1IJEA

Nucleotide exchange intermediates in the eef1a-eef1ba complex
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
438
structure length
438
Chain Sequence
EKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords elongation factor 1-alpha
publication title Crystal structures of nucleotide exchange intermediates in the eEF1A-eEF1Balpha complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 127
structure length 438
sequence length 438
ec nomenclature
pdb deposition date 2001-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ijeA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ijeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ijeA01
1ZYUA 2C8VA 1OGIA 2HYDA 1N5IA 3SJCA 3I5XA 3DM9B 5FOVA 3QOFA 1OHHD 4FCVA 1NMYA 4HAXA 2F1RA 1NN5A 2ZJYA 2P3SA 4PSAA 2VNJA 1ZINA 1FP6A 4UXHA 3Q7QA 2CHVA 3RS3A 2WVJA 1HUQA 5JHGB 2O0KA 4YC7A 3QF4B 2FSHA 2CNWA 3B1YA 2BPOA 3TBKA 1CNFA 2JASA 1QX4A 4DSUA 4TZ0A 2C2HA 2BBTA 2JJ1A 1WA5A 1IJFA 1DELA 1P9WA 1R2QA 4QBFA 1VQ5B 1DAGA 1E9SA 3CWZA 3PEYA 3W9YA 1II9A 2X1VA 4F7WA 1K9MD 4BLTA 1ZW6A 3GPLA 4GP7A 1Z0FA 2AK3A 4W5HA 1QFJA 4CDGA 1JXMA 3U6BA 1Q21A 4RVCA 1SXJA 3ZQ6A 3NBZC 2RGCA 1N0WA 2REOA 1NL3A 1XJ0A 1CS4C 2NO1A 3JQRA 1TLLA 1GKIA 4FCTA 3JQPA 1E4YA 1JR6A 2QNRA 4FW9A 1Q44A 1Z0JA 4Q19A 1EFCA 1XZPA 4MGIR 3K1JA 2JDID 5JEDA 2ZRIA 2FPLA 2OXCA 4OI2A 2H1LA 3CWQA 3I8SA 3X2SA 1WF3A 2OG2A 3CR8A 5BN4A 1NY5A 2HUPA 4PPFA 1P3JA 2DWOA 4LDJA 4OHXA 1OJLA 2C99A 3WMEA 5A4JA 3ZD6A 1RKBA 2KI5A 1JR3E 2QRZA 5AUQA 1MO6A 2EVWX 4RD4A 1IN7A 3I4LA 4NCKA 2WJGA 2WJJA 2V1UA 1CJUC 4P4UA 1YR9A 4JSYA 3GQBA 4Q1DA 721PA 4BLRA 1OYWA 4B32A 5KYKA 1F60A 3ZZUA 1YQTA 5D3MA 3NHAA 3SFZA 3CX8A 2BCJQ 2OTLB 1QFZA 1S4QA 1ZUHA 4UAJA 1IXZA 2ZSAA 1W36C 4LHZA 5GJCA 4LJ8A 3AGPA 5J5CA 1QRAA 2WJIA 4C0JA 1KI7A 1U94A 5EUMA 5K8LA 2XB2A 3KTAA 4Y0VA 3SJBA 2WMOB 1UEJA 4II7A 5L8VA 1KO5A 2DB3A 3CB4A 4HUQA 1E2DA 4RJLA 2QA5A 1GR1A 1VCOA 1OXVA 1FMLA 1KAGA 6Q21A 5DO9A 2ZJ5A 2FZ4A 1M6NA 3U4QB 3GLIE 4D2IA 3GCGA 4XVRA 3IIKA 3AVPA 5CJPA 3CONA 2ZRLA 1E1QA 3QFSA 5FUXA 4LX0A 2ZE6A 4KAXA 4O0MA 5H1YA 4A36A 2ZUCA 1LF5A 2ZI9A 1E2PA 1OKKA 1XEXA 3FB4A 3GLFB 3NVAA 4JYBA 2JLZA 1W36D 4Q21A 3W2FA 1BMFA 4EQ6B 1N6LA 3CPEA 2CLSA 2GZAA 3BD9A 2GDJA 3R7WB 2LKCA 5SZHB 2FJUA 2QGZA 4DDUA 4N1AA 3RABA 1OH5A 3NDPA 1ZC3A 2RGEA 2CK3A 5FPTA 1A4RA 1C9KA 3CNOA 3K9NA 1BX0A 1M8PA 3T5GA 5FH9A 1SHKA 3L0IB 3B1VA 3ZQJA 4MRVA 3TQCA 2F3RA 4G1BA 4YALA 4FINA 1R6BX 2ZRDA 4XSHA 1JALA 3CUEF 3BJIC 1WDTA 3UMFA 1W47A 2B6HA 3ADCA 4P4TA 1KC8D 4DCVA 2QEXB 1R8QA 4ZCIA 3WYGA 4MUAA 1XFAA 1YVDA 1XCMA 1BOFA 1Z6AA 5FBQB 4AYXA 4G3XA 1GUAA 3ZD7A 3IEVA 2FOLA 3FMIA 3FDIA 4EJSA 2X3UA 4A8JB 3AVXA 1OH8A 1RIFA 4FCWA 1YRBA 1II8A 2ZVQX 3CH4B 1KZGB 3N2IA 1NJFA 1E2QA 5EZ6B 3IO3A 2C5LA 3OZVA 4PHFA 3BIFA 1LY1A 5FOXA 4Q1FA 1TAGA 2WKRA 3RWMB 2FA9A 4OBEA 4HDQB 3WYFA 1NLZA 4HI0E 1W2GA 4F38A 5G3ZA 1PLKA 2P5TB 4YQFA 3IHLA 4HE6A 2BMFA 3QVUA 3X1WA 3IHWA 4EH1A 4ASUA 3E2IA 3ETLA 2QAGB 3FKSD 4RCZA 1QVRA 2IYVA 4L5BA 1KK1A 1XTSA 1G5TA 4NZYA 3LXRA 1U99A 3RYTC 4URXR 3EZ2A 3OIWA 2GJSA 3I3SR 2WAXA 1TF5A 4NP6A 3R20A 4G0NA 4QBGB 1E62A 4HUTA 1GWNA 1FTSA 2BOVA 1VG0B 4P6VF 1ZD8A 3B82A 2GXSA 2VP9A 3U44B 3IQWA 3WMGA 2GETA 4DLRA 2QT1A 4TTRA 4ITRC 5JS8A 5KUTA 4HAYA 2GK6A 2FWRA 3K0SA 2O8CA 4LJ7A 4DLSA 3KXIA 3R8CA 4D4KA 1KI6B 2IYYA 4OQMA 4QRHA 3KUDA 4ERNA 2NPFA 1N5KA 3B5JA 4JLPA 1MABA 4D26A 4OJQA 1NN0A 4TMKA 1KNQA 2REXB 1S9HA 4US2R 2O8FA 2DWQA 4OI4A 5EZ5A 4DLXA 2IW3A 2YINC 1KI4A 2DR3A 2YVUA 4XOIA 1KSJA 1G8PA 2ZUBA 5E7MA 2PLRA 3DZDA 4M9ZA 3OE7D 2GTPA 2QPAA 4GL2A 1WBDA 2EFCB 1F48A 4ZGNB 2FFQA 4B6EA 4RCYA 3LVQE 3QJYA 5BYKA 4PZZA 2XNDD 3WMFA 4A1FA 4NHOA 1UMKA 3S1AA 1A2BA 3QXHA 1CTQA 4Z8XA 1HEIA 5DN6D 1Q1ZA 3RSOA 3I32A 4JIMA 1S72B 3F3YA 3PV0A 1DDGA 3THOA 3KZ1E 1CBUA 1G8FA 4A2WA 2V7QD 4TL8A 3I73A 4A0HA 4C2UA 3AF0A 1OPXA 1DDIA 1EFUA 2J7KA 4KJZA 1KI2A 3L2OB 3PXGA 5CM8B 2FNAA 4F93B 1GVHA 5L3QB 4RD1A 1A7JA 1GO2A 1JEEA 4GOJA 2RGAA 1RPZA 2AD1A 4LRWA 3W5HA 3T1TA 2IYSA 1W5TA 1FOEB 2VP4A 3N5CA 3NC0C 4WW0A 4BLOA 1J99A 4OHVA 4RZXA 1NVXQ 3EW9A 3U2QA 1OIWA 2FX3A 1G5PA 2GWHA 4IEIA 5E7IA 4IDOA 1NN1A 2Q0HA 4DB4A 3TAHA 1OGJA 2JJ2A 4XVQA 1ZIPA 2XEXA 3GLHA 2ECKA 4XJXA 3P27A 1J8MF 4ABYA 1PUJA 1IN6A 2YWGA 4Z1MA 3RRZA 4I1OA 4HB0A 3QSYA 2W2VA 2J9RA 3CPJB 4Y9UA 3L43A 2DBYA 1XEWY 1R5OA 1TL7C 2J7PA 2Z6VA 3CZQA 1CNEA 3EA0A 3THWB 1Q86D 1XDBA 1JAHA 4AI6A 2IYUA 3GD7A 3ICQB 2REBA 3EZ9A 3PENA 2C03A 5M04A 1R5BA 3CW2A 1Q3HA 2N42A 2YOFA 4BECA 1N6OA 3PUXA 4TZ6A 3T1OA 2IX3A 1JJ7A 2FF7A 3IUYA 4UNPA 1ZNZA 4UKDA 4H9GA 1G4UR 4HAUA 1IN4A 2GBLC 5CIQA 1DAFA 4Z8YA 4A15A 4B3XA 1R0ZA 4HAZA 4LV6A 2ZI6A 1TPZA 5B64A 4CF7A 2CEAA 3P1JA 1SVLA 4TLAA 2BN4A 3A58B 5B57C 4Q66C 4DZZA 3BERA 1DPFA 2R65A 1GILA 3AUYA 4WAUA 4HDOB 3CXCB 1FZQA 4WZBE 1COWA 4XD7A 2BM0A 3A1SA 2B21A 3U3JA 2XB4A 3SS8A 4A2PA 3KQKA 4E03A 2IXGA 2C9CA 1AQYA 1TUIA 2LCFA 3VX4A 4BRWA 1UAAA 1US8A 4QXAA 1OXTA 3SYNA 1G21E 2MSEB 2R8RA 3J81k 3VU9B 2CNDA 5AUPB 4JMPA 1MH1A 4G5OA 4ZKEA 4JYCA 4FMBB 4IOMA 1A5TA 5E4FA 1E9AA 4OQLA 3LBHA 4MQBA 2BMDA 2QE7A 1G19A 2EFGA 4PPQA 4A9AA 1WBBA 3W5JA 2FH5B 2AD5A 5J4YA 1VQOB 4Q9LA 2DFKB 3BFVA 1J8YF 2TMKA 2VL7A 4LWZA 1E2NA 2A7QA 3A4LA 5FI0B 4DDVA 1EFRA 2OSBA 3VQTA 1E79A 4QG7A 5TY0A 1JEDA 2OZEA 3HYTA 5F2EA 4LC0A 1LFDB 2YNMA 4NCHA 4QHTA 2C98A 2OTJB 4KI0A 1E2FA 2PJZA 2WIBA 1NNEA 1L8QA 4QFMA 1KO8A 5CM9C 4DBLC 1QH0A 3GJ4A 4LY6A 3CCEB 1Q81D 1KGDA 1Z6XA 3LX5A 4M22A 3UANA 2JLVA 2AWNA 3CZPA 1QG2A 1CEEA 4NCJA 5EE1A 2ZIAA 3QF4A 4G1UC 3WP1B 3FTQA 2HYIC 1K8RA 2DYKA 5DIFA 1KJYA 4RZUA 4ZO4A 3C14C 3U3OA 3W5VA 1U9IC 1YR7A 2ZI4A 3TSOA 3CC4B 5GJWC 3VKHA 1A8PA 521PA 3T1VA 2G88A 3VR3A 1CKEA 3W8RA 3VNVA 2ZJ2A 1XTRA 4AKIA 1Q20A 3BH0A 2ZANA 3HR8A 4B4DA 4F91B 4AYWA 3EIQA 4MRPA 2RGNC 1AJEA 2YC2C 2D7CA 3NEJA 4JBWA 3RNLA 3QE0A 2ZITA 2J3EA 4IW3B 1HV8A 5DSZA 1HQYE 2ZR7A 4XTCS 2WMNB 4CYMA 3WP0A 4DCUA 5L3RA 3TLXA 1WCV1 5DISB 2GEUA 4N0DA 2ZXUA 2W2TA 2H57A 2OFWA 1GAQA 1TNDA 2MSDB 2ZTSA 3L82B 4KHZA 4B3GA 4B74A 1NVVQ 2CLCX 2ZE7A 2OK7A 3X1ZA 5IT5A 3NKVA 1E96A 3IEUA 4ZDKA 3R9IA 4L15A 4QGAA 3PFIA 3W5IA 4Q4LA 4B2IA 3VX3A 4B71A 3FFAA 5KPDA 1VQKB 4V0LA 4CZ2A 4M1SA 1QVGB 2RAPA 2DPXA 4CIDA 1S2MA 1GRQA 1OFTA 3REGA 3LBNA 2CDNA 4M1OA 4QJ4A 1XCPA 2IYRA 4YAOA 5FL7A 4HEJA 3I5YA 1Q22A 2ONKA 2G1JA 3MHPA 2R6GA 3O8CA 4TMZA 5TR9A 5DYGA 5LBIA 2EU8A 3AKDA 2PMDA 3HJNA 3LY5A 3U4QA 3KXKA 5DI3B 1TMKA 4N3NA 1KDOA 1QHXA 2BHRA 4FXPA 1Z0DA 3G82C 4U5XA 1FDRA 3EA5A 3K09A 3QKSB 3ZVRA 5JRZA 2B7BA 2QDXA 2GJ8A 2RHMA 3K70C 1YU9A 2JLUA 4JZKA 4YDHB 4Z51A 2BMJA 3BE4A 1YZQA 2YWEA 1G41A 3ZBUA 2GVDC 2WIAA 2FSGA 3EXAA 4ZDIA 1S9DA 1XF9A 2XZLA 3T06B 4IFEA 1NI3A 4LYJA 2HCJB 4A2QA 3R7WA 3RHFA 1H8HA 5LPNA 4B47A 2ORWA 2IA5A 3IDQA 2K5UA 3OIVA 1SKQA 1JB9A 1AKYA 1SVOA 1OSNA 1RJ9A 1NBMA 2FU5C 2R6FA 4I1VA 1VIYA 1AMOA 3VTKA 3LBIA 4BFXA 4DLTA 5CK4A 3AKCA 1P72A 3BOSA 3L0PA 3FOZA 1QGYA 2FPKA 2XOKD 4MUBA 4V02A 4LPSA 4W5WA 3FMOB 5J47A 1KKLA 5KSWB 1U0JA 3QKRB 1Q1EA 2QTZA 4TLBA 3B1ZA 4DCSA 3U60B 4V0NA 4Q03A 1OLOA 3Q5DA 4Q9IA 3K70D 1KMHB 2FEOA 4EUNA 2NZJA 3CRVA 3K0AB 4BFSA 2DCUA 1G8GA 3NC1C 4DCTA 3O8BA 4BE7B 2BJVA 2G9NA 1W7AA 5AN9A 1E2GA 4DLZA 4TYNA 5DHFA 3IGFA 3H4MA 4DDTA 1ELOA 4TN1A 2Q3FA 3TMKA 4A8JA 3ZLJA 4CRWB 1ZBDA 3C5CA 1GOTA 2RGXA 4Q9JA 2P6RA 2V3CC 2O8DB 3F5FA 3EPHA 3KL4A 4EPTA 2PLFA 1PVOA 4RD6A 1ZM4A 5JWOA 4PHTA 3W3ZB 4KLZA 5B2ZA 2YYZA 3C8UA 4FN5A 3CKLA 1LW7A 2IC5A 2ZE8A 2B5OA 1JXOA 4KFSA 2JLRA 4LYAA 4P4SB 2E9SA 3GP8A 1RZ3A 2HLDA 4DHEA 4NCNA 3UIEA 5J4HA 4M1TA 2FFBA 5DE3A 1G3IA 1Z5ZA 3NH9A 2HMAA 5HTKA 1GAWA 1NJGA 2QAGA 1B2RA 2XSZA 5K8TA 5CB8A 3THXB 1W4CA 2UVQA 3CCSB 1G4AE 4BPBA 3LAWA 4URWR 4C7OA 1VECA 2VP5A 4LUCA 4TQ9A 1D6JA 3DEFA 1KKMA 3LLUA 1LTQA 3PCRB 4MGYR 2QMHA 1TQ2A 3Q3JB 5E7JA 3GLGB 3U44A 4NYIQ 3F8TA 4Q7MB 5AR1A 3SOPA 2GPJA 3SC3A 1XXHE 2XX3A 4QHSA 2EWWA 5KDLA 2VTKA 2W6JD 1CLUA 2A30A 2WV9A 4HLCA 2IF0A 5BXQC 2IS6A 2ZS8A 4BFYA 2F9LA 2ZRFA 1KI6A 3CBQA 1XU4A 3RRYA 3TNFA 2RGBA 2WSSA 4D6PA 2X19A 1IXRC 3U5ZB 1GZSA 1H8ED 5THXA 3C41J 5EXXA 5CB6A 5KSZA 2J0SA 1VCIA 5C18A 5KSYA 1KO1A 4TYPA 4BASA 5FTMA 3SNHA 5HPYB 4PC6A 4IVRA 421PA 4MYTA 1CJVC 2J59A 3EWAA 2BMWA 3B78A 3KXLA 4V0KA 1S1CA 4AF7A 3EX7C 3AGQA 1SM4A 3IBGA 1QUEA 2DFNA 1JR3D 2NOAA 4R71A 5FPYA 2HT1A 4TL9A 4KFTA 1XEWX 4Q4HB 3W3AA 1DAKA 4Y9RA 3VHLB 1GKUB 3OIUA 3VKGA 2Z83A 3DOFA 3IPXA 4TSFD 5L3QA 4B3CA 4R7ZA 1AZSC 4A6XA 3EASA 1UDXA 4IDHA 4QOSA 5BN5A 2GEVA 3N70A 2QP9X 3SBEA 1Q3TA 1PUIA 3A36A 1LV7A 3R9WA 1P73A 3WNDA 2CBZA 4TMVA 5EXPA 2VF7A 1L4YA 4S2EA 5FUYA 4ACAA 2GHIA 4BLPA 3WNCA 2O5VA 3O8DA 4M8NE 2GEDA 2J0UB 3AP3A 1VQ7B 5JWRA 5JI3E 1XD2B 2CNWD 4TLDA 3VHXA 3EIEA 3HU3A 4URUR 3EC2A 3ZGXA 2D7DA 3LLMA 1VHTA 3GFPA 5JWHA 4PC1A 3AVYA 1NVUQ 1XP8A 1S3GA 4KVAA 3SDZA 1E2LA 2JJ1D 4POAA 3U3RA 2VHCA 2PT5A 2R6DA 2GJKA 1A82A 1GRRA 4US1R 4MGKR 5FPKA 1DADA 1G7TA 1OYYA 1XJQA 2BKEA 4V0ME 1EWRA 4Q7JB 2O0JA 5BWMA 1FNDA 2ZRKA 1SXJD 3TE6A 1EK0A 2VHUA 8OHMA 1FW6A 3ZBTA 3LV8A 1M1KD 1TVCA 1E2MA 1KK2A 1GIAA 1OIVA 5FA6A 2A5FA 2V8OA 2ZRAA 3CM0A 1I2MA 2OLJA 3PUYA 4LBYA 4JLDA 2CHQA 3RDPA 3BWDD 1T8TA 4EIWA 2G3YA 4JLAA 1AN0A 2VLIA 1KI9A 1NDHA 1ZD9A 2VPPA 5JJKA 4RKEA 2AL7A 3PR1A 1N6KA 1WRBA 4AKEA 4Q4AB 4K81B 3DOEA 1JA0A 2J45A 4OK3A 1YJWB 3DPUA 3MWKA 3QKUA 4Q18A 3CNLA 4D80A 3TK1A 3QKTA 3JQQA 2OBNA 3RVBA 1Z08A 1N25A 4R9UC 4RFSB 4B75A 3Q7PA 1K5GA 1CRQA 4UJ3A 2B8WA 2YKGA 3KQUA 4GZMA 4ESVA 3SFVA 2BEKA 1J70A 2ZS9A 2JLQA 1T5LA 2FGKA 1NKSA 3SYLA 2GZDA 4ZI3A 3VU9A 5B58C 2F55A 1C4OA 1SVMA 1RRFA 4DQKA 3R8FA 5C4MA 2OXRA 3I1FA 2ORVA 3LQRA 1JPNA 1XPOA 4YMUA 2L0XA 4EPXA 1DEKA 4RKFA 1Z6TA 5GVSA 2W58A 5AJXA 5FOUA 1KHTA 3VFDA 1X86B 3DKVA 1QF9A 2IYZA 4BFTA 3NBXX 4LCBA 1E1QD 2EWVA 4OYHA 1QHNA 4URYR 3CPWB 1VKJA 4TTQA 3WRXC 3H1TA 3L0OA 2VP2A 1OKKD 2QP4A 2CJWB 4HAVA 4QL3A 3SEAA 1BMFD 1SULA 1VPLA 3L8ZA 1MV5A 1CU1A 4UXIA 1SXJE 1HT1E 1TF7A 3K0EA 4IOLA 1SKYE 3PEVA 4MKIA 4EJSC 4EDHA 3ADKA 1JNYA 2CLDX 1Q82D 1ZIOA 3FGNA 3B9QA 2UKDA 2CK3D 4RD0A 3G0HA 1F2UB 4M1WA 4TMXA 2Q3HA 4IEEA 4JLBA 1W0KA 3PVSA 1O3YA 3OEEA 3AKEA 3TUIC 4TYYA 3FWYA 1IB0A 5FBVB 3AEZA 4PPGA 3K9HA 1T4GA 1SQ5A 4EPYA 2IXEA 3ZJYA 1KY2A 1R4AA 1H42A 1YIJB 3QFRA 2DHRA 2WJYA 2ZI7A 5CJ2A 3JVUA 2X8AA 2GILA 2QAJA 5BQ5A 1JQLB 1P61B 2O8EB 3P32A 2GCOB 1GVNB 2IYLD 2ZETA 1BO6A 4US0R 2HJGA 3K0CA 2IL1A 3AM1A 1KDRA 3HR7A 5BN3A 5UKDA 1XPRA 1DBSA 1EFHA 1TUEA 3K0FB 1Z6GA 3O8RA 1OFHA 1T0JB 1NMXA 2C9OA 3LDAA 3SJAA 5E95A 4LYFA 2QEQA 3K70B 1LF0A 1NJID 4UJ5A 3U7GA 1YZNA 3OZXA 4W9MC 4Z54A 1Z22A 3W6PA 4TLEA 2P6NA 2R44A 3B7GA 1VQ8B 2NPIA 3ZYCA 2D2FA 2C77A 2QSZA 1KY3A 1XMJA 4Q4JB 2P67A 4HLUA 2KSQA 3Q9LA 3CRQA 4WXPA 1T91A 4D82A 4ACBA 1P6XA 1XE1A 2QM8A 2YHSA 4LHYA 3THYB 3CCUB 4WIAA 1S1MA 4RSGA 4NBSA 4ASUD 5JSZB 5KU1A 3V4RA 1WB9A 1E63A 4C0SA 2PT7A 2MMGA 5FFMA 3X1DA 5H5JA 2WJVA 4Y7CA 1XBTA 4BUJA 1W48A 2H5EA 4OI1A 2PL3A 2D62A 2NGRA 1R5NA 2LWIA 2RGDA 3W8NA 3BH7A 4BPRA 2BGIA 1YI2B 1BKDR 1GTVA 1QVAA 1TF2A 1ZU4A 5JI2E 3P20A 4M21A 4Q9KA 3NH6A 3IPYA 5F98A 2NMVA 1LNZA 5FBLB 1I4LD 2GJAA 4DIEA 3QBTA 1OXSC 3Q8XB 2WICA 3FPAA 5DI3A 2JAQA 4PO9A 2OFXA 3FFBA 3V00A 5FPSA 1M34E 3TRFA 3QKSA 5CK5A 2ZRHA 4NDZA 3X1XA 1YHQB 1OXXK 1F3OA 1UDWA 3SHWA 3SE0A 1W4BA 2XZPA 1JA1A 2J87A 4MKGA 1JPJA 1T9HA 4LK2A 1J7KA 1RRGA 2G0TA 3B9PA 2NO7A 5EP4A 1ETUA 2JLSA 2CCKA 4PQYA 1G6HA 4BZPA 4JT4A 4XWOA 1RRPA 1QHGA 4M0LA 1U81A 2NIPA 3KQHA 2AK2A 3G71B 5CLLA 4MH0R 4B48A 1QBKC 3DHWC 3RS5A 3TGPA 2JATA 2ZYVX 1FX0B 4FWIB 5CYOA 1QG0A 3QKRA 2ANBA 2IUSA 3D7MA 1L4UA 1BQEA 1Z2AA 1RC8A 5FTKA 3HU2A 5JLJA 4ARZB 1B0UA 3BGWA 4LJ5A 4M9XA 1PV4A 2XNDA 1KQSB 3K0AA 3TKLA 2J41A 5DN6A 4WXRA 4PO1A 3DM5A 4ZIRB 5EXTA 621PA 4PZYA 2ZRGA 4LZZA 4DKXA 5A5GA 1U90A 1RW4A 1D8TA 2VSXA 3KJGA 3SU8A 4IDPA 2V7QA 5JECA 4DCNA 3CD6B 3BH6A 2HT6A 1HA3A 3NG1A 5IHPA 1E9DA 4YXWD 2VNKA 5FOTA 5DLQC 2O8DA 1OF1A 2HXSA 4M2LA 1KO4A 1YZGA 1KDPA 2D4HA 3LFUA 3C16C 2VNHA 1MT0A 2AXNA 5C4GB 5FUWA 1FTNA 1P60A 3D31A 4P4SA 4C0HA 2JJ2D 2XZOA 2AHOA 3DVLA 2ASEA 1EXMA 2C95A 2ZRJA 5JFGA 3DO6A 5A0FA 1P2UA 1EWYA 2J7PD 3EPKA 4PSVA 1K8AD 3TUZC 4MKFA 1HURA 2ZEJA 2EW1A 3ZS8A 5KDDA 1AM4D 3QBVA 5J40A 3THXA 1KMQA 3GLIB 1E0AA 4A6PA 3RRMA 4C0QC 4O3MA 1ESMA 1R0WA 2B7CA 2I1QA 3LWNA 1CQXA 1R8SA 2QA4B 2AKYA 2VP6A 4QJ5A 3GLGA 1HT2E 1D2EA 2QQEA 3OEHA 1KAOA 3BB1A 3V76A 1JAIA 1W2HA 5EP1A 1XTKA 2HF8A 4NYJR 4P33A 2ZI3A 4Q1CA 4OQFA 2A5JA 3VR5A 2P65A 3D8BA 4ZPXA 1YJ5A 3W2EA 2AN9A 3KFXA 2G77B 2BF4A 1DE0A 2PZEA 4R98A 3VR1A 3MD0A 4JVNA 2W2XA 4IHQA 1GL9B 2BIFA 2HF9A 1CR4A 4LJ9A 2BEJA 3TR0A 4EAQA 5KDOA 1U8YA 3VKWA 2ZYUX 4KSCA 4IKEA 4DLYA 3CCLB 1Q1BA 4UNQA 3QUSA 3WBJA 1GNQA 1X8LA 3MRSA 4ESHA 5HCNA 1KTVA 1COWD 2PIAA 1R0XA 2PBRA 4XD7D 5DHAA 1WE2A 2A78A 3G6EB 4JBYA 5G41A 4BLQA 1P4SA 4AIIA 2I4IA 2AX4A 2G6BA 4Q47A 2WWWA 2OUKA 3FHOA 5E3HA 1KDTA 2QTVB 2B8TA 5C1BA 2QM7A 3MUFA 3TAUA 1NLYA 2A2ZA 2QTFA 2J0QA 4JS0A 3X1YA 2GXAA 4OJKA 4D4LA 1OXUA 3HYRA 3MSXA 2RH5A 4EPWA 1T0HB 5DGXA 4D0LB 4MYUA 3CCRB 4ZDJA 3I62A 3BXZA 4DWJA 3KKOA 5J4KA 2CVHA 2HV8A 4BFZA 1JI0A 2CE7A 1ZNYA 4KODA 4TT3A 1IN5A 5D3MB 4DC9A 2XTMA 5KNBA 1ZM9A 1X1RA 2O52A 3GLHE 2E87A 2QE7D 3D3QA 3FJOA 3UG6A 1A1VA 2ZUDA 1F20A 3CR7A 4LYHA 3RANA 1FQJA 2DY1A 4GSYA 5L3SA 4YAWA 3GJXC 1NRJB 1W5SA 2YWFA 1FRQA 1SVSA 1ZJ6A 2HCBA 2XJ4A 3KTAB 5FPHA 4I81A 3I55B 4CEIB 5GADl 3B60A 4HDCA 2IWHA 1EFRD 3I56B 2ZU0C 4D4MA 1E79D 2UZ3A 4OK6A 4R2IA 4AKHA 3KKNA 3QVVA 2NQ2C 3OHMA 4N3GA 4YMTA 3A6PC 1G1MA 4M4SA 3AQ4A 1ZVQA 2IHYA 2VF8A 4JVMA 2ZM5A 5HXBA 5HZKA 2B92A 4CVNA 2GK7A 1TU3A 4DLUA 3SHFA 3T1QA 2GXUA 3RS4A 3CF6R 1CR2A 2J0UA 4PHGA 1W36B 3GJ8A 1ZUNB 1ZC4A 5LB2A 4FMDB 1Z2CA 5DH9A 1E64A 4HAWA 4GP6A 3T12A 2WBLC 5IK2A 3DMNA 4J0QA 4MRSA 2ZJOA 1FL9A 1ZMXA 3KKQA 4H1VA 4PXAA 3GJ0A 1HYQA 1E9RA 1QUFA 1OH6A 1CP2A 3W6OA 2RHDA 1EP2B 4B2LA 4F4JA 4NH0A 3OIYA 2A5GA 2F43B 3LVBA 4L8GA 1JB1A 3AF2A 4JBXA 4CGZA 3B13B 4BEJA 1CR1A 2VP0A 1GAJA 2IYQA 5JBQA 2HXYA 2JCSA 3TW4A 2IUUA 1Z0KA 4RY2A 1BX1A 4HB4A 4C0KA 5GJBA 1Q12A 2JLWA 2OV2A 3LH5A 1IXSB 1VG9B 3UWKA 1GNRA 5AJZA 2GRJA 3QY0A 3KFVA 3LD9A 5G53C 1AKEA 3VR2A 1WXQA 2JIZD 2VRWA 3FHTA 1EESA 1EGAA 5DNYB 4L9WA 1QGAA 5AUOB 4D81A 2PZGA 4IDQA 1S0UA 3FMPB 4LI0A 1AS2A 2H8KA 3W90A 2IYTA 2VYQA 2A3RA 1E94E 2OM2A 3B85A 4OI0A 4NYMR 2I3BA 2WKQA 2VQSA 4RFSA 2O8BB 3K09C 3QG1A 4NONA 2VEDA 4TYWA 1W1WA 2ZYWX 3LO8A 2NG1A 2GCNA 1FPMA 2MSCB 4XWAA 4LBVA 2IT1A 3RAPR 5KHOC 1JECA 1E9EA 1II0A 1E2IA 1B23P 4JL5A 4DB2A 5FL7D 3NWJA 4NMMA 1IY2A 4JLKA 1XNJA 1OFUX 1NY6A 4B43A 1G9XA 3LXXA 3TR5A 3RS7A 4PTLA 1IN8A 3O47A 3Q85A 4AC9A 4K1XA 1CJMA 1IQPA 2BBOA 2FG5A 2WOOA 2YOGA 4NE2A 4WBSA 5EXSA 5JMTA 1QG4A 3U6KA 4TMWA 1E9CA 4P0TA 3GLFA 2ATVA 1DG3A 1E2JA 2OEPA 2WSMA 4QNMA 4EQ6A 2CJWA 2QP3A 1N6HA 5EE0A 2VBCA 4IOKA 1UBCA 4BFWA 3EZ6A 5EE3A 1QFYA 2QPTA 3VO2A 4KITB 3CX6A 2O8CB 2QMOA 1N6RA 1M90D 3P4XA 3CCQB 2HDNB 1KIMA 1H8HD 1TEXA 3OFND 3QF7A 3SYKA 1ESNA 4HLQB 2PJRA 1E4VA 2IBMA 1FNMA 1MABB 1DTSA 2P0EA 3TQFA 3WBKA 2VH5R 3E1YE 1F2UA 2PH1A 4B6FA 5EE9A 2O8FB 4NL4H 1NBMD 1U2RA 1CJTC 3BFXA 1VYTA 4BGDA 1KO7A 3QNUA 4MRRA 3VR4A 1VG8A 3ASZA 2ZU6A 5G40A 4XTRA 3ASYA 4MA4A 4GMDA 4CW7A 3GJ7A 1E1RA 3AP1A 4D0GA 1FFHA 3KJEA 1P2SA 1DAHA 1P5ZB 2V1XA 3QPVA 4KV9A 4WA7A 1N6IA 1D1NA 1G6OA 2GCOA 1ZNXA 2YV5A 3B2EA 4PANA 2ANCA 2JLXA 4E22A 3K53A 1SVIA 3OAAA 1GFIA 2NZ8A 3ZVMA 3AVVA 1XJCA 4KO8A 2QAGC 4GOXA 3K0FA 4JLJA 1YJ9B 3I92A 4A92A 2BDTA 4X8OA 1W49A 4PQRA 1UPTA 1OIXA 3QXCA 2JGNA 1BS1A 4GPTA 2VSFA 4YLGA 2QU8A 3CCJB 4LHWA 3HPQA 1MOZA 5HKKA 2F1JA 4HSEA 1VTKA 1E0KA 1HTWA 2GKSA 5CDFA 4Q4JA 5D3QA 2FE4A 5EE5B 4URVR 5K8UA 1G17A 1T5IA 1VQ6B 1U8ZA 4B3FX 2HLDD 4DUGA 2NO9A 4KYIB 5EP3A 4LSGA 1OV4A 3THYA 3CRZA 3CC2B 3LRPA 4QGHA 3MWJA 5JSZA 5KSOA 2ZROA 4DXAA 2F6RA 2WZQA 5AUNB 2XSZD 2ZREA 4FD2A 1GM5A 2QTHA 3EZ7A 3EPJA 3CNNA 4ILEA 3TVDA 3GLFE 4G5GA 1ZM7A 4M1MA 3F0TA 1W44A 1E6CA 5TVKA 2FN4A 4MDFA 2QORA 2F1IA 4MITA 4UXJA 4CT4B 4I4LA 1TQ4A 3C5HA 1W0JA 1UKVY 3AVTA 3B8HA 2W6ID 1KOFA 3QEOA 1P7CA 1XMIA 4IFBA 2D74A 4F7DA 1NBME 2QROA 3LW7A 3KDSE 1FMJA 2LKDA 3IBYA 4QKQA 4CEHB 2XGJA 5IDVA 1G3RA 2DEUA 4A82A 2R6AA 1CULC 4GDFA 2R9VA 4PC3A 4U9UA 2CE2X 3K9GA 1QDEA 1G8HA 4BLSA 4KBFA 1Z29A 3BS4A 2BJWA 5C46F 1HH4A 4DLVA 1G64A 1UJ2A 2PEYA 2KWIA 3N2EA 3QXXA 2BKUA 4A4DA 3PJRA 1NG9A 4WQMA 2AKAB 1S3SA 1RYFA 2H92A 4P3YA 1XCGB 2RCNA 4QHYA 3E70C 1EP3B 2CCGA 2XTZA 2WPDD 3U3KA 4DEXA 1N8RD 1NKTA 2BM1A 2QT0A 4B76A 5KPJA 1X8KA 3QFTA 1RYHA 4HLDA 4HZIA 5L3VA 4CEJB 2C78A 3MJRA 4G5RA 1CRPA 3WHLA 4JVSB 2OESA 3HP1A 4ARZA 1XRJA 3EARA 1IY1A 3DL0A 3EC1A 2AXPA 4B2PA 3GJ6A 2A5DA 2QZ4A 4NTZA 5JS7A 1VQLB 4ZIRA 3ZIAA 1NN3A 1TADA 5GJVC 3ZZTA 3FHCB 1JR3A 1TEVA 5C2JB 1KSHA 1SXJC 4QBHA 4LBZA 1I4DD 1AGRA 1CF4A 2CXXA 1AA9A 4JKIA 2G1KA 4TSFA 1YKSA 1M74A 3LW8A 1GSIA 1G16A 1HQCA 1Z47A 2GJ9A 2ZS7A 5AJYA 3ADBA 1VG1A 4TMTA 3A8TA 3CLVA 5HE9A 4EFMA 2ODNA 1IBRA 4JL6A 3THWA 1E32A 5LD2C 1OHHA 5EP2A 4LHVA 1KI8A 1NMZA 1Z8FA 1G7SA 2IHBA 4PFSA 3TW8B 2Q6TA 2ZVPX 4FMCF 1KJWA 4WZ6A 4C9BA 4QGFA 1A2KC 4B34A 2VHTA 1V5WA 3GEEA 4ZGQB 2ERYA 2Z0MA 3GLIA 2W0SA 1VQ4B 1DG1G 4I99A 3EPLA 1UF9A 3TH5A 2ZRNA 1UKEA 1BYIA 1KI1A 2IXFA 5IF9A 1M7GA 1Y3AA 1E3MA 4AY2A 5KO2A 3ND9A 3B1WA 2QTLA 2Q9CA 4M1YA 1P9NA 1KSFX 1ZM2A 5TARA 1G3MA 4HYYA 5CYPA 1KJZA 2ZYTX 4R2HA 3KKMA 5F9HA 2OO7A 4YDSA 3PUVA 2QSYA 5FBWB 2N46A 5KNDA 2XNSA 1ZU5A 4LJ6A 3TSZA 4BFVA 1G5RA 3BRWD 4OHYA 4FK8A 1XEFA 4E07A 3ZVNA 4UQOA 2ZSEA 2EFDB 4HATA 4NU0A 3DMDA 4C2TA 3WNBA 3I72A 4Q9HA 1KD1D 2Y8EA 4JLMA 3IKJA 1EFTA 2JDIA 1GRNA 3NHBA 1FRNA 4HE5A 1L2TA 3CC7B 5J4VA 1SHZA 1T8UA 3HU1A 5FL3A 5AK0A 4EPVA 1OH7A 1XD8A 4C43A 3HWSA 3MAAC 5HZHA 1FNCA 1Z83A 4DJTA 3OZUA 1F2TB 1G18A 2QL6A 4MGZR 2GXQA 3NBYC 4UNSA 5TMPA 1VMAA 1E0SA 1YITB 2KE5A 4OK5A 1XWIA 2W83A 4PAOA 4PPNA 1GDDA 3LX8A 4G1VA 2JJ8A 2QY9A 1MRNA 1R10A 3AB3A 5TDHA 5K8IA 2SHKA 1G291 3A4MA 3KX2A 2OK8A 3W5UA 2XAUA 4ZDWA 3PUWA 3KQNA 1XMVA 2Q9BA 1E2EA 4RD2A 4CEIA 1RRCA 1JBKA 1IHUA 1IONA 5EJEA 4C3ZA 2QQ0A 1W46A 2CL6X 3AF4A 4Q7KA 3RS2A 3GFOA 1FUUA 1I4TD 4B3BA 3B6EA 4E5UA 1NG1A 3K0CC 4GZLA 2JEOA 1BIFA 4GFDA 4Q1EA 121PA 3H86A 1LS1A 3QPWA 3AV0B 3CF2A 4FIDA 3DKPA 5H68A 2KBEA 1UM8A 4AD8A 1TU4A 5F9FA 2QI9C 2J5XA 1Z3IX 3CMEB 2EYUA 4KLNA 4YMVA 4YHBA 1W0KD 3QE2A 2IK8A 2ZI5A 5DYIA 2J1LA 3OEED 3T61A 1XXHB 3RSLA 2QMEA 2D3WA 4JT2A 2QBYB 4M9SA 4LV8B 3V9PA 4D0NA 4HLUC 4DEYA 4KFUA 1PLLA 2YC4C 3ZC3A 3T35A 2ZRBA 3W34A 2F43A 2ZQ5A 4LJYA 1IJEA 1RJ9B 4LHXA 1N0UA 2EQBA 3KUCA 1QVFB 3QXJA 3K9LA 2ZAOA 2WHXA 3MWYW 3UK6A 1Z06A 2GF9A 2WWFA 5BW8A 1VQNB 4AWXA 1W4AA 5FR1A 1VCNA 1Q57A 3CX7A 3U3MA 1QHHB 2VZLA 1UBGA 2FEMA 3ZDQA 4YAFA 3B1XA 1SVWA 3DDCA 4K8OA 2FMXA 2YZ2A 3MFYA 3OJWA 1EWQA 2QGNA 2KBFA 3SI7A 4KVGA 2V6IA 1ZD1A 4H1UA 4DSOA 5AJWA 3M6AA 3SZRA 1LS6A 2JLYA 1J9ZA 4XH9B 2GA8A 4OL0A 2O8BA 1W35A 1OB2A 3A37A 4ZCLA 4YAUA 2I1VB 3OESA 2EYQA 1VCMA 4EFLA 4RD3A 4JJZA 2X77A 3GJ3A 4V03A 1XZQA 2A9KA 4NKRA 3CCVB 5EQTA 5TV2A 4OHZA 4PAQA 1ZP6A 5CITA 2AFHE 2FFHA 1E69A 1UKYA 2ZRMA 3FKSA 3A1UA 3G4SB 3ZVLA 2YWHA 2GCPA 2ODWA 1MO4A 1VYVA 3TJZA 3G5UA 1X1SA 2N1BA 1ZUIA 3AF3A 5JRJA 1LVGA 1MO5A 4PAMA 4KSBA 2ZJBA 2IEZA 2DETA 1G3QA 2X2FA 4U02A 1OE0A 3W6NA 1M1YE 1G7CA 4AF6A 1HY3A 4DRZA 4C7OB 1NLFA 2IYXA 5JHHB 2PCLA 1K6MA 2VIIA 5KTYA 3AF1A 4B33A 4U00A 1IY0A 4PX9A 3JZAA 4FWTA 3ZZ0A 3EAQA 3WY9A 5EMNA 1QGZA 4GNKA 5EUQB 5B30A 1Q0UA 4FI3C 5KNCA 1CJKC 2ZE5A 1ZCBA 3A1WA 1PJRA 2FZLA 1D9ZA 3KJHA 3MCAA 1YZKA 3AVUA 4XWKA 4GBMA 4DT1B 2OCPA 3QENA 2QMUA 2Q9AA 3M1IA 4TL6A 4G5QA 4I1UA 1DAMA 1W87A 2VHQA 3RRNA 1TQ6A 5LB4A 2V54A 3A1VA 1AQUA 2D2EA 2OT3B 2P6UA 3T5DA 3MGCA 3BORA 2XXAB 2EFEB 3OE7A 4X8LA 4TL7A 4B3DA 1AIPA 1ZRHA 5J4LA 4I1SA 3BB4A 4LPKA 5FI1B 1KMHA 2V55B 1W2BB 2WWGA 3U7EB 1YZUA 1KK0A 3NBFA 4IVQA 2OBMA 5FBRB 3CH5A 2Q3MA 2FDCA 4GT1A 4HZUB 4Q7LA 4NCIA 1FP7A 1G7RA 3H2YA 2G83A 1FNBA 4V0OA 1TTTA 3W2IA 2XJ9A 4JSTA 2FFAA 4GI7A 4AG6A 1SZPA 4Q01A 1E98A 4PZLA 4Q1AA 4NYJQ 1P75A 3CCMB 2R2AA 4G5SA 4WVFA 1M7BA 1SVKA 1VQPB 3EG5A 4KFRA 2FSFA 2H16A 3LQQA 4JLOA 4AKGA 4M9QA 3W2HA 4HB3A 5H70A 3SJZA 4C0AC 3RWOA 4Z1MD 1S96A 3CRW1 4UNNA 2RB4A 1E99A 2RMKA 4X8HA 2FV8A 4NPHA 3VR6A 3U7HB 4YXWA 4QNRA 3MJHA 4KU4A 4E09A 2F1HA 4L9SA 4JKYA 1T6NA 4AG5A 1EX6A 2VHJA 3FYHA 1N0VC 1GJRA 2VNIA 5ANRB 1Q7YD 4IXNA 4AK9A 4ZV4A 3QXSA 3P26A 2ODBA 3K8YA 2Z4RA 3C4JA 5FOSA 4EKDA 4PHHA 1O87A 2BGJA 1N6NA 2PCJA 4D25A 3OEHD 1XB2A 1EP1B 3TIFA 3CMAB 1MKYA 3C7KA 4U7DA 5TB5A 2Q21A 2X2EA 2IS1A 1N6PA 3SR0A 1ANKA 1SXJB 3UG7A 2FGJA 4M53A 1SKYB 4CEHA 2QN6A 5LDDC 2NO6A 3NEYA 3E5HA 3M4YA 1X3SA 4EPRA 2D06A 3WHKA 4P31A 3FKQA 3ZH9B 3AKYA 3AVOA 4ZKDA 1RVDA 2OAP1 2QUZA 3GFTA 4JL8A 2ODEA 1Z07A 2BBWA 5LD2B 3UATA 4URZR 1GL7A 1WMSA 3AP2A 1HE8B 5KSPA 5HR5A 3EIHA 5JJLA 1DOAA 2WTUA 4IDNA 4X8MA 2DWPA 5G3YA 1E9BA 2C96A 2GQFA 4LJAA 3PUZA 1NSTA 1G8YA 3UWOA 1AGPA 1D9XA 5HCIA 1GL6A 3FPKA 2AWOA 5SZJA 1F6BA 1QZXA 3PITA 2YJTD 4A0FA 4XIGS 4GOKA 4IOJA 2OILA 4Q4HA 4CEJA 3WXMA 221PA 5FOWA 4IJMA 3KB1A 4TQAA 4TT3D 3EZFA 4BQSA 1VQMB 5JEEA 2GBLA 5IRCD 1N5JA 3OF5A 2W0MA 4HB2A 4MKHA 3IIMA 1U0LA 2OHFA 4HUQB 5H8WA 2OCBA 3BBPA 4L4UA 1K73D 2BC9A 1F5NA 1KK3A 2DFTA 4XSGA 4WOPA 5AWFC 1H65A 3L0SA 4F92B 3OJXA 4TWZA 2BSAA 2EIXA 1X8JA 3FVQA 3LO5A 4IRUB 3PEWA 1U8AA 1GNPA 2MMCA 3EWSA 4RZ3A 1L7VC 1T3LA 4BWYA 3OZWA 1BYUA 3QEJA 4C0LA 3UMSA 1J2JA 4Q1BA 3MLEA 3MG9A 4YMSA 2ZR9A 1KSGA 1Z0IA 3GLGE 1V43A 3M0EA 1UBFA 2WWXA 3CO5A 1XD2A 1M2OB 2UZIR 2DERA 1XEXB 2VYFA 2ZSBA 4K46A 2OCAA 3ZS9A 3ND8A 3UPUA 5CLQA 4BFUA 5GVRA 4F4CA 4IVPA 2CL7X 2P2LA 1FUKA 1OB5A 1EG7A 4G01B 5IK2D 1Y63A 4PQFA 1P2TA 3CIOA 1Z28A 4NYMQ 3C15C 2BMEA 2WWHA 2OLKA 2AFIE 5JCZA 2CL0X 2C04A 3PIRA 5P21A 1ZAKA 2Z43A 1UADA 4BEBA 4ZCMA 2WJHA 1Z6YA 1MO3A 2J46A 2RKOA 1SGWA 4Q00A 4TQUS 1H85A 3FE2A 3WRYC 1JQJC 2Z5FA 1VQ9B 1UFQA 1YZLA 4DSNA 2GF0A 5ELXA 1AS3A 1GKYA 2IWRA 2OBLA 4KYUA 3VAAA 3ES9A 1D5CA 2DFLA 2QPOA 4DSTA 4QM6A 3AVQA 1W34A 2NO0A 1YE8A 2P5SA 3MWLA 4JLNA 3BK7A 5SZKB 1JJ2B 5KOYA 1XX6A 5FTJA 1KYIA 1GITA 1GG2A 3RC8A 4OQXA 1GP2A 4RFVA 1P62B 4DLWA 3AUXA 4AYTA 1T3HA 2XITA 1ZCAA 1C1YA 1NP6A 3IQXA 4Q4AA 4B35A 4EJSB 4AURA 2ZSFA 3AVWA 1II8B 1NIPA 2VA8A 1IOZA 1E9FA 1QHYA 4LV5B 4OKSA 3SBDA 1U9IA 4LC1A 1D2MA 2FSIA 1EX7A 1IM2A 5H59A 1N2CE 1XTJA 1P9RA 2IUTA 1Z0AA 2JIZA 4QM7A 3DZ8A 2VSOA 3PG5A 3RS0A 1QHSA 1VHLA 1F2TA 1OFIA 2ZRPA 2XNCA 3U61B 3IO5A 3U7FB 4PC7A 4MRNA 5FTNA 1FQKA 5JZVA 2V6JA 4C4PA 1R7RA 1XTQA 3UXMA 2RGNA 3QI2A 4LJ4A 3JZMA 3QPUA 3ICEA 4TLCA 5JJIA 1DVRA 5F3WB 1UBEA 2PEZA 3LVRE 2IS4A 2RC6A 4PGOA 2BVNA 4PO8A 3NTUA 4PSKA 4Q48A 1YRAA 4KXFB 4TTPA 3QIAA 4FMCB 3IILA 2KJQA 4QBIA 4GRAA 3KB2A 2RGGA 2GAOA 2ZSDA 4OHWA 3TUJC 3CRMA 3NXSA 1N3BA 3BB3A 3VNUA 3WYAA 3KQLA 2E1RA 4N0EA 4Q5IA 1E2KA 4A8JC 2R6HA 2W00A 1Q1QA 2WOJA 1JJVA 2GNOA 2ORIA 3H84A 4A0GA 2HEIA 2O0HA 5JCPA 1G20E 2CRVA 1NVVR 4CT5A 1G3UA 5BYJA 1AS0A 4DQLA 1DARA 1XPUA 2OAQ1 1R0YA 3MMPA 4W5JA 2ERXA 2A5YB 2WWIA 1XXHA 2ZJ8A 2QBYA 4EFNA 1T3SA 3OFNA 2IS2A 2BWJA 1E1RD 2O8EA 3Q72A 4QC2A 2VO1A 1YHNA 1NIJA 1I2DA 3S1AB 3KJIA 4LBWA 3D6TB 2XOKA 3GMTA 4MYCA 1ZM3A 3E20A 2BCGY 3OAAD 1OT3A 2WWYA 1WP9A 2PMKA 1AZTA 4KBGA 2PX0A 3SQWA 2WM9B 1RE0A 2ONJA 3TVTA 1CXZA 2BBSA 2GVZC 1M7HA 2C9YA 3CRRA 1TX4B 3E1SA 3I8XA 2H7VA 4Y0AA 2R6CA 1QHHA 2ZR0A 1S8FA 2XTNA 2JA1A 3QG5A 5FTLA 3T34A 4BZQA 1P2VA 3L8YA 1E0JA 1ODFA 3FMFA 4OQNA 5AJVB 3LA6A 821PA 5HKKD 2QRNA 3VO1A 4PC2A 3R9XA 3QFCA 1WQ1R 4MYHA 2AR7A 4F4IA 4B44A 3BC1A 1U0HC 2F7SA 2GZHA 2Z4SA 2QENA 4DUGD 4W7SA 1IAQA 2QG6A 3JVVA 2EFHB 3BAFA 3NIBA 4BZXA 1MR3F 3NDBB 1XD9A 2PX3A 3GLHB 3GEIA 4M1KA 1D2NA 4IXMA 1BJKA 1DS6A 2H17A 4JLVA 2GAAA 2KB0A 1XTIA 2CHGA 5GV8A 3H0KA 4O2LA 3GJ5A 3ECCA 3TSWA 3CF0A 1RFLA 3REFA 2OCYC 1DO2A 1KRHA 3HDTA 3SQXA 3UKDA 2F9MA 2OFOA 4JVLA 3V4FA 5HE8A 2ZRCA 4MDEA 4LOAA 2BV3A 1CR0A 1W0JD 4GMXA 3Q5EA 1PLJA 1YR8A 4YMWA 2CCJA 4JJKA 1HE1C 1ZNWA 2YOHA 4A0RA 4B73A 1LB1B 2WSSD 5DI9A 3PQCA 2ZJZA 2WKPA 4Q02A 3LNCA 1UKZA 4ON9A 2W6JA 4WZAE 1VYUA 2W6IA 2IEYA 4O2RA 2J0VA 2ATXA 2CVFA 2V4ZA 4L16A 1KNXA 3KKPA 5CIWA 4FMDF 1K5DA 2IF2A 1OW3B 5GV7A 1AK2A 1DAEA 3AH8A 4ZI2A 2NTYC 4DT1A 1YR6A 3A4NA 2R62A 3PEUA 1YJNB 1CIPA 1H8EA 1FNNA 4V0MA 4YONB 1PZNA 2IYWA 1FX0A 3BFKA 4RZ2A 1X6VA 4C0BA 2ZJAA 4DVGA 1NSFA 1ONBA 2F3TA 1QHIA 3SN6A 5TXGA 4DIDA 1XMSA 2XXAA 4UNRA 2RC5A 4O25A 4QJ3A 5SZIA 2CMKA 3OW2B 1KZ7B 3GEHA 3VMFA 1DO0A 4S35A 5FR2A 1E2HA 1MRSA 1US8B 3IIJA 5CDFE 1U98A 3P4YA 3ADDA 1YZTA 2WAYA 3UMRA 1J90A 2PZFA 1Z63A 2V9PA 1N5LA 2GESA 2WPDA 4LGMA 3T15A 4NYIR 2ZAMA 1W4RA 4HZUA 1TQDA 4KCGA 3W2GA 3RLFA 1BH2A 3ONWA 3RC3A 2G0NA 3ZIAD 4XVUA 2FPMA 4QGGA 2ZPTX 5FUVA 3A1TA 2OE2A 4P32A 2H18A 2HJVA 3I61A 1KI3A 1VIAA 1I7PA 1NVWQ 4BRUA 4C30A 4TYQA 2XNJA 1UEIA 4DDWA 5L3SB 4PR0A 3CPHA 1DAIA 1VDZA 3HPRA 4D4JA 3QQ5A 1NF3A
chains in the Genus database with same CATH superfamily
3AXTA 3HJGA 1OGIA 3UXYA 1WTHD 1UEXC 1WMEA 4LI3X 1NPTO 1TO2E 1Z13A 3DM9B 3P0IA 3QOFA 1OHHD 1NMYA 3TLGB 1RWOA 4PF1A 1NN5A 1E5DA 1RWBA 1VSQA 2MR6A 1ZINA 4NHEA 2BH2A 3DKRA 4AULA 1FP6A 2HBZA 1VFPA 3OZIA 3Q7QA 4L5AA 1HUQA 5LC1A 2O0KA 2FSHA 1OWNA 2W6ZA 3JQGB 3B1YA 2GFIA 3TBKA 3H3FA 4XDYA 5HW0A 4KAJA 2IUFA 1Z7EA 4F5WA 4YO7A 2C2HA 4W99A 2JJ1A 4DUYB 1WW8A 3I6QA 3N8NA 5KYWB 1BVRA 4QBFA 2HBYA 1E9SA 3RU3A 3ND5A 1OLSA 2G4LA 2GMWA 2HQRA 2OPBA 2X1VA 3B9BA 2BGTA 1K9MD 1GARA 3T54A 3WGVA 4B3IA 4GP7A 2AK3A 3HRHA 1ZOPA 3B1FA 1OLUA 3GCZA 2J5QA 4CDGA 3U6BA 3SKVA 3TXXA 2XMCA 3UHFA 3EGXA 3INYA 2A1UB 3F98A 5JSHA 2REOA 2AI2A 4M1EA 3WE7A 1ZFNA 3JQRA 2NO1A 3VDRA 3CUWA 3P9YA 4JCCA 1I6MA 4FCTA 4PWYA 3AEXA 5CYGA 1YR3A 2QNRA 4Q19A 2PFSA 2L69A 1EFCA 3RUPA 2JGIA 2DJ5A 3A6KA 2FEAA 4MGIR 5DYWA 4NK4A 2FPLA 4OI2A 3S70A 1E4EB 4YT2A 4IQ8A 1WU7A 2H1LA 3CWQA 3SY8A 1ORWA 1C0IA 2OG2A 4L0CA 1YQWA 4OH1A 4WKCA 1K08A 5IBRA 2HUPA 4PPFA 2ZUUA 4BV8A 3H4VA 5JQGB 3JTMA 1JQBA 1JR3E 3Q3VA 1NUPA 2CN1A 4RD4A 2EVWX 1UOPA 3OOJA 3ADPA 3I4LA 4G89A 1VHJA 5IJ9A 2V1UA 4EAAA 3HJBA 3OIDA 3PDUA 3L1UA 1VA5A 1MJ5A 3FNHA 1J20A 1OYWA 5KYKA 1FDVA 3NHAA 2YZ7A 3S29A 1EG2A 2J4CA 2BCJQ 3V7FA 4BMCA 1QFZA 4P25A 3JV7A 4QAJA 4XX0B 1UXGA 1RNLA 4LHZA 2PUAA 4O8CA 2P4EA 5J58A 5GJCA 4LJ8A 2ENUA 1JQEA 4HUJA 1D5WA 1XG5A 2GZ2A 4ZREA 1FFAA 1GEEA 3SJBA 3BD6A 1UJMA 4HF7A 3HO8A 1U8EA 2BCEA 2DB3A 1E2DA 3INRA 2QUJA 3R6LA 2VNAA 1A71A 1VCOA 2GYUA 3BWVA 5CXSA 3EH1A 1DKNA 1TGYA 3WO0A 3R0ZA 4CMGA 2ZB4A 2V4UA 3JVDA 3KQVA 2FZ5A 3VHRA 3U4QB 2JIBA 1AKRA 1VMIA 1V96A 1ISPA 1V7QA 3UKJA 1BQ4A 1OTHA 1QZTA 1T2EA 2AXQA 2WDZA 3G5AA 3SCZA 3QFSA 4UHEA 3CVXA 1UMBA 4UUAA 4KAXA 4I5DA 5I9IA 1LF5A 5JDIA 3CU5A 2ZI9A 1UQTA 1E2PA 3GLFB 3OWOA 3DVQX 4QDXA 1J0BA 4RDKA 4X7CA 1ZSVA 2JLZA 4UAVA 2VRNA 1N6LA 3C1TA 3X1KA 5AH0A 3J7AC 2GZAA 3BD9A 3H9JA 3HUUA 3VU3A 1NMEA 3ZGNA 4KX3A 4UOZA 4RV9A 5A5DA 2P7IA 4R31A 3Q6RA 3L4SO 1ZESA 3ZE2B 1OH5A 1SU6A 1ZC3A 2GAJA 4DEVA 1Y3IA 4YMIA 3TM4A 2Z08A 3RC7A 3T5GA 3JVEA 1SHKA 1V7PC 1RQ2A 2D0OB 2GLXA 2X0NA 3M5WA 3B1VA 1N4AA 3HKDB 1M34A 4XLTA 4AUEA 4MHOA 3V1TC 1D7AA 2XLCA 3LZ6A 4IDAA 3TQCA 3S81A 5CB4B 4OYRA 4WESB 4EA8A 4G1BA 2F1OA 2JBAA 1R6BX 4G81A 3AT1A 1NLUA 2PWZA 1W5AA 1JALA 5KAMA 4UPEA 3BJIC 2HA6A 2E85A 4G0WA 1U7OA 3ADCA 1XAHA 3I1YA 4P4TA 2Z9BA 1UFRA 3GRYA 5K9ZA 2N3ZA 4ZOBA 1ZOOA 1PG5A 3TKAA 4X66B 4OTZA 5A9TA 1QAOA 1Z6AA 5FBQB 4QSMA 2Q7XA 4RQUA 3EDMA 4RAQA 1GUAA 2BKLA 3KD2A 4DG8A 3U9SA 3SIRA 4YUVA 4E0FA 1FA9A 4JROA 4A8JB 3AVXA 5LLTA 3F5QA 1I0ZA 5EMLA 3RV4A 3WZLA 1YRBA 1ZH8A 2EZ9A 3R5KA 4RL6A 9ATCA 1KZGB 1X92A 1NQTA 4IDCA 4BFCA 4ARCA 1QU2A 3AHFA 2ERCA 2G1PA 3KSDO 3GPIA 3IO3A 3WNQA 2C5LA 2AC7A 2J9FA 5EKSA 5K0BA 1ML3A 3BIFA 2H1WA 2JHAA 1SZCA 4TV8A 4QARA 3ABZA 5FOXA 1U6JA 2XUGA 5BV8A 4QG3A 2WG1A 4OBEA 4ZVSA 4IQ0A 4C6SA 2QM3A 4M8LA 4CKWB 1NLZA 3V8PA 1W2GA 3RGGA 4X7MA 2PUDA 4YMGA 5DP2A 5EXDA 5B3LA 4M36A 1Y3CE 1XYYA 2NXCA 1SU7A 1KAMA 2XKJE 5T6BA 1OX5A 1S2NA 3GCWA 3IHWA 3VYSB 3A2MA 2KMLA 4H6XA 1F0KA 4KGZA 3V7NA 5JW6A 3CSSA 4RCZA 1NF2A 2IYVA 4IIGA 4E94A 3JWIA 1N2XA 3WIUA 3TPFA 4URXR 3EZ2A 1M72A 3I3SR 3AUTA 1T8YA 2B61A 4NP6A 1QMGA 5AQEA 3R20A 3SX4A 3ZTWA 4QBGB 4A7PA 1KWKA 3F6RA 4L85A 2QZJA 2BOVA 4P6VF 1ZD8A 3MTGA 2VJBA 4OXRA 3NM5A 3PR3A 3PEEA 2GETA 3RK0A 1PJQA 4F4UA 5JS8A 4NABA 3ZN2A 3K0SA 3FTEA 3LT4A 4IJVA 5ENVA 2FR1A 4LJ7A 3IRVA 4O4IA 4KYTA 3T51B 1PD1A 1L7BA 2HRCA 3UMJA 5AHXA 5BUCA 5BSHA 5BNIA 3L5KA 4ERNA 4RZIA 1N5KA 5K3FB 3ZWWA 2FPPA 4A0SA 1QQ5A 3VNSA 1NN0A 3NWOA 4US2R 3IPRA 5T8KC 1A69A 4X5OA 2CDBA 1B73A 1IXKA 3LT2A 1H9AA 2FAXA 2IXDA 4JUBA 1EEXB 1UAYA 2ECOA 3USCS 4DLXA 2YVUA 2C4TA 4UVIA 1G8PA 1Q7TA 3BIWA 4IIEA 3H9EO 1DC8A 1B6RA 3TLKA 2IE8A 4CLOA 3OQ1A 1UPFA 2I7CA 2PRJA 2I91A 1F48A 4ZGNB 2PGAA 3PQ3A 1O4VA 1U2QA 1PTJA 2JGRA 2XNDD 4L95C 3ZK7A 3UT0A 3S1AA 1UMKA 4AT1A 1QP0A 2VJPA 3QXHA 2IHKA 5B4UA 2X9QA 3OECA 1DWQA 1RWWA 3C3EA 4Y6LA 1ORHA 1ZISA 3I32A 3QNWA 1Y8ZA 1LBSA 4Z4TA 3L6RA 4TKUA 2FLVA 2W6MA 3ZIUA 4ND8A 1CBUA 5EIHA 5KHLB 5KYVA 3I73A 2R68A 4C2UA 2XWBF 1OPXA 1EFUA 5AKLA 1H9BA 1KI2A 4ZYYA 3M5DA 1WMDA 5EWJA 1ESCA 3BWYA 3FGOA 1HFEL 4EA7A 4PNHA 4TRRA 3TVYA 1FYVA 1RPZA 4HXFB 4XLAA 3W5HA 3T1TA 1FOEB 5BN5B 4WW0A 4ZHQB 4LGCA 4HMQA 1Y8AA 5I7HA 3AB8A 1WOMA 5JYCA 1NVXQ 2BGKA 3EW9A 3KTDA 3BE8A 4G09A 3VR6D 5C5DA 1OIWA 2AMLA 1JG2A 4IMIB 3WIEA 3ZK8A 3NFYA 3C24A 1MVLA 2XB8A 4NE7A 1IZ0A 3PWSA 1ZGHA 3IBFA 1P0PA 4XVQA 3GLHA 4O29A 3EBLA 5LJIA 5DT2A 3SMVA 3HTXA 4BGIA 1J8MF 2A1IA 4U2DA 4NCXA 1V2HE 1BGWA 2VATA 1H1TA 1QO9A 2W2NA 3ABQB 3QSYA 4I1OA 4LX8A 4Y30A 5AM1A 1XQWA 2H59A 5KWEA 4DYDA 1VLQA 3OH8A 1E2UA 1PSZA 1TL7C 1YR1A 3CZQA 3LKZA 3NHZA 5FAXA 1IIRA 5DCLA 3G6KA 4WKBA 2NACA 2NYVA 4CQMA 5TSDA 5CMLA 1T5BA 1H6AA 3GZJA 5E8JA 5ELLA 3U26A 2C03A 3WRVA 3WLJA 5M04A 3IAAA 4QUHA 3GDGA 1JTFA 4NV1A 3ZZNA 2N42A 3R0VA 4YECA 1LQ2A 3O75A 4BKPA 2GN9A 4ODIA 2OZVA 1PR6A 3KOWA 2XLBA 3O3NB 1GQQA 3EVAA 3KXPA 4G41A 3C45A 1B0AA 5HF6A 2IX3A 1GU1A 4N54A 5K05A 1U2DA 3CF4G 4NPAA 3KRTA 2FF7A 3NT2A 3PDIA 4UM5A 5IEJA 4HAUA 5CIQA 1IN4A 3KP1A 1SUSA 1QTIA 2OUIA 2O3QA 5HJ7A 3ZVKA 1NQWA 4KMOA 1K89A 2ZBEA 4IIBA 4X63A 3SF8A 2CEAA 2AX3A 2J5BA 3QZUA 2BN4A 4C04A 5B57C 3BERA 3Q1LA 4Q34A 1HDYA 3CXCB 4XD7A 2V03A 1PNQA 1RKUA 5EPUA 2B21A 3SJ7A 5IT0A 1UWCA 1WPRA 1X13A 1I6KA 5HIIA 3SLRA 4E03A 1AQYA 1TUIA 3EOBI 4JMLA 4OLHA 1WXFA 4MCHA 4GOMD 3VX4A 4NENA 5ALVA 1T3TA 4CI9A 4BXOB 1SBZA 3H5IA 3N2LA 1UAAA 1US8A 4P4NA 1OXTA 1V5FA 1G21E 1NDUA 3OJ0A 5TJ9A 3LPCA 4QLBA 3UOWA 3WL6A 5C8VA 3V8BA 2RH8A 5KOHB 5IP5A 1SMKA 3SQNA 1YGYA 3WWEA 2JFQA 3KTFA 1E9AA 4OQLA 4GGMX 1U1DA 3LBHA 3HEAA 4A03A 1G19A 2OBBA 3WOHA 1AK9A 3Q9SA 2EFGA 3S27A 2B1JA 4BV3A 1DG9A 3ZJ4A 1U7XA 1N57A 1VQOB 5G4KB 1ECCA 2DFKB 3BFVA 3WB2A 4RIGA 4XUDA 4UZUA 2BHSA 5FI0B 6GPBA 3M33A 4KQXA 2OSBA 5IPFA 1A9TA 2M6LA 4QG7A 5TY0A 2OZEA 2PJUA 3O9ZA 5T64A 4BVEA 3PA1A 3I8OA 1O95A 4J0CA 2YNMA 4JQZA 4NCHA 5DCYA 1TM7E 4P82A 1HZZC 1U8CB 3L93A 2QLTA 4IAOA 4IXTA 2VDKB 4OFZA 4E4YA 1E2FA 2OECA 1HTBA 2WIBA 2Y27A 4ZJPA 2GN1A 4MA0A 4WK0B 3GJ4A 3L6UA 2ECQA 4HQRA 4P4LA 2H65A 4NBWA 3UANA 1XHEA 4CHGA 2ZB8A 4RTMA 3MIZA 1CEEA 1BEZA 3DOJA 1WOPA 3VH2A 2MOKA 3I5MA 1XC7A 3RD5A 5EKDA 3WP1B 3FTQA 1GQOA 4OHCA 5FA8A 2DYKA 4E5VA 2HYIC 1CD5A 4ZO4A 4UUPA 2IHUA 3PFBA 3PGA1 1YR7A 2XUHA 1I94B 1Q0RA 3FCEA 4MWOA 3BK1A 4MWZA 4OP1A 1A8PA 4BO3A 4RTLA 3TLEA 3AWDA 3W8RA 1NUUA 1P29A 3EBPA 1SPXA 2G40A 2G28A 4AKIA 3BH0A 1E1LA 1QH8A 5F52A 4RZQA 1GN9A 1GZ5A 2P4UA 2Q9UA 1JHRA 1W30A 4P5PA 4AYWA 3HVRA 2PMWB 1QNFA 4MRPA 4UMFA 4JEUA 1ZHHA 2JEZA 2Q3JA 3RNLA 3I9NA 3WIOA 10MHA 1ULZA 2ZITA 3OBBA 9MHTA 2ZR7A 1U6IA 4JCOA 3WP0A 3O2QB 1OAAA 1K5PA 4W9RA 1HYGA 3UB4A 3THWA 4B3TB 5HFJA 5KI6A 1QPZA 1CHNA 2R97A 5IXSA 5DISB 1N2SA 4ENQA 4BO2A 2J09A 1RHQA 2ZXUA 4H1HA 3F78A 5IVKA 2ATIA 4G07A 1PHPA 4GX0A 4TSKA 1MC5A 3KT8A 4WZZA 3NANA 2DT8A 2GI4A 4YRGA 1YK1A 4EGJA 4X06A 2ZTSA 1UR5A 3S28A 4K9QA 2W6PA 3W7BA 3DZJA 1NVVQ 2CLCX 4B74A 5EEGA 3NKVA 2OZLA 3E0QA 2PU7A 2HDWA 3CZ4A 3DL7A 5DM2A 3VX3A 1PJ7A 3GGCA 2OD9A 3BXOA 3SF0A 1F8XA 3FFAA 5HQTA 1V16B 3KSUA 4CZ2A 4DMRA 1KPGA 4J29A 4M1SA 3FNBA 4OGGA 4MO2A 2RAPA 2QTMA 2GLTA 3MUNA 4J3FA 4N5MA 1PL6A 1F9AA 1IN1A 3CS3A 1YHYA 1GRQA 1OFTA 1L8AA 3LBNA 3VJKA 2CDNA 4B7AA 1EVIA 3NM4A 4LNAA 1B14A 1XCPA 3EQ9A 4YQYA 4PCUA 4HEJA 3AFIA 1Q22A 2G1JA 5KS2A 3MHPA 3AX6A 3PPWA 5DX1A 4PRKA 1U0NA 2R4QA 3BEDA 2O06A 2Y6VA 2W2QA 1YO6A 4FHCA 5BWNA 5EJ9A 1JHXA 2PQ6A 4NOJA 5E2BA 2XECA 3B6ZA 4OPOA 2HJRA 5DI3B 1TMKA 3ANLA 4KG7A 1KDOA 1QHXA 2GB4A 3K8ZA 1H2ZA 1F51E 4UHHA 3A35A 4EX7A 4J94A 3SZUA 1GU0A 3EA5A 4KZPA 1Z16A 1A8IA 1ZCZA 2FQQA 1VGRA 1TJ3A 3K70C 4TMYA 5KW9A 3N6VA 4JUIA 4EW3A 4YDHB 5A6SA 5K3SA 1YZQA 2GVDC 3H5TA 2PKEA 1L4EA 4ENWA 2YRWA 3GG2A 3ZR4B 3TINA 1XF9A 3M9WA 2XZLA 1RZUA 3T06B 1CE8B 3VR4D 2P0YA 4A2QA 4CL0A 2X86A 5IABA 4I9GA 4RQBA 1N2ZA 4RSMA 3OKFA 4FB5A 3M6FA 2X6RA 1SELA 2X9LA 4H4EA 3V32A 2IA5A 5EHXA 3U62A 2BT4A 2PS0A 4GIBA 4Y0NA 1YCGA 4GGOA 1CUXA 1RJ9A 5C35A 1NBMA 2HTFA 4YACA 3CN7A 3P2JA 1P72A 3FOZA 5FLYA 4GVPA 4MUBA 4V02A 4GU5A 4LPSA 3FMOB 3RBZA 3OD5A 3QKRB 2QTZA 1BXRA 3DDOA 2VXYA 2P5YA 4FJ1A 3E3AA 4V0NA 4Q03A 1OLOA 3W5AA 4Q9IA 3K70D 1USKA 2H7CA 3O74A 1PJLA 3K0AB 4BFSA 4LMAA 5IJXA 3E3OA 2WQ7A 1GCUA 3VU0A 1G2QA 2VDLB 1P9OA 2YRFA 3C97A 2BJVA 4UVEA 4H18A 1Z62A 4BE7B 1JLSA 4TYNA 1SUEA 3HV2A 2PSSA 4F12A 5KWSA 2A14A 2C9ZA 4TN1A 4GP9A 2DPYA 1KS9A 4E32A 1HE5A 2BRUC 2C1ZA 3C5CA 1AF4A 3EE6A 1H5UA 1NXWA 4MUIA 2R0QC 1T1EA 2AZMA 4JUFA 3EPHA 1PVOA 4X8IA 1EHIA 3MF4A 1ZM4A 4PHTA 4C0XA 2VT6A 4MQMA 1WUIS 1IK4A 1X3LA 3D6MA 3K4PA 3V2UA 2B2CA 3HHPA 4ZAXA 5K0ZA 2IC5A 2B5OA 2Z8ZA 4IFTA 5GMOA 4ROSA 2HLDA 2EF1A 4NCNA 1VLJA 4ITUA 3ED5A 4KZKA 2EEZA 2FFBA 1JE0A 1G3IA 1PSWA 4M1TA 1KQNA 1SBIA 2HMAA 1AQJA 1AD2A 2B1GA 1A8QA 2VVTA 2XV1A 3A2KA 3ER8A 4MYRA 1I2BA 1MMFB 4UPDA 3ROZA 2IGTA 5K8TA 3L7YA 5FWXB 4LXUA 4XMYA 1BE8A 3THSA 2DLCX 3NVKI 1XLTA 2RDMA 1W4CA 3TPZA 5CT4A 3TQOA 2PPVA 4HDKB 1YRHA 3T7TA 1TVKB 4B8YA 1QQ6A 1P4MA 1VECA 2VP5A 3NOVA 4TQ9A 2AVNA 4O08A 1HTTA 5DYNA 3GLGB 1QE0A 3U44A 2BY4A 3FUVA 3F8TA 4AJJA 4D99A 1FX1A 4D9EA 4CLEA 4P2NA 3SC3A 4U7HA 1BJTA 1QGOA 1J0AA 4GAEA 3WWDA 2HO4A 4DR2B 3Q15C 5LUAA 2GRUA 2VTKA 3W05A 4R40A 3RUFA 1CLUA 1B26A 2Q4OA 2IF0A 4XYGA 1E8MA 2IS6A 4BFYA 4TZKA 3GLVA 1H94A 1MNAA 3CBQA 3O6VA 4I1RA 4YRCA 3EFEA 5ECWA 4LTNA 1FRFS 2WLTA 2AFIB 2WSSA 4MR9B 4D6PA 2PX6A 5HIMA 1Y5LA 2MDTA 5DMHA 4ZT2A 4IYRA 1PG2A 2WAAA 1GZSA 4F3RA 1NT4A 4FR5A 3DMFA 5THXA 2R66A 3A11A 3C41J 1QK4A 1ZD2P 3PA8A 5EXXA 5CB6A 5JFOA 3K6SB 2JG3A 3S5JA 5C18A 4DPLA 4NECA 4MVXA 3L7LA 1KO1A 3PUNA 4ITVA 3VTFA 5JTTA 3T3HA 1HQKA 1CDZA 1Y1QA 2Q5CA 3L0BA 4O8ZA 3VR4H 4WCFC 4D45A 1RBZA 421PA 1CJVC 2Q0QA 3VO8A 2OP1A 4AM8A 3B9RA 5G02A 4S04A 1WW3A 5DXJA 3U39A 1VJDA 1FDOA 2OBFA 1WD5A 1SM4A 1IHXA 3DBRA 4FNGA 2DFNA 4RPJA 2HMWA 4R71A 1RLJA 3GT0A 3GEDA 5FPYA 4YBZA 3WLRA 3ZE6A 3EZGA 5K6AA 4BB9A 1J8FA 4Z2YA 1DAKA 4M55A 1QR2A 1CNMA 2RKWA 2W2LA 5EKXA 2WTMA 1EWVA 1GKUB 3OIUA 1ZOIA 3AOEA 1VKRA 1NYQA 2Z83A 1TRKA 3D8NA 4J76A 4TSFD 4CQNA 3RB8A 5B6IA 3LC1O 2BW0A 4YT5A 1JEYB 3D6UA 3N53A 3EASA 1L1EA 5E6TA 4YGYA 3L07A 1WVMA 3IP9A 4I8XA 4MWSA 5IJAA 3A9TA 3UENA 1PUIA 4KN6A 5FUBA 4JKOA 3IQEA 4ISBA 3WNDA 2J3JA 1WLSA 4FNAA 5HRAA 5F3DA 1NW5A 3DCYA 1KYYA 3EDRA 1QDUA 3GVJA 2AC2A 2YW2A 3B6MA 3HM2A 4OL9A 4ACAA 5FUYA 1JDZA 3L0CA 4LJLA 5H0IA 3T5CA 1DBRA 4OXNA 1VQ7B 2C82A 4K5QA 2H48A 5AHKA 1VLMA 5JWRA 1H2YA 3FW1A 4KIFA 3P0FA 3VHXA 5D85A 3TZBA 2Q45A 4WPGA 4DAOA 4Y2VA 3LLMA 5HRUA 3HZHA 3I2IA 4PC1A 1FFSA 4XKJA 2JB9A 3E5MA 3U4GA 4YR9A 1E2LA 3KBOA 4KQ2A 3GVPA 3D59A 2PT5A 2HU8A 3O4FA 3HRKA 1ZKDA 2GJKA 3WKEA 1A82A 3IPAA 1Z88A 2D1FA 4LF7B 5JYEA 5A4FS 4WY2A 3LUGA 5FPKA 4N12A 1C4KA 3E27A 1D09A 3PWTA 1DADA 5SICE 5GTDA 2CXHA 4HQFA 1XJQA 3OOHA 3UJ3X 3ZG6A 4MB2A 2REQA 3WK8A 4HDNA 4M49A 1SXJD 2C54A 2OCXA 3I04A 4IQFA 1X70A 1RLTA 1SIOA 1W5FA 1CPYA 2G80A 2AUNA 4K2AA 5HCUA 4BMDA 4WJKB 4NBRA 1R18A 1OIVA 2BMVA 3RVLA 1JUDA 3CM0A 2ZRAA 2BP7B 1FFCA 2G72A 4JQYA 1EVKA 4JLDA 4N47A 1KC1A 3QK7A 3UFXA 1SBQA 4EIWA 2GREA 2G3YA 5F12A 4BMYA 2VLIA 4XR9A 4DABA 5BV0A 3RBXA 1ETHA 3EGDA 4RKEA 2AL7A 4AKEA 2VPWA 4J3NA 7MHTA 1JA0A 3MEQA 1BN7A 3MWKA 3QKUA 4Q18A 1NZDA 1K7YA 1QIEA 2JJYA 4XQEA 3D9QX 3PFNA 3RVBA 1NI4A 3Q7PA 1J0CA 3WC4A 3KYCB 1ISHA 1CRQA 1R4MB 3D8RA 3MJTA 3PC8C 1G0OA 1OA0A 1EHCA 3SFVA 1FQOA 1J70A 2ZSIA 2ZS9A 2K4MA 1MFPA 2JLQA 2TMYA 2AUMA 1I8DA 4INPA 3SYLA 3W3AH 3LUDA 2GZDA 2Z2IA 4OOFA 3UAOA 4K0KB 2QD5A 3UJBA 5B58C 2F55A 2OV4A 2UV8A 4NLLA 1OVMA 5CAEB 1XELA 3WDMA 2APJA 3I1FA 1VXOA 4DOMA 4P7GA 4YR7A 2WIFA 2VJMB 2ETXA 2IKSA 3DP9A 2EJWA 3DF9A 4RKFA 2G9UA 3EN0A 1Z6TA 3ILHA 3DR5A 4KXVA 4MYDA 4RKWA 3FZNA 4QDZA 3PKJA 1FP2A 2HWKA 3C6XA 4M1QA 7REQA 3DKVA 4QUEA 4HTFB 1V5GA 2GYWA 2X5JO 3HI6A 4P83A 5AXCA 2PXAA 3ERCA 4URYR 1QHNA 4WH0A 3HKBB 1OBFO 3KBBA 4JGIA 5LWHA 4TTQA 1CZUA 1SC4A 2XODA 2X6QA 3H1TA 1XTUA 3L0OA 2Z6BD 1OKKD 2QP4A 2VP2A 4HAVA 3QYJA 4F2GA 3G05A 1BMFD 1SULA 2Q5EA 1M6EX 1VPLA 2HU7A 4X0EA 1MV5A 3BHJA 1MJHA 4MVJM 3DOUA 4EUEA 3K0EA 4IOLA 1XDDA 3PEVA 4ER6A 2X0JA 1D4FA 2XCLA 1JNYA 4J7XA 4OHBA 4EDHA 4X7FA 3VZSA 1QV7A 1ZIOA 3FGNA 5BN3B 1VE7A 2O23A 2XDYA 2WUEA 1LBHA 4KJXA 4M1WA 1M1YA 2Q3HA 5FD8A 3WNZA 2JIOA 2Z5VA 4JLBA 3WR5A 1O3YA 1FSGA 3OEEA 2BE9A 2DBRA 3IOCA 3FF1A 2F2TA 3BGOS 4HNRA 4NNPA 4E6EA 3OTQA 2C2MA 1P4HA 3FETA 5AOVA 3EVFA 3FOAA 1I4OA 4K9PA 4HQKA 4LY0A 4GKBA 3WGOA 1SQ5A 4GEGA 4W5NA 4L6CA 3IPLA 3ZJYA 3AR8A 3HCNA 3LX6A 3S1LA 2RONA 2NSHA 1VDMA 1VIMA 1JLHA 2VJDA 5GY7A 4CG1A 2X8AA 2HWYA 2G09A 4GR5A 1PW5A 1N1MA 4IZIA 3VPGA 4CLRA 2IZ7A 3MBIA 1VMKA 5LM3A 2IYLD 2ZIXA 2EGGA 4US0R 1ST2A 1ID1A 1TZBA 3ZZ1A 3EFOB 3H11B 3OEYA 4RESA 3T9CA 3ZTTA 1DBSA 3H1AA 4WXEA 2CXUA 3BKWA 3LQ2A 1XPRA 1MXHA 1T0JB 5B3JC 1T8SA 1VP9A 1XRPA 2W6QA 3IUSA 5TX7A 4WK6A 5J2TF 5E95A 3T6KA 4CL8A 4LYFA 2AH5A 4JUAA 4RM3A 1J6UA 1H1LB 3PHBE 2RHTA 2C1XA 2CKDA 3OZXA 4LY3A 2P78A 1Z22A 4Z54A 5A62A 4W9MC 3KR9A 2P6NA 5JANA 2DQYA 1YVPA 3L41A 1RYEA 3EY9A 3Q0TA 1IXYA 2NVWA 2QSZA 2VAVA 2P67A 5CBKA 4WXPA 1T91A 4D82A 4PZDA 4RHYA 4MVJG 1P6XA 5BYBA 4LHYA 2WYIA 5U9CA 1PFUA 1LRLA 1S1MA 3D7RA 2C7BA 3RQIA 5BVHA 3BMQA 5D6NA 5B7PA 3EEIA 1E63A 2V4MA 2ZYSA 1KDVA 3TQSA 4YPOA 3X1DA 3GXBA 1G8MA 3ROPA 3E8SA 5JS7A 3FY4A 4HRXA 4I36A 2EIHA 5TQJA 1XBTA 2DX7A 2PAFA 3AEKA 4C01A 3VNRA 3W8NA 3HMQA 4HNVA 2G67A 5HK9A 3BH7A 3L1KA 1YI2B 1QVAA 1FJHA 1GLGA 5JI2E 1J1ZA 1D04A 1T9BA 5F98A 2FN7A 1GL3A 4AJ9A 3QH4A 3DEZA 4G8DA 1LU9A 4I9NA 5CT5A 4F72A 3KM0A 1ZH4A 2XCIA 3CCCA 3E1KA 2OFXA 2QLNA 4PO9A 3S8EA 1PEKE 1ZZGA 4RTRA 2PD3A 4J0IA 4TRJA 4H1WA 1TYZA 3TZQA 4OO3A 5BSVA 4NDZA 1ECLA 3X1XA 1HSOA 3KPWA 3B1KA 6ABPA 1CF2O 3SHWA 1F8UA 3GN2A 3D2BA 5GAJA 1AO3A 1CIVA 2PKXA 2QYHA 3GXOA 3KOUA 3N8GA 1JA1A 1Y8RB 4IL5A 1SIUA 3I1JA 4MKGA 4P2BA 1BJRE 1J7KA 4IV8A 1A9YA 5DTJA 3ZWMA 4DLAA 2G0TA 4GRIA 3B9PA 5EP4A 4PQYA 3U60B 2CCKA 3DMGA 1G6HA 4XWOA 4GXQA 1QHGA 1U81A 1VE6A 4J75A 3EVDA 1N3IA 3Q38A 3CZCA 1XAJA 2FWMX 2JFXA 2NU7A 1NFRA 2W2KB 3RS5A 1Z36A 4MI1A 1FX0B 3LT5A 4PLPA 4IY1A 1IM8A 4MQFB 4N41A 4ZARA 3KYDB 5KOIA 3SLKA 2ZTUA 4OBXA 2ANBA 4XJSA 5F2KA 1RXWA 4OHPA 2QJTA 3CXUA 1BQEA 1LPOA 1Z2AA 5GM1A 5BXYA 5FTKA 2XMRA 5HGXA 4QV2A 1N08A 1B0UA 2NVBA 4ENVA 1PV4A 1ZJ5A 2XNDA 2CVZA 1CY4A 5I9LA 3O4RA 3PHGA 4HC4A 1Z38A 3TKLA 1DTWA 1ZXLA 1Q6YA 5JCJD 1TLTA 2WVHA 5AM5A 2J41A 2XXJA 2JC3A 2ZW9A 4KPUA 4PO1A 2CLLB 3UMBA 2CV1A 4PZYA 4J0FA 5A5GA 1X7GA 2VJAA 3O8NA 4DRYA 3AR3A 1RW4A 4FYYA 2VSXA 2AQIA 3SU8A 1WX1A 1AK1A 4WFQA 4CLHA 4IDPA 5ADHA 5IBQA 4KPYA 1I4WA 3E7PA 4DCNA 3RVSA 2C31A 2B8NA 3BH6A 1HA3A 3GFBA 4QUDA 1E9DA 3P9RA 1R4ZA 3VDNB 4IEFB 5T8KA 5THQA 1KZ6A 2HXSA 3UJ7A 4M2LA 1OBOA 4IR7A 4CF5A 4CMKA 1CCWA 3ZDXB 1KDPA 2IHTA 2D4HA 2QTCA 3C5EA 2FPSA 5KAPA 3VM6A 1JI3A 3FWPA 2VH1A 1QTNA 2BFCA 5CFZA 1N7IA 4HDSA 4ML3A 3UBMA 4C0HA 4AFNA 2XZOA 3GRFA 3OQOA 3DVLA 4PLGA 3FNEA 2GT1A 3BN3A 4FZRA 3BXFA 3VPCA 3FNGA 5BQFA 1BKSB 2PD4A 4GLBA 3OW7A 5AI5A 4AY5A 2PZAA 3EPKA 4RY0A 4YDRA 3NHWA 1QYWA 4PSVA 1ESZA 4F6RA 1ECJA 5IT4A 2E1BA 3JYHA 3G0OA 2EW1A 5KDDA 3THXA 3LHKA 2HF7A 4XIJA 1FP4B 2RJOA 4EF4A 4BATA 2CC2A 4JOQA 1ESMA 1R0WA 3I6IA 4FOLA 4K9RA 3UJPA 4ARBA 2I1QA 4NXMB 2YFYA 4JN6B 2AJLI 2VP6A 2MJLA 4QJ5A 1ZJZA 2Y1DA 1D2EA 2QQEA 4BNMA 3INTA 5BWLA 1FXWA 4AQDA 4BB6A 4RANA 2XCSB 1P0QA 4O1HA 1KRWA 3G23A 2COEA 4MUJA 2GLUA 5H3LA 2AN9A 3HB7A 1LPMA 3L7DA 2G77B 1XZHA 2II6A 2R8ZA 3F2IA 4G0XA 4LMBA 3VR1A 4TM8A 3C0KA 3DC2A 4FYPA 1KU6A 2W2XA 1AN9A 2E4YA 1GL9B 4LJ9A 3RUEA 3OETA 3V4OA 2BEJA 3NHLA 2MTBA 1ZVJA 5AKKA 1RBQA 5KDOA 2AG0A 4AN1A 2ZYUX 3JWHA 1U63A 4J03A 3CCLB 3MLAA 4UNQA 3ZOKA 4DLYA 1SBTA 3PHHA 3CVUA 4G24A 3A1EA 3MSCA 2PZLA 1JMVA 4LSZA 5HCNA 3ZHXA 2Q1SA 3KNZA 4BB5A 2XYQA 2UUBB 1L6RA 2ZT5A 1YSCA 1R8XA 5G41A 5KYYA 3VUFA 1Y5RA 5ED4A 4EY5A 3IA7A 3MOGA 4UD6A 1QX3A 1J0XO 1KDTA 5AHWA 3H19A 1H0RA 3F6EX 5C1BA 5JTUA 1SOMA 1XLVA 1NLYA 4XJVA 5E1DA 3TAUA 2EV9A 3X1YA 1SHJA 4BBPA 4IDBA 4KPEC 1OXUA 3HYRA 3LL7A 3SHOA 1WULS 3WK5A 2G9QA 3CCRB 4YJFA 1NVTA 3LPNA 2RAFA 5J4KA 1EDBA 3E9RA 4KN9S 2Q5HA 2VDQB 3UNXA 4BFZA 1W5EA 4DZTA 5LP6B 1WXIA 2I55A 1QIDA 5C1IA 3P9IA 4Q3KA 1DFIA 4L4RA 4M38A 1H2HA 2RFLA 1N7GA 3CPXA 3M4ZA 3CR7A 1NW9B 4LYHA 4DKJA 1FQJA 2DY1A 4KKTA 1N9KA 2DC1A 2WHQA 4IRMA 1DJNA 3GJXC 1N2CA 5TQ0B 4AF8A 1F6DA 2BUBA 2XJ4A 4F97A 4X0CA 1CB7A 4FTWA 4I81A 5LA6B 3B60A 3PR2B 1PZGA 4TS3A 2IWHA 1CRZA