 1EFKA 3Q6NA 2GO7A 4IGEA 5T7BA 4KQJA 2R4QA 3RYCA 2GAFA 2GZSA 1ZD9A 5CJ2A 3A3BA 2JGEA 4AUKA 1E0JA 1XMOB 1E6CA 2H52A 2NUBA 3COPA 4I4TB 3OE4A 4GOOD 4R5MA 1L7EA 3FDIA 1WVMA 5FBRB 5A3QA 4Y9RA 2A5GA 3C70A 2W4MA 4MKHA 4HYYA 1ONSA 2GN2A 4RM0A 1X2BA 3BREA 3QJGA 4NTZA 5AKGA 1QO7A 3VQTA 4Z4FA 3CVOA 5DLDA 4IG9A 2K2WA 5DLPA 1DTWA 4XGKA 1YL6A 3B36A 2X2FA 4PICA 4DGQA 1WCWA 3C3AA 4BDTA 1L8AA 5JW6A 2QRVB 2YHIB 2XTAA 1Y9AA 4LJKA 3FCXA 2VH2A 4JL6A 5BW5A 3QVOA 3R9XB 1E6EA 3FJ1A 4PLHA 4YI5A 5CAEA 5CD1A 3FFWA 4ER6A 2XHEA 2Z2ZA 1NFRA 3JQGA 4NNPA 2VR1A 3P9SA 1KIFA 1QRAA 2ZAGA 3I92A 3TW8B 1QF6A 4KBYA 1DC8A 2VAWA 5LD2C 2A92A 5LUAA 1NRWA 1QG0A 1HSZA 3ORSA 3L6RA 5CM9C 1LPAB 2UYYA 2BHNA 3HA2A 5D1NA 5EHGA 4DMRA 5HJEA 5ER9A 1PFUA 2HJGA 4WINA 2IV2X 3TX6A 1AN9A 4PSAA 4HBGA 2ZJ1A 4NFYA 1CBUA 2EXXA 1D4OA 3EGOA 4QUKA 1JA0A 1GPYA 1K0FA 1YDHA 1TYDE 2AT1A 3C7KA 3RUCA 1BGXT 4PYOA 4EEKA 2OMEA 1D4FA 2C5FA 2W6MA 4DLUA 4IX9A 2FPXA 4QUGA 5CBPA 5LSAA 4K1LA 1ZCJA 3I9LA 1SCUB 4TM8A 1JDSA 1BMFA 1Q7CA 5IKOA 4CMIA 4MIYA 2CDBA 2IP2A 4MITA 1Y8RA 1QFXA 2QN7A 4IXWA 1KZ4A 2PN1A 3VSCA 3VSBA 1Y7PA 4FFVA 1E5LA 1E5TA 4P9SA 2BEWB 4U2EA 1TM3E 2H8GA 3ZWKA 3IEVA 3T5BA 3R74A 3PSAA 2FQ1A 5EKUA 1V0EA 5BVGB 4P35A 5DT9A 4R8MA 3TUIC 4KXUA 4DBZA 5FQNA 1KERA 1RPNA 4LG1A 4ARZA 2ZUSA 2P2ZA 1RI3A 1RLMA 2GPTA 1YOVB 5E6SB 1G2OA 3B1FA 1WCIA 3NZEA 4P2GA 2AX4A 4PNZA 4ZOLF 3Q39A 3CLVA 4L15A 4RY9A 4YK7A 1D8TA 3A8KA 1MBZA 4NCAA 3N7AA 1OBCA 2QUAA 3ZC3A 3D8TA 1Z07A 3D0OA 1FLDA 1Y80A 4K6MA 1GCIA 3ESYA 1FVOA 4X6UA 1K8AD 1A88A 4YGXB 4UM9B 3NIDB 1GAEO 4FJ0A 3QKSB 2HHCA 4XPZA 4Y2UA 4D0LB 2CL5A 1OA1A 1Q81D 3UANA 2Q7XA 3L0DA 3N58A 3T53B 5JHHB 2DERA 2Q5OA 3RT7A 1HR0B 1I3KA 3CZ9A 5K0TA 1RNLA 1ZINA 5T41A 4YRGA 4JK3A 2LDXA 3KQSA 5LZ9A 1R8QA 4JLWA 1RWNA 3WGMA 2XGGA 1ZEMA 2DGDA 2P79A 2ACWA 2CL6X 2RBGA 5SZJA 5E7IA 3WMXA 3THXA 3QIVA 3DW3X 1FNMA 3OUTA 1SWVA 4HS4A 4LZAA 5FV4A 1XPUA 3ROEA 1MHPA 4QE3A 2OESA 3OPXA 3T4EA 1VIVA 4K0RA 4LVCA 2R4TA 4Z8XA 2BBTA 4LXHA 1NTOA 4KN6A 4G6IA 2REOA 4GKAA 3MCUA 4O1HA 3R5TA 4DY6A 5IN5A 2GDZA 2HMVA 4CNQA 2Z58A 4TVSA 1E1DA 1RABA 2AOVA 1VDZA 4ZO6A 1PFVA 3TIVA 1NLZA 1YAHA 2ASEA 3UHJA 1WZ2A 4GLLA 2PX0A 1R3UA 4HGNA 1HNWB 1ZZEA 3L1JA 3W2GA 3NDPA 1F2UA 4L4RA 1DAPA 1RYDA 3Q40A 4KDCA 2MINB 5C3UA 3W9UA 4XORA 3PC7A 3F90A 2Q2VA 3RWMB 3QBVA 4EEXA 4BVAA 3ZV7A 3WLQA 3E20A 1JDZA 1VG1A 3GNSA 2YICA 1KGDA 4MPPA 4YWJA 2W00A 3NX4A 2GTHA 3CXCB 3PRJA 5DV9A 5KNCD 1KPHA 2ORWA 3EAQA 5LJLA 3VGPA 1I10A 4M1KA 2VDRB 3F7OA 1Z4JA 2FZVA 1H85A 1ETHA 3AEUB 3BUSA 3FM9A 4G5HA 5CHEA 1YQXA 3W90A 1TD1A 3NO4A 4BNWA 5G3YA 2WQ7A 3KHKA 1N1EA 1QO0D 4ZIRB 4KQKA 3I9MA 4RTOA 1ZU5A 2YW9A 4Q00A 5FLKA 5LP6A 3TB6A 4KK3A 4C4YA 5DNYB 3NP9A 3AF4A 4E3WA 4ZRNA 4JI6B 3KPVA 3FWPA 4KO1S 5JROA 2FVYA 1KMNA 2BN4A 5D3QA 3CKLA 5LA6B 2OUKA 4FBLA 5KCMA 4IDQA 4X61A 1KYZA 2RC5A 3WQRA 3NFYA 1ZP6A 1E4EB 4LHZA 1NYQA 2YYZA 4LOAA 3U4DA 3VNBA 4RKYA 4KJZA 5EIWA 4TMFA 1S89A 3ZHQA 4BLVA 2ZFUA 3AETB 5IULC 5C34B 2HWKA 2C99A 3HWX1 1KI6A 3D0QA 2H1OA 2ZYAA 3E8XA 3RDPA 1KI9A 1DAIA 2H9YA 2OG2A 5EWJA 5MN6A 3PJEA 5EJ5A 3DE1X 3GN2A 2QZ9A 2XWSA 4BNZA 2WU3A 1T1GA 1DC6A 1QH1A 3ZJUA 2AR0A 3GUZA 3TRFA 4LNHA 3LX5A 3EG9A 1QGZA 3OE7D 1E1LA 1DIHA 4WUVA 1ECLA 3DUWA 3UVEA 2IQIA 2H57A 4LZLA 1JQEA 4IDCA 4M0CA 3CNNA 3NDRA 4CIWA 3DGFC 1KDYA 2EJBA 4L5CA 4R6WA 5FPPA 2ID7A 2E6UX 1WXDA 1LX6A 1FLNA 2IYQA 2GFHA 4LRTB 4NCIA 4YXWD 5BNWA 4JYZA 3ASRA 3E3LA 4HG2A 3DT6A 1L5YA 4DYDA 3BSSA 2GZRA 2AFIB 5A4FS 4GC9A 4QNRA 1D6NA 1GV0A 4CDNA 1OHHD 5DHSA 2Q62A 4IFBA 2VDMB 5FO0A 1UEXC 4H16A 3JQPA 2OGZA 1V3QE 3JZDA 4UHFA 3TTXA 3V2UA 1YGPA 4IKPA 4IM7A 1IB0A 1HORA 1G1AA 3WL3A 1YA4A 1NVTA 1C80A 1GITA 3DDOA 5ALHA 2IYAA 4XX0A 1DOZA 1HFKA 1V35A 2QTHA 3DYIA 3FLMA 3I9V1 2J6CA 2X8LA 1EJ0A 1A2KC 1COWD 3O1HB 4MVJM 3H94A 3U1VA 3H5LA 1GT6A 5DYTA 3DOCA 5IYNA 4ID9A 4HL6A 2B6HA 4TX1A 3HGMA 1XZDA 3CSDA 1XRRA 2X4LA 3IPAA 2NU7B 4KIJA 3N7TA 5E8RA 4Z7QB 1RFLA 1IN8A 1THTA 2DHRA 3EWIA 2ZTGA 5DOZA 3IEXA 1HMYA 3RYIB 4Z4ZA 5JFTA 5IYQA 4YNBA 1H9AA 1V5EA 2BGUA 3K8YA 1FMTA 4J4HA 4WFIA 3VR4D 5DW3A 3KUKA 3SAJA 4M0MA 1BE8A 3O2SB 2OTJB 1XSEA 4OHYA 1KFEB 4CCAA 5BV0A 2P5SA 4RYDA 4QOFA 3UPUA 3DE2X 1DIOB 3RPEA 2O2DA 2EZ8A 2P9QA 3O8QB 1UBRS 1JR4A 3BTOA 3HNPA 3TIXB 5HPYB 3HG7A 3K09A 1PGOA 3HJUA 4N6OA 3GHHA 5L46A 2R6ZA 2HDWA 3ZDQA 2JGFA 3CPEA 1VLVA 3BFXA 3IEKA 3PXAA 1N8KA 4OTZA 2BUCA 5K3CA 4ARSA 4IFEA 4E5SA 4B6EA 2PBFA 1JMVA 4II3A 1P1KA 1Q92A 1D2HA 2YJGA 3E9RA 2X4GA 4J3FA 4LGMA 4PSVA 4BO5A 3ESDA 4POOA 4RTMA 2ETVA 5SY6A 1DAKA 3CUYA 3E48A 4ZVNA 3GQBB 4RTRA 4KGZA 3VR2A 3L6EA 8GPBA 2XQIA 4RPHA 1BXZA 3B3QA 4P5DA 2OZVA 3KQLA 4RLHA 4BKMA 1GZ3A 1B15A 2IK8A 3RQSA 1N1DA 5CA1B 1BJRE 3L8MA 4UPEA 2VNSA 3ZZTA 2N1MA 1FDOA 2ODTX 1JN0A 1XQVA 3H9QA 2HU8A 1SB9A 4FFPA 1KSJA 1R15A 3IXQA 3SHTA 5ALZA 4DG9A 4NIMA 4P7FA 4MEBA 5EMJA 3HWRA 4JROA 3UEOA 4U6SA 3PYXA 4O4IA 4YMHA 3O8LA 3VKWA 1OQAA 3GJ4A 4OI0A 1AK2A 3OKFA 2QLJA 2QX8A 2NSYA 5IAEA 4D82A 4OJMX 2VK2A 3CC8A 4DJJA 4HDKB 1D5CA 4BLUA 3IUQA 2XCRB 3WO0A 1A8IA 1ZGCA 2Q49A 3MQFA 4OVKA 3K0FB 4WNCA 5AH0A 7GPBA 4B76A 3Q7TA 4MKXA 2ECKA 1SZCA 5EXTA 3ZLVA 4RTPA 3ZS8A 2UXCB 4TWAA 1JVNA 2YOHA 2GLXA 2JAWA 3JQ9A 1ZIDA 1UDCA 2WG2A 5J1SB 3SLDA 2WAXA 5DMXA 1P4RA 2C4VA 2W6NA 4BFVA 3S81A 4P22A 2IYPA 2GXQA 2SNIE 3LX4A 4RBNA 1GL9B 1G20E 5KSPA 2QQ5A 3EVAA 3QEMA 4QOHA 4CZ2A 1G8FA 4LGVA 4ALKA 4IXNA 4LZPA 4A03A 2OZLA 1ZBQA 4GE0A 1XV5A 1BE0A 3AJ8A 5HBRA 3U26A 2XTJA 4G0YA 4MMXB 2B4TO 5BQ3A 1SKYB 1IQUA 2GFQA 4NE7A 1CR6A 2C4WA 4ZI7B 5KINB 2AI3A 3WWYA 3GHYA 3KHSA 2AUMA 1V8BA 1E0KA 1QU2A 3QUQA 5F1PA 5IUJC 2OHOA 3AVXA 4TM7A 2QENA 1AQJA 4ZHQB 4KR7A 3HKCB 1NRXA 1DAOA 1DT5A 2J3LA 3QU4A 4EL5A 4FVTA 2VPPA 3TJMA 1TO1E 1EGAA 2ZI6A 3I04A 5DM0A 4NVRA 3WMFA 3VC3A 5CXXA 3TCNA 5FA5A 4JJ7A 1YIOA 1JILA 2WJAA 3P2MA 4V0NA 5JSYA 4I1SA 4DR3B 1T36A 2CMGA 1Z4LA 1S4MA 4XE5A 4I99A 1PKEA 1X8JA 1CUAA 1E9CA 2B1JA 2IT1A 2NXNA 4LS3A 3U37A 3IX7A 4KVGA 1R0RE 4IGAA 4KR6A 4NH0A 3FPPA 1OWPA 1PR0A 4BCCA 3L05A 3JAKB 1J21A 1YDEA 1JSZA 2CE7A 2LCFA 4RDKA 2FPPA 2TRSB 4XWGA 1O97C 1Q7TA 1S2LA 3WWPA 2I7XA 1XXHB 1R0BA 1DWPA 1Z0KA 3EDQA 4PSDA 4Z86A 1OH7A 4NULA 1DINA 4REQB 2OFWA 4AN1A 1P0CA 4WFKA 3RSFA 4FHFA 3D4PA 4M37A 4LW8A 1W96A 4NU6A 1A5AB 3GJZA 4BC0A 2YFKA 3DM5A 4RANA 2GA9A 2LV8A 4FOTA 4Z4WA 2ZR7A 2Q3EA 3FOWA 2RGAA 4QOEA 4OKIA 3RRBA 4MJLA 4RH3A 3G1TA 4RVDA 4LSZA 1IXZA 2FSVC 2FPIB 2RHOA 2ZROA 1LLFA 2BEUB 5JAPA 2OOSA 1T3GA 3D7NA 3QJYA 2KHZA 2VP0A 2OOKA 4ON9A 1U02A 3PKIA 4EUKA 4IMRA 5BWMA 3DMDA 5KKAA 1VGRA 4A2WA 1U0OC 2IUYA 4ZALA 1OAKA 1KJJA 4LX8A 1JG1A 2H3EA 4YB8A 1CDZA 1QHEA 1TIBA 1YASA 4GMKA 4OFXA 5F35A 1FFDA 4RK1A 3V00A 3ZOKA 4JQCA 4C7VA 3NAMA 2ZDGA 1J7KA 2YJ5A 4NYJQ 3AHJA 4TKMA 3BK2A 1RSZA 3KXPA 2WPDA 1QK5A 1XNGA 4HBZA 4QECA 2I5PO 1GNQA 5GONA 5H80A 5HCNA 3RAGA 5A2GA 5IJ9A 1D1PA 1LDGA 2GVNA 1XE3A 1I7NA 4DLNA 3K9HA 6REQA 5JLJA 4LEIA 1FVFA 4QLAA 2Z2YA 4FCWA 5TV2A 2I29A 4L22A 4X8IA 3E1KA 1H6CA 4DSZA 3TW0A 1Y7HA 5A9SB 5H3HA 3HB7A 1XB2A 2IEIA 3HZZA 4LSMA 4Q24A 4FXUA 4AMUA 1ADYA 1V8DA 2CLFB 4D6YA 3CC2B 3HXKA 3BGOS 1TF7A 3OWXA 3F4KA 3VZBA 1BQ4A 2ZSJA 1JG4A 3R0IA 4K6CA 3R9IA 4F5EA 1MRZA 4F4DA 3SQLA 5BSWA 1LSUA 1NWHA 2I65A 4DF3A 2YHSA 1WB4A 1BWSA 1V11B 4HDQB 4XOUA 2JRLA 2BL4A 1LBHA 3PFNA 3UUWA 2P2GA 1E59A 4XCXA 2GCGA 4BWFB 4F56A 3D7RA 3DXYA 4OCZA 4MDFA 3MWYW 3IBYA 4EJSA 2NXEA 3H18A 4LBWA 3P2EA 4NP6A 3OZRA 3P94A 3T35A 2PZMA 2RG1A 4QDOA 4P26A 4MHSA 1E3EA 3GT4A 4LYDA 4NJMB 3TWOA 3KAPA 3PHGA 1ZQ1A 4EG6A 3Q9SA 4HYEA 4XOPA 5CA1F 4M87A 4C1NA 4OXXA 4FEEA 1DZIA 4Q15A 5GZ6A 1YMUA 1OLUB 3R7FA 3VYTB 2PBRA 1ZJ6A 3DE4X 3B5IA 4IF4A 3VSEA 3L18A 1LVHA 3C16C 1RZ3A 2ZBRA 4HDKA 4P3NA 4UPDA 3RVBA 1ZD8A 3GLIE 2QIPA 3OCJA 1YJAA 1QFYA 1TDJA 3BQNB 5AVQA 3CLHA 1W581 4AMVA 4BC1A 4O4LF 1M66A 2JL1A 3KV1A 4YVFA 1NXXA 3BQJA 4LI3X 1KOLA 1UZMA 3EZ2A 3N2GA 3RSQA 3QVLA 3ORYA 4RWZA 5B64A 1P91A 2FH5B 1MABA 5ALLA 3UV3A 3KNZA 4PYJA 1DIAA 2OGTA 2Q4TA 3TECE 5FNVA 1XMVA 3KLNA 2IODA 3QHPA 1UBGA 3L0OA 5DTRA 4HFRA 4C0AC 1Y1PA 4E5YA 4CMKA 1EFAA 2B25A 1CERA 4H0CA 3H84A 1HZZC 2BM1A 5KNCH 2NSLA 5DM2A 1I4EB 1A8UA 3TLKA 4N41A 1J9EA 4F11A 3FHLA 5D6NA 3CUWA 1NBMA 1Z0SA 3DGEC 4IV5A 1YI0A 4BO9A 2WJHA 1T0BA 2ZB8A 2NLOA 2FEAA 4GVLA 2QX9A 5K3BA 3ZBQA 1PP4A 3N2IA 1JEAA 5AKEA 3EBPA 2ZBVA 2CYBA 2OBMA 5JBQA 2F6RA 2RK3A 2XZLA 2GQ0A 1TE2A 4XB1A 4DLZA 1JWLA 2OKGA 3X1YA 1KPIA 1KOFA 3FAZA 4M21A 3K8QA 2P65A 2KI5A 3E9EA 3N8GA 1KRXA 3C7AA 3K0AB 1SC9A 2PFGA 1L1EA 1RRMA 1I7QB 3O92A 3C3JA 2BZGA 4RK4A 3SXUB 3B53X 3PENA 3QF4B 5DJ5A 3V8VA 2CDAA 2IKSA 5LLSA 4URWR 2AFHE 1ZUHA 3WSVA 3PGXA 2E5FA 4KACA 3DFMA 1AXEA 1SVMA 1TW3A 5AK3A 4A82A 2PNJA 4B8WA 5DN6A 4MS4A 3EZNA 3GJXC 2H1SA 3VZPA 3IPLA 1NN1A 4P2NA 2ZU6A 4X07A 4OHWA 1GU0A 1BS9A 3RIHA 3CVYA 4AMGA 1XQ9A 3MZ0A 1CJKC 1JECA 2J08A 1JWAB 1C7IA 4U7PB 4YAJA 3U44A 4UEWA 2I4OA 1OHHA 4U63A 3BKXA 1SU4A 3DHYA 2BDTA 1DUIA 4XLLA 4CLEA 1EHYA 1SC3A 4EHJA 1C2TA 5F12A 1P0FA 2YZ7A 1CR1A 4LDPA 1ADBA 3LGSA 4YXWA 4RADA 4EATA 4P93A 3AERA 3RJMA 1ORTA 4R2KA 3Q2OA 3I5UA 1FQOA 1ZM3A 1T9ZA 5A05A 4XFKA 1JDTA 4YBRA 4UNRA 4J3JA 4YBZA 1K7FB 2VUSA 3B1WA 3DE3X 1G63A 4MP3A 4J75A 4BFZA 4TQ9A 2FWNA 2XOEA 3GRFA 1IU9A 4IIVA 4YJDA 3ZPXA 2IYYA 2C8VA 4QARA 2N46A 4BNIA 1X80B 1QYRA 1JG2A 4QGAA 4GI5A 2XYGA 2WJZB 1C1XA 3AUFA 3ETLA 3KUUA 3LBHA 4PPYA 3DJYA 4BCBA 4JUCA 4LOJA 4PYIA 1T15A 3ZE1B 4P7JA 1WJGA 4HGZA 3QELB 1RKBA 1Y1TA 3WGNA 3BFVA 3O8DA 1ZRHA 4R2WA 1NJSA 4HQNA 2BKXA 2CY0A 5KNBD 5IXYA 1X9HA 3HRKA 5CH5A 2TMKA 3ONFA 1BS1A 4L4YA 1GRRA 3KZCA 4CCSA 4J94A 3C4QA 2DKNA 3RTGA 5GZ1A 4MB0A 4ZFNA 2QNRA 4TTAA 3DVSX 4WLVA 2P6OA 3MB8A 4N3BA 1D9XA 2AV6A 3FLAA 5B7PA 3NTOA 3QUAA 2Q7DA 2VF4X 1G0OA 3LT5A 4XSGA 4QFMA 1XEXA 3BSWA 4F8JA 3ENNA 3WGIA 1R0WA 5KHAA 1FYWA 3NVKI 4IV0A 1RHJA 2PYIA 4CUKA 2YHUA 4FBGA 5F64A 1HV8A 4ZCSA 2I1WA 5B36A 3GLKA 2FMFA 1WHSA 2CLHB 3L46A 4HB2A 3ZGOA 3JZMA 1P9LA 1KARA 3IV6A 2IYUA 1VE5A 4JJKA 4UUOA 5FOTA 3AIKA 3SKYA 5IWCA 4ZTUB 4BMNA 1MP0A 5HXBA 3HJGA 3TVYA 3H2BA 4I1OA 5DOVA 1EGMB 3MLEA 3CP2A 3K6SA 4IVPA 1OLOA 2EYUA 2MCFA 1ZOPA 1YD7A 3GEEA 4LZOA 1A1VA 1H05A 2BFDB 2ZIGA 2AGVA 5HKLA 3NT5A 1EBBA 1H4VB 1WB5A 4FILA 4MWCA 5TVGA 2VDWA 1XVAA 3WRWA 3NOOA 3PX3A 1YO6A 2IHUA 2HMYB 3NC0C 2VQ6A 3Q3VA 3OPMA 3DQQA 4RF3A 5F76A 2JA1A 1DBRA 4UCXA 5J4VA 3PUHA 5JVDB 1QGED 4FFBB 4IUDS 3SQNA 5IAOA 3WNBA 4QTZA 3TLAA 3O75A 3OIVA 2YBDA 2DE0X 4LJLA 4TWIA 2XWQA 2ZTLA 3TW6A 4MR8A 3ZY3A 4YJ2A 3RREA 3WGLA 1ENYA 3H9NA 4S1WA 3VPAA 3LE8A 4FYIA 4NPCA 4N54A 2O8EB 3NATA 2EW1A 4YMWA 3T0FA 2HMWA 1D6JA 4KLNA 2OK7A 4EY4A 1JA9A 4G63A 3KDAA 5DYWA 4HT3B 3D9QX 4NNOA 1Z2DA 5BXYA 4IYRA 1EYZA 1QIKA 3LZDA 4UU1A 2VTKA 4NNJA 1OBVA 1NXWA 1QH8B 2JJYA 1ORDA 2O48X 2PSEA 4XEHA 4E21A 1IHDA 5B4VA 3AF0A 5AW2A 5EHQA 3ADDA 1CUBA 1KTVA 3U61B 1MAVA 3BQMB 5JYBA 3A9VA 3ASTA 3EZFA 3KJXA 3LPDA 4XUCA 3BS4A 4C3UA 5BT8A 2LDBA 3WK9A 5HRCA 1NJ1A 1V39A 2QVBA 4DGSA 4JDUA 1TC2A 3QV1A 4D9NA 1N5RA 3EVGA 4WWVA 2WJVA 3H11B 5SY9A 3T7TA 5FI3A 1VKOA 3OJCA 1Z08A 4DPKA 1L1QA 3AP1A 1NJGA 4HAUA 5AICA 1I2DA 1JI0A 3T7RA 5ALVA 4QNMA 3AO0B 3EDYA 5FEMA 3EFHA 3F7NA 3U39A 1RJDA 1U90A 1VRWA 2ZBPA 4UHDA 3C6QA 3EHDA 5E3IA 4EUFA 2CFCA 4P4SA 1M2WA 4FHZA 2HHAA 4QGHA 3TLMA 4URFA 1DV2A 3UK0A 1XNHA 1OX5A 4TKUB 4C04A 2OV3A 1R50A 2J5BA 2QUIA 2VSFA 2WZCA 1SUEA 3BMQB 2ONKA 3IFSA 3R7BA 3FPEA 1V2GA 4F3YA 2VBGA 3NBMA 4CKEB 3BWDD 3L0ZA 1GGHA 2OO3A 2Y05A 1V5WA 2RI1A 4HQ0A 2MYUA 2W37A 5CA0B 2CV0A 1EWTA 3TX2A 2ZBGA 5CM8B 5BSUA 1JTFA 4MRRA 3QX3A 3PDWA 1P80A 4RAOA 1CE8A 4EPYA 1R2QA 1L5RA 4RJJA 1E2PA 5CVTA 1K1EA 2KLHA 4PQYA 5JEDA 2RONA 3BGSA 1XZAA 3II6X 4MINA 3RFUA 1OD6A 3QP9A 3H1PA 3SBDA 1B1AA 5HYVA 2O8VA 2R85A 4W9NA 3ICVA 5EHIA 5TMBA 4D7AA 2EWVA 2ILVA 4J7XA 4KPGA 3NE5B 2RHLA 1H4TA 2BGNA 4OB8A 5H81A 1DFGA 1KI6B 5BW4A 3FTFA 3PPXA 3JQFC 2A8YA 3W5UA 2Q41A 1H2HA 3OZIA 2OWDA 3GZTB 4PPNA 2HNAA 1UZUA 2NXWA 3KEFA 3NNNA 2RH5A 1DLIA 4F71A 1GTL1 1P2DA 1E94E 5BYAA 4INPA 2VSOA 1DFIA 4HH3C 1IEVA 3FUVA 5IYPA 4X54A 4XJTA 3TGLA 5LFAA 1P2BA 4HAOA 3ZXXA 1Y0RA 3GFSA 1PRYA 2QK4A 3T3DA 2Y27A 3P9YA 5ELXA 1G8MA 4RZXA 5CRIA 4C3OB 4LVOA 5EE1A 2Q4DA 4AKGA 4XEUA 2J32A 2PUCA 2X6WA 1FFEA 2PUDA 1Y7TA 3VI4B 1A9TA 3C2QA 1FTSA 2X0DA 1W2BB 1AQIA 1RVV1 2WT4A 4RA6B 3LSYA 4V2UA 1DDOA 1NQWA 3OEHD 3AIIA 2Q4OA 5KYGA 1USGA 5J2UA 1NXSA 5CLFA 2FR8A 4QQRA 4DR1B 4LZNA 3H9UA 1AS3A 1NATA 3H8SA 1IIBA 2QTFA 2NU8A 5DW0A 3DE6X 5A06A 2G80A 1I7PA 1XHEA 1C0LA 3BEDA 4KWIA 4MARA 3ZGZA 3TSYA 2QDXA 2DT5A 5AI5A 4X00A 1XZPA 2H4WA 2G40A 4WZAB 4O8CA 4PPFA 1SBTA 3FZGA 4BE4A 3DP7A 4HR7A 1P1CA 1CHDA 4YJ3F 1RE0A 1UDXA 1Q7BA 4X3PA 1GQYA 5ES3A 2EU8A 1MORA 5H3CA 2Z4RA 2V5VA 1YACA 3U4MA 3UUEA 1O94C 3IAFA 3D3NA 3HN7A 3GUYA 1FFBA 3OZFA 4OY3A 3X3HA 1E3WB 2JZNA 4JJFA 4QBIA 1P1IA 3CKMA 3EW7A 1F2VA 2Z5GA 5D3ZA 1LK7A 3YASA 1UCFA 3A6ZA 3RC8A 1BKDR 2FQQA 5CCDA 1KBQA 2XNSA 3DAYA 1N78A 1G6Q1 1V9SA 3C1UA 1Z4PX 3FYDA 2Z43A 2FWBA 3G2MA 3RR2A 1EESA 4J29A 1OROA 4Q3OA 5E6RA 4GX2A 3CF4G 3LC7O 3P4YA 4ZAGA 1ZWLA 2ZPTX 2MSDB 4CIXA 2F1RA 2IQ5A 1I0LA 4KO8A 4H3KB 1WW3A 5AI0A 1VJ1A 2JIDA 1JAHA 2GX6A 2VO1A 3PQ6A 4BV8A 2J46A 1QH8A 4JH0A 4XAQA 4CQJA 2PM8A 5JEEA 4L0QA 2YIVX 1H5NA 1AHNA 4JLUA 1DIBA 3KK0A 2EF0A 2G25A 2X7XA 1PT9A 3QKSA 1H1TA 2J3MA 2D1QA 3DR5A 3NOXA 5EFOA 2EZUA 4Y0VA 4UMEA 3EIXA 3RK4A 1OGJA 1GRVA 2QAIA 3A26A 4M1OA 4RORA 3M70A 1WSDA 3OO0A 4GSYA 3MJRA 4C76A 3E3AA 1PF7E 3K0EA 2NV6A 2V4ZA 1TTHA 1P1JA 2IXDA 1Q3HA 2QZZA 3CEHA 3R3UA 4PZCA 2WK1A 1JE0A 5G02A 3N1UA 5LDDC 1H0RA 2X53S 1KJ9A 4Q4JB 5M2QA 2V6FA 3KT0A 2NYRA 4OJNA 4ALNA 2WIBA 1X7HA 3EEFA 3V46A 5J4YA 2WAYA 2YRWA 1JR2A 1VKRA 1IN7A 3N3BC 1E5VA 5CW1A 4EB3A 5IPFA 3WFIA 2VYNA 3L6UA 3D6HA 3L93A 1GU7A 1WR8A 3O4VA 5EMKA 3GA0A 1P73A 1EB9A 4H18A 5K2OA 2PAFA 4AIIA 1FLAA 4JI0B 1SU6A 1CUFA 2ZZGA 1O95D 2O1SA 3TUJC 3TE7A 3TN7A 3FIUA 3LVFO 2EEZA 4QUDA 1RAHA 2V7QD 2WHPB 3FOCA 4IQGA 4WBSA 5ALDA 4DLRA 5DNUA 5K8VA 1F1JA 2FVXA 2X1LA 1GCAA 3WQQA 1AKEA 1ZA2A 3DLCA 1V95A 3NIGB 1AF7A 3F7TA 3PJGA 4ITUA 4NZNA 2I99A 1W49A 1XQ1A 4Y6PA 4DCSA 4ENWA 3D8SA 3N07A 2VPIA 1AKTA 3LCMA 3UWDA 3UV6A 1WPQA 3BGWA 2ZXHA 5KMGB 4FU0A 2PRKA 1DS6A 1FFHA 3PX2A 2C9BA 5HXAA 1KO7A 2AC7A 2R44A 3EA4A 2C3OA 4KWCA 2WA2A 3PHBE 2G3YA 3MN1A 3PUYA 4OYYA 5KAMA 3ZW7A 4QTXA 4UTRA 1YQTA 4CEIB 1WU7A 1X38A 2LTAA 2C3YA 1GZHB 3ICWA 3PZRA 1N2IA 1X0VA 3SE0A 2OO5C 1WQ3A 3ND8A 4AP5A 1G60A 3ZJYA 5KX5B 4CMJA 3DO5A 3GZNB 5EZSA 4PZDA 1H65A 3OF5A 2XTNA 3KS9A 5CXQA 3BJMA 1I3LA 3WJ2A 2Q5LA 1YL5A 4QEZA 2WZPP 4HOYA 4QDXA 3R8XA 2GN4A 3EXEB 5KI6A 3W78A 3C8HA 1B0ZA 1T9GS 2Q0QA 3PC6A 4M1ZA 4FYVA 3PITA 4PFQA 4RQUA 3ZWNA 4DV7B 3KSUA 3I6MA 3RAPR 1RJ9B 1I18A 3PDIA 4CT0A 1RWPA 5HTKA 3ZWAA 5K5EA 4RA6A 1QFSA 3CLRD 3OFJA 4IIDA 2A0WA 4MOWA 4AS2A 3O1IC 1CXZA 3SDZA 1FRFS 1KRWA 2AXPA 4D41A 4HGQA 5D1HA 4DRZA 1AKWA 1A77A 4HV4A 1EFVA 1SCAA 3URMA 1HE1C 5JMPA 1AZWA 2JGIA 4KV9A 4ACAA 4O5AA 4UAGA 4UM8B 2GPSA 3KB1A 2EFGA 1LBQA 2IUFA 4WUTA 1A8PA 2NADA 1EUCA 2AKAB 4BE7B 2HR1A 4NBTA 3L7JA 3F6CA 3QOFA 3VISA 5IVKA 1R5NA 5ALQA 4DRXA 3E3NA 3KZOA 3EXAA 4J0FA 4NOLA 5HCUA 3RRNA 4UZUA 4N7RA 3U7QA 5B30A 4KLAA 5L6MB 5IM4A 1OH6A 3KZNA 4BLTA 4XM3A 3C3WA 1X1SA 3DD5A 3EIUA 4HXFB 1LNQA 3QXHA 4OOVA 2PE3A 3SS9