1IJEA

Nucleotide exchange intermediates in the eef1a-eef1ba complex
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
438
structure length
438
Chain Sequence
b'EKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords elongation factor 1-alpha
publication title Crystal structures of nucleotide exchange intermediates in the eEF1A-eEF1Balpha complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 127
structure length 438
sequence length 438
ec nomenclature
pdb deposition date 2001-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ijeA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ijeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ijeA01
1XMJA 3N2EA 1XXHA 1S3GA 2VZLA 2XTNA 1QG4A 1Z22A 3CPHA 4IFBA 1VQMB 1SXJC 4OQXA 5EP1A 4CEHB 2B8TA 5CK5A 1DTSA 2F1HA 2YOFA 3DM5A 2EIXA 3GLFB 5AWFC 5HCNA 1RKBA 2QG6A 4L5BA 1F2UA 2AWOA 1YR9A 3FMOB 3Q9LA 3R7WA 1GRRA 4M4SA 2IS4A 1ZP6A 3DEFA 3B8HA 3K70C 3MWKA 4JL5A 1G9XA 1JAIA 2IW3A 2H8KA 5E95A 3W6PA 1NVUQ 2G0NA 3LV8A 4W5JA 3OAAD 1GL6A 3SJAA 2BVNA 3K0FB 1D2NA 4MDFA 2BBWA 3THWA 1S2MA 1G3IA 2X8AA 4KFSA 1FNNA 1RE0A 1X1RA 4OYHA 5KYKA 3ZBTA 2R6DA 1A4RA 4BPRA 1U2RA 5BXQC 2MSCB 5K8LA 2OILA 3HU2A 4ZI3A 3AVVA 1Q22A 2AD5A 3QUSA 3TQFA 3UKDA 3QG1A 3ZIAD 1MH1A 1Q12A 1XU4A 3R20A 3CCRB 4LHZA 3I8XA 4NU0A 3PUYA 1UBGA 4JZKA 2RKOA 3A8TA 2QE7D 4TL7A 2OV2A 5FTJA 4PC2A 5HTKA 4G5OA 1W87A 1E6CA 3CLVA 3SFVA 1XJQA 3FKQA 4CGZA 1UEIA 4MKFA 1NL3A 2JJ2A 4ILEA 1RRPA 4HB0A 4P31A 1Z83A 2BEJA 4EH1A 1E9EA 5EXSA 1ZM7A 4A4DA 4P33A 4LC0A 2BBSA 2O0HA 2QMHA 121PA 3FJOA 2JIZA 1TL7C 3IIKA 3PVSA 5IRCD 2NMVA 2EFGA 3UIEA 1VTKA 4FMBB 5EXTA 4DUGD 3ZVNA 2XNJA 1N6NA 3U7HB 4PAOA 1Z07A 4DVGA 2H7VA 3AVTA 3AB3A 1H65A 3GFTA 1I2MA 2VSFA 3CW2A 2C96A 3G5UA 4DLXA 3U3JA 3TGPA 1ANKA 5JJIA 4B74A 1CP2A 3QE0A 5DNYB 2WJIA 1GNQA 3MSXA 2WWYA 1Y63A 3GLGA 4RFSB 3NDBB 3TMKA 4A8JC 5AUNB 1GR1A 3FTQA 1DAGA 1NJGA 3FB4A 4TL6A 3VMFA 4LBWA 4UXIA 4XJXA 1K8AD 3SYKA 3TK1A 2GVZC 3LNCA 5JI3E 1XFAA 1DG1G 5LPNA 4PGOA 3OZUA 3ZGXA 1TEVA 1M90D 2D74A 1NG9A 3GLIA 4NCIA 3L8YA 2H16A 5HPYB 3WNCA 5CIWA 4LHYA 1OXVA 4TSFD 4B3BA 2J59A 2QA5A 1EWQA 3NBFA 2VP6A 2ECKA 3RAPR 1NI3A 3ZZ0A 5DE3A 4U00A 1FDRA 5B58C 3R8FA 2GHIA 1ZU4A 3QPUA 4OHWA 3CNOA 3LXRA 2PX3A 2VNKA 3GJ5A 4MUBA 4P4UA 1UDXA 1T91A 3P26A 1V43A 1P75A 4E03A 1QVGB 1DADA 4QBGB 2D2FA 4QKQA 5EE5B 3LH5A 2VF7A 1AGPA 5FR2A 3SEAA 1P2UA 3VKGA 1AZSC 3B1WA 1KNXA 2CXXA 1Z28A 4B32A 4PX9A 1KDTA 3PEVA 3AH8A 4WOPA 3U2QA 1J70A 4NYIQ 4BFSA 1BMFA 2QMOA 4OJQA 2BEKA 5THXA 2JJ2D 3CRMA 2ZANA 1P7CA 4QNMA 1FPMA 4URYR 3U3KA 1YJNB 3EC1A 3MG9A 1D5CA 1ZUNB 1RZ3A 3GJ7A 3P1JA 5G40A 3K0AB 2GKSA 4NMMA 2IWHA 3K9LA 1N5JA 4CYMA 4M1SA 4JLNA 3AVUA 1T5IA 4L4UA 1LW7A 2GXSA 1Q1BA 4PZZA 5L3SB 4BUJA 2CJWA 4IVQA 1EFRA 4JS0A 1FMJA 1G1MA 5CYPA 4YAOA 3QF4B 2W2XA 4PC6A 3KJHA 3QPWA 3ZC3A 1YZLA 5AJZA 1QG2A 2BWJA 3AF4A 4JMPA 5DYIA 4K8OA 3FMPB 1KDPA 1KI6A 1ONBA 1QHNA 4DC9A 1GRQA 3BE4A 1NBMA 2QTHA 4DLRA 4X8OA 2AD1A 1I4TD 4BFUA 4ITRC 3U60B 1GWNA 3MJHA 2NPIA 3VR5A 4A9AA 4Y0AA 2YNMA 5H68A 1YR7A 3EXAA 1U8AA 5E7MA 1AQYA 2NO9A 1E62A 4KYUA 4LZZA 4J0QA 4A6PA 2WSMA 4QGAA 3U7GA 2DWPA 1QVRA 1KZGB 2ZRFA 4E09A 2O5VA 2P0EA 1KSHA 1OXSC 3ES9A 4H1UA 3RYTC 2DEUA 1ZIOA 3CF0A 2SHKA 4R2IA 2OUKA 4LV5B 4RD4A 1QFYA 5H1YA 1M8PA 2NPFA 3K9HA 1GVNB 4JBWA 2LKCA 3CCLB 3GEHA 1M1KD 1RRGA 1W2HA 3NDPA 3QVUA 4KVAA 4QBHA 5FOXA 4OI2A 4AYWA 4CT4B 5GVRA 2QMUA 5LBIA 4B3GA 1R2QA 4ZDIA 2F7SA 4JL8A 1NP6A 5EP3A 4F7DA 5CITA 2RGAA 3P27A 1E9FA 3FFBA 4HATA 4B3FX 4DCSA 4BRUA 3SYNA 3TRFA 4HDCA 1G64A 3TAHA 1IXSB 4Q1BA 4RKEA 3RRYA 1FW6A 1NMYA 2ZRCA 2C9YA 4KJZA 4LV8B 2QSYA 1P4SA 4Q03A 4CIDA 4IXMA 3F3YA 2GJKA 3IILA 521PA 2VNHA 5C46F 1XEXB 1Z3IX 4LDJA 2R44A 1OJLA 1OYWA 5EE9A 3W5HA 3UMRA 3W90A 1G20E 1Z6YA 4LSGA 3G82C 4C4PA 1ELOA 2VNJA 2C9OA 3K9GA 2XZLA 3QBVA 1AM4D 4W5WA 3FHOA 4KITB 1W5SA 5AR1A 1TPZA 3PEUA 1ZM3A 3KDSE 4C7OA 4LUCA 2QN6A 3C7KA 3W8NA 5JSZA 2YOGA 1DO2A 1GFIA 1KO4A 4PANA 2WKPA 4HUQB 4WXRA 4US2R 1XP8A 2OSBA 3DZ8A 3U3MA 5TXGA 1MRNA 4DCVA 2ZJ8A 2BMWA 5AK0A 4AI6A 1OV4A 1W4BA 1DAEA 1AS3A 5FTLA 1D9XA 1JAHA 5E3HA 3TSZA 4YMUA 4W7SA 2HYDA 1SKYE 1DOAA 2IYVA 2VEDA 1P73A 4PQYA 2V4ZA 4OHYA 2AWNA 1Z47A 2CLSA 2OFWA 3SJCA 4YAUA 1ESMA 3EW9A 1QHXA 2BMEA 3CMEB 3M6AA 5BN5A 3A1SA 2W6ID 3LO8A 3QKUA 4BEBA 2RHMA 4LY6A 4DCTA 3CWZA 4AYTA 2R6FA 5J40A 2XTZA 4OBEA 2YWFA 2GZAA 1IXZA 1G41A 4HB4A 4OHXA 4KLNA 1R5BA 3BAFA 3W5UA 3FE2A 4Q1DA 1XTJA 2OM2A 4NP6A 2O8EA 2FH5B 4QBIA 1HURA 2KSQA 1K6MA 2NZJA 3RRZA 2OT3B 2HF8A 1SXJD 1WA5A 2W2TA 3U6KA 4OQNA 1YRBA 4LGMA 4DEYA 5FBRB 1II0A 2CK3A 1ZCAA 4XVUA 1EK0A 1ZM4A 3O8RA 3UXMA 1P2VA 3EIQA 1Z0DA 1AKEA 1E1QD 1TF5A 2OCPA 2QQ0A 3W6NA 4C2TA 4OI0A 3CXCB 3IEUA 4LJ8A 5FPYA 1KYIA 4Z54A 1R4AA 2CLDX 1Z08A 2ZE5A 4D0GA 5B57C 3K70D 3QI2A 4Q1AA 1Z63A 1VQ5B 1EP2B 4Q02A 4TQ9A 4TYQA 3T5GA 2ZI3A 1NJID 3WY9A 1VKJA 3Q5EA 1S1CA 2EFHB 3LAWA 4URUR 2O52A 3C4JA 1K9MD 2YYZA 4YDSA 3OZXA 1T3LA 1X6VA 2GK6A 2PMKA 2Z4SA 1G3UA 2FMXA 1XTQA 2HJGA 3IBYA 3CZPA 3QEJA 2NIPA 4M21A 1QUFA 2REXB 1LVGA 2XNDD 2QT1A 3EARA 3V76A 1GG2A 4B4DA 3E2IA 1E96A 1FNBA 5FTKA 3C15C 2OHFA 1FTSA 1SXJB 2OBMA 1DAFA 4TLAA 3I61A 2CE7A 2J46A 4LYFA 2J0UA 2P67A 3M0EA 2UKDA 1TADA 1H42A 1VCOA 5KNDA 1FX0A 3DMDA 3K1JA 4FW9A 4A82A 3LDAA 4CEJA 1XD2B 4URZR 4V0NA 1GRNA 4DCUA 3PUZA 3QIAA 4KLZA 3CPWB 3B9PA 3GLGE 3QG5A 3WHKA 4ZIRB 1TF2A 1YZTA 2GA8A 2ZYUX 4V03A 4Q9LA 1E99A 4JJZA 3KKQA 3T1QA 4OHZA 1KDRA 1Q3HA 3ND9A 3X1XA 2Z43A 4P4SB 2N42A 3THXB 4FMCB 4TMWA 5J47A 1AIPA 1CJUC 4P0TA 2C04A 1FQJA 1XPRA 4XVRA 3UANA 1H8HD 2ZJ5A 3I56B 3I73A 3RS5A 5FPTA 5C4MA 2JCSA 2FZ4A 3NKVA 4PHHA 3LW8A 4DSTA 4WA7A 3OZVA 2IXFA 2JGNA 4ZGQB 4A92A 2WPDA 3BD9A 4HB2A 1XPOA 3T61A 2WJGA 2IXGA 3BH6A 3B1ZA 3W5VA 1MO5A 4YC7A 4A0HA 4CW7A 1MABA 1TF7A 4LJ5A 2WJJA 2ZYTX 2F3RA 1UBEA 4KYIB 2ZE8A 4Q4HB 4D6PA 3EPLA 1KNQA 1JA0A 4H9GA 2ODEA 2QAGA 1E98A 3JZMA 4HAVA 3S1AB 4BFVA 4ZCIA 2VSOA 2X19A 1I7PA 1E2EA 3QFTA 1LNZA 4GOJA 4JT2A 4B2LA 3U7FB 4G5RA 1DE0A 1YZKA 5F98A 3RRMA 2ZRMA 4V0MA 3KUDA 2C9CA 3KQKA 4NYMR 1BYUA 1E4VA 3I55B 2W83A 1TEXA 2XNSA 4RD2A 2Q9CA 4O3MA 1HUQA 2AK2A 1VYVA 1Z0KA 4AKGA 4LHXA 2ANCA 2ZJAA 4LJ7A 5KHOC 2IEYA 2Q9BA 1G18A 4L16A 4AG6A 1OIXA 5JHHB 1CR0A 1IHUA 1G8HA 1L4YA 2WSSA 1F6BA 4Q1EA 3B13B 2EFCB 1L2TA 3BS4A 4Q21A 2CHGA 4Q4AA 1KC8D 2KBFA 1CKEA 1D2EA 4IRUB 1KKLA 3X1ZA 4TYYA 1G7TA 3IQWA 4UJ5A 1KK2A 2LKDA 4DIEA 4CEIB 2BCJQ 1V5WA 1GITA 1HT2E 4GT1A 2GXAA 2ZIAA 5K8UA 1VCMA 1OLOA 1XEFA 4AIIA 4CRWB 5AJYA 3WMFA 4DWJA 1QHIA 2PL3A 2ZROA 2GCNA 1W2GA 1QZXA 4C0HA 4ZCMA 3CM0A 2BMDA 2QP9X 1M7HA 1YZNA 4O2RA 4BWYA 1RW4A 4M2LA 3ONWA 1UBFA 1RJ9A 5EE1A 1E79D 2CBZA 4TMXA 1E2KA 4NH0A 3B60A 1QHHA 4MITA 2BHRA 1JI0A 3L2OB 1AS2A 1Z2CA 4ARZB 4G3XA 4A0FA 5JCPA 2ZJYA 2JDID 3LVBA 3HP1A 1MT0A 1N8RD 2PT5A 2ZVQX 3P4YA 1Q21A 3Q7PA 4G01B 5KNCA 5GJBA 3AVWA 1COWA 1OFIA 2OLKA 1F2TB 4EJSA 5HKKA 4I1VA 4URXR 2VP4A 1SXJE 4Q01A 4D4MA 1TUIA 3RS0A 2VYQA 4EFMA 3C8UA 2D3WA 2JASA 3BJIC 1H8EA 2FG5A 3AUYA 2GK7A 1E0SA 1KY3A 4MGZR 2XXAB 4EPXA 5EJEA 2PBRA 1UADA 1EP3B 1ZNZA 5FTNA 2J7PA 1GUAA 3ASZA 2L0XA 4YXWA 3PUXA 3OEED 2QY9A 4FMCF 5FPSA 1ZMXA 2WKQA 2IC5A 2P6NA 4MGYR 3SBEA 1T5LA 5DI3A 4EIWA 3O8BA 3ADCA 4B33A 1DVRA 2V6JA 2YHSA 3EZ9A 3MUFA 1KI3A 4DLWA 4LBVA 4BFWA 2VSXA 5IK2D 1NKSA 2XOKA 1Z6GA 1W0KD 1IBRA 3KQNA 2DFKB 1PLJA 3OE7A 4QGFA 5JS8A 2J0VA 1W7AA 2RC6A 1KAOA 3SFZA 5L3QA 5FOWA 4HYYA 2A2ZA 4I1UA 4BFTA 4DDTA 4B73A 2WOJA 4WZAE 3QY0A 4EPYA 3I5YA 3ZLJA 3CCUB 1DG3A 3CIOA 4RZXA 1RRFA 3G71B 2D7CA 2QROA 3OEHD 4CEHA 4IDOA 1O3YA 4LJ9A 5EUQB 4M9SA 4PPGA 1NY6A 3JVVA 3GLFA 1FQKA 4GPTA 3UG7A 1JB1A 2RGBA 1UAAA 1RYFA 1F5NA 4OQMA 1OSNA 4V0KA 3U7EB 3GEIA 2V7QD 4XWAA 4QFMA 1IOZA 2O8FB 4HZUB 1W44A 2IHBA 1NG1A 1XEWX 3IQXA 4GZLA 3I8SA 1R6BX 3K0FA 1NLFA 4C43A 3QFSA 4M1WA 1XEWY 3FWYA 3VO2A 3T35A 3CF2A 1F60A 4X8LA 3K0CA 5CLQA 3EWAA 2ZI7A 2R65A 1ZNXA 2ZSDA 3P32A 4QJ3A 1RFLA 4KAXA 3TIFA 2WM9B 2VHUA 4ACAA 4DCNA 2EU8A 5GV8A 3Q72A 1TMKA 3GJ4A 1W36C 5HCIA 2B92A 1EWYA 2ZAMA 2KBEA 3TSOA 2PJRA 3CCJB 4LHVA 5FTMA 1ZD8A 3CX6A 1XD8A 2G77B 2N1BA 1E2MA 2QA4B 3HJNA 1G7RA 1KI1A 5EUMA 5KSYA 5LD2B 1WRBA 4A15A 3CR7A 4EAQA 5FL3A 2RMKA 1KI2A 3TVDA 5DYGA 1XMIA 4DBLC 1NRJB 3L82B 4D2IA 3SHFA 4MYUA 3VR6A 3EZ2A 1JQLB 2GJSA 3THYB 1WB9A 1LF0A 4GNKA 3BFXA 2RH5A 4FN5A 3EASA 2AKAB 1Z2AA 1YVDA 2QDXA 2EFEB 2ZR7A 2BM1A 4F38A 3LD9A 4NYJR 3OJWA 2IK8A 2QUZA 4YMVA 4WQMA 5FBQB 4AYXA 5UKDA 721PA 1E2NA 1NKTA 1MOZA 2GF9A 2C98A 3LQQA 1YRAA 5FA6A 2J1LA 5K8TA 2Z83A 1XTRA 4RFSA 5D3QA 1W49A 2CCGA 1GTVA 4CZ2A 2G9NA 4GZMA 3BB3A 1GKUB 1S0UA 1R8SA 5EXPA 5HE9A 3RLFA 3ZDQA 3ADBA 4QC2A 5ELXA 3ZS9A 4M22A 5KUTA 3GFPA 4HDQB 1Q1QA 2W0MA 1Y3AA 1EP1B 1EX7A 1XZPA 4TL9A 4LHWA 2GJ9A 3E5HA 2OFOA 3QJYA 2HYIC 1QH0A 1JXOA 3CNLA 2CVFA 2P3SA 3U6BA 3P4XA 4G1UC 1XDBA 1QGZA 2R9VA 4EPTA 1DEKA 1W47A 4OKSA 3KX2A 1J2JA 3LA6A 5KTYA 4BLPA 3B7GA 2AFHE 4FCWA 821PA 4M9ZA 2IS2A 1OKKA 2E1RA 2OCAA 1FNDA 1JR6A 1N6HA 1E4YA 2CCJA 3HR8A 1A7JA 2ZJ2A 1G17A 3EPHA 1P9WA 4JLAA 4EKDA 2V1XA 2QNRA 5TVKA 1XPUA 2OAQ1 2GF0A 1KMHB 1FOEB 2H57A 3A4LA 1N0WA 2DETA 4KFUA 4RD6A 4PHFA 1HT1E 3RABA 3EX7C 4TTRA 3VQTA 4BQSA 2JLZA 2C03A 2WICA 1GAJA 2KJQA 2KWIA 4UQOA 3PJRA 3ADDA 1F20A 2CHVA 2IXEA 4NBSA 3HR7A 2BKUA 2ZUDA 1Z0FA 3RC3A 1VQ6B 1KDOA 1AK2A 2H17A 1JXMA 4S35A 3B78A 3CKLA 5CB8A 4JKYA 4V0ME 2PZGA 1KAGA 4B43A 1G3QA 1GNRA 1US8B 2JAQA 3K0AA 2AL7A 1IXRC 1AGRA 1YIJB 2DFTA 3PQCA 1IQPA 3T5DA 3WBKA 3B85A 3KKNA 1M6NA 2F1IA 1VQ4B 2QTZA 4DB2A 3LBHA 2OG2A 5F9FA 3QF4A 3DO6A 1AJEA 6Q21A 4IW3B 1NNEA 2GWHA 3GEEA 2VA8A 1PUJA 3KZ1E 1R10A 4YHBA 1G6OA 1E2PA 2BMFA 1T8TA 2OK7A 4YAWA 1W0JA 3FVQA 4FIDA 4TTQA 1TQDA 2XSZA 4IOKA 4WZ6A 1JA1A 1CJMA 1VG8A 3KUCA 4TYNA 4DLSA 1Q7YD 4Q9KA 1DAKA 5A5GA 3H4MA 4AWXA 1NN5A 3AUXA 3VR3A 2F43A 3GJ8A 3PITA 5KDLA 1GM5A 1G5TA 2EWWA 2WMOB 1FL9A 2RHDA 3A58B 1HQYE 1CEEA 4L8GA 3KKPA 1RPZA 1SULA 3AVQA 4XWKA 3CCSB 3SN6A 1CU1A 3B6EA 1CRPA 2GTPA 2ZREA 2QBYB 5JWHA 1J90A 1VG1A 3LX5A 5K8IA 3KXLA 4S2EA 2VHTA 2H18A 3B1XA 2IS6A 3FMIA 4B48A 3SHWA 1L8QA 2CE2X 3NH9A 5E7JA 4DB4A 4IOMA 4MH0R 2RGGA 2FPLA 3A1UA 1KO1A 1TU3A 4A0RA 4BZXA 4Z1MA 3QF7A 4QGHA 4ABYA 2V9PA 1WP9A 2IYTA 4II7A 1Q86D 2CNWA 3FKSA 3AVYA 2VLIA 2DERA 2JLWA 1K5GA 3IUYA 1XXHB 4JVNA 3MWYW 2F1RA 1ZD1A 1XEXA 2V3CC 2NO0A 3ZQ6A 2OXCA 3UATA 1GL7A 1JJ2B 1M2OB 1SKYB 5DHFA 2UZ3A 3SYLA 2RB4A 1NIPA 2BDTA 1XTKA 4ASUA 2XZPA 1Q0UA 2ZE7A 4F4JA 1U9IA 2HCBA 4AF6A 1WXQA 2QORA 4RSGA 3EZ7A 2DFLA 1GVHA 2ZSAA 4AG5A 1F2UB 2QTLA 2IYXA 2O0KA 1TTTA 4I4LA 3NHAA 3FOZA 1P61B 3LVQE 4D80A 5EQTA 1E1RA 2G3YA 3KFXA 3JQRA 3VKWA 4B2PA 1U99A 1GKIA 4MYCA 5IHPA 3SQXA 2JIZD 2ZUCA 4KXFB 1NY5A 3DOFA 1QHSA 1RIFA 4N0EA 4BFYA 2HT6A 2J0SA 3THWB 1J8MF 1N2CE 1VQNB 3CD6B 5H8WA 3A36A 5DISB 3TSWA 4CVNA 4PC1A 2QTFA 1S9HA 2IEZA 5AJVB 4TLBA 4QM6A 2IYWA 1W4AA 3L0SA 4TZ0A 1N6OA 2ZM5A 3QOFA 1EFCA 1FTNA 3CRVA 1LY1A 4DZZA 4GRAA 1AN0A 4HEJA 1G21E 4NCHA 3U3OA 3VR2A 1OF1A 2GPJA 2IF2A 2VP5A 3UG6A 1A5TA 3W9YA 1DDGA 4XIGS 3KJIA 5EE0A 2ZE6A 3O8DA 5J4YA 3L0PA 4YMWA 2ERYA 1VCIA 5J5CA 1A2KC 3A1TA 1NLYA 2YC4C 5KPDA 1XMSA 2YWEA 2A5DA 1CXZA 1ODFA 3AP2A 4RCZA 2F1JA 2NG1A 3NIBA 1A8PA 2QAGC 1P5ZB 1CS4C 3CPJB 5BQ5A 5FBLB 3R9XA 2OTLB 4YALA 1XB2A 3IPYA 5CM9C 3I62A 2C78A 2ZUBA 5IT5A 2OBLA 1XTIA 4GSYA 1MO6A 3NG1A 4FD2A 3HPQA 2WAXA 1ESNA 1OIWA 1ZRHA 5DIFA 3RSLA 3SU8A 3DOEA 3TR0A 3RSOA 1GOTA 1N6KA 2F9LA 4M1OA 2QM8A 3RRNA 4E22A 1SVLA 2IUTA 4V0LA 3DDCA 1KI9A 2CDNA 5D3MB 4L9SA 1XWIA 5B30A 4FMDB 2DPXA 1Q57A 3E1SA 1S96A 4IDQA 3ICQB 3AKDA 1DAHA 4D4LA 5JHGB 3GLGB 1XJ0A 1W2BB 3UK6A 1EWRA 4JT4A 4W5HA 1EESA 4KVGA 5B64A 1SVWA 5JRJA 4A6XA 1I2DA 1ZC3A 1BMFD 4A0GA 2Q3FA 5EP2A 4AD8A 1PUIA 4PZLA 1YZGA 4ZDJA 3U5ZB 2FU5C 2QI9C 1ZU5A 3AVOA 3EIEA 1KSJA 2REOA 1W36D 4JIMA 1FUKA 1CJKC 2DCUA 1CF4A 1S8FA 1GO2A 3RWMB 5LB2A 1OB5A 3EAQA 4GI7A 1LFDB 3NEYA 2G1JA 4JSTA 4MKGA 3ZQJA 1JR3A 1XZQA 1KJZA 1W35A 5KSWB 1UKZA 1G16A 3SI7A 4DDWA 2ZXUA 3RNLA 3ZS8A 1EFRD 2PZEA 1XD2A 2VF8A 4WVFA 4LBZA 1QF9A 2A7QA 2QENA 3NBZC 1TU4A 2XZOA 1SVOA 2QP3A 4D0NA 4ZIRA 3GLHA 3LBNA 8OHMA 5TB5A 2QEXB 2CL0X 3IHLA 2ZS9A 2VP2A 3UWOA 3U4QA 2BN4A 1NBMD 2BM0A 3IEVA 1XXHE 1NMZA 2P6UA 1GIAA 1RVDA 2W00A 2ZYWX 4B3CA 4DSUA 4EJSC 2IT1A 3K8YA 2ZRJA 5TR9A 4FCVA 4OK5A 1P6XA 1ZM9A 1G8YA 3WYFA 4XWOA 3MLEA 1IJEA 4Y9UA 1Z0IA 1BS1A 1U8ZA 1KO5A 2HEIA 2O8DA 3A4NA 3L0IB 1VDZA 1W36B 4BE7B 1IN4A 1Q3TA 2EYUA 3LFUA 2FEMA 2O8BA 2LCFA 1S1MA 3R9WA 2FGJA 5SZKB 3VFDA 2WJHA 1JALA 1WBBA 1KSGA 3QE2A 2B8WA 1YKSA 3CB4A 2O0JA 1LS1A 3TW4A 4AY2A 3AGQA 3J81k 2ZRAA 2OCYC 3KJEA 3EPJA 1UMKA 4LK2A 4Q4HA 1II8B 4DEXA 3S1AA 2D06A 2QSZA 4JLOA 1NIJA 4TLEA 2XNCA 3B82A 1MV5A 4LJAA 1KI6B 5EE3A 1GL9B 4TLDA 1E9DA 1DO0A 3CWQA 1CJTC 1Q20A 1UEJA 3SDZA 4EPVA 5KU1A 2JA1A 4G1BA 4IXNA 3R8CA 4DRZA 4Z51A 2WWFA 4Z8YA 2A5FA 1VQ9B 1XD9A 2E9SA 4BASA 2OE2A 1T3HA 1SM4A 1IONA 4QL3A 3ZZTA 1T6NA 4KFRA 1DDIA 4I1OA 2ZETA 4Q7LA 2QRZA 4JVMA 2ZI5A 5G3ZA 5J4LA 1R5OA 3BFKA 3W6OA 4Q48A 1M34E 2IS1A 3PR1A 3VX4A 3LW7A 1S3SA 3OW2B 2IX3A 3EA0A 1N5IA 1JR3D 3MJRA 3O8CA 3K09A 3NTUA 3AQ4A 1G5RA 3DVLA 1W5TA 2E87A 2AHOA 2VP9A 4Q7KA 4UNQA 1RRCA 4KBGA 2VP0A 3ZVMA 1U81A 1G4UR 2F9MA 3V4RA 1P60A 1Z0AA 3SZRA 2JLXA 3AF1A 2GAAA 4TT3A 4JVSB 3PXGA 4MRRA 3QFRA 1CTQA 1F48A 4FMDF 3GJXC 3QKSA 3QNUA 3K0CC 1KIMA 4RD3A 3KFVA 1KI4A 4IVRA 1HE8B 3VKHA 2WV9A 2K5UA 5AN9A 2NQ2C 1XJCA 1TUEA 1KKMA 1NN1A 1ZD9A 5FOTA 4BLOA 3K70B 5EZ5A 4LC1A 1A2BA 1UKEA 3W2FA 3FHTA 4ESVA 4ARZA 4W9MC 4FI3C 3CRZA 2HLDA 3VU9A 1OE0A 4Q4JB 3V00A 1WF3A 5JEEA 2XJ9A 1ZUHA 3KXKA 2HT1A 3GLIE 3B1VA 1XCGB 3QXSA 4UKDA 3I5XA 5JWOA 1CQXA 1ZNYA 3ZYCA 5JSZB 5FBWB 5KSOA 2GVDC 2GJ8A 2EYQA 4B44A 1OFTA 5EMNA 3FGNA 2JJ8A 3KKMA 1UDWA 1ZVQA 4MYHA 2CK3D 2GCOA 4DJTA 3IHWA 3RANA 4EQ6B 4KI0A 4RY2A 3QXCA 4QJ5A 4Q1FA 621PA 4ON9A 4P3YA 1E94E 1JEDA 3PIRA 1N6LA 1G3RA 2YC2C 4KV9A 1R0WA 2WVJA 3X2SA 4POAA 4WW0A 5BYKA 1E9RA 2QTVB 1CIPA 5L8VA 2P6RA 3THOA 1IN6A 1F3OA 1X86B 1LF5A 4URWR 4GDFA 5F3WB 1GJRA 3EIHA 3CX8A 2QM7A 4GBMA 1NDHA 1SKQA 2GILA 3AKCA 1R0XA 1FP6A 1U8YA 2ZI6A 2JLYA 3KQHA 2PEZA 3BC1A 4ZO4A 5H5JA 1GKYA 3BFVA 3H84A 5TDHA 5JLJA 4B76A 4MYTA 1SVMA 2IL1A 4HAXA 1DARA 4TN1A 2H5EA 4XTCS 3CH4B 3D8BA 3EG5A 5FR1A 2ATXA 5KDDA 3CC4B 4ERNA 3AV0B 2ZI4A 3HDTA 2OZEA 4WIAA 1Z06A 4ZPXA 2R6HA 1NSTA 2EVWX 1HV8A 5TMPA 2YZ2A 1P2SA 1VCNA 2NO7A 4EFLA 1NBME 2O8FA 4HZUA 5CIQA 4MA4A 1A82A 3M4YA 2W6JA 1VIAA 1XTSA 4IDPA 3F8TA 1E64A 4R98A 1CNEA 1VECA 3CC7B 1ZCBA 5CDFA 3KQLA 3T1TA 4D25A 4U7DA 2MMCA 2OO7A 4MGIR 3NWJA 4ACBA 4NYMQ 2GDJA 2HLDD 3GJ0A 4D26A 2A5JA 3MGCA 4TMKA 5AUQA 3H86A 3CZQA 1NVVR 2ERXA 1KJWA 2VIIA 4PHGA 1ZW6A 4PO1A 4QGGA 2ZRBA 1DPFA 3RS2A 5J4VA 4G5QA 2VL7A 3FYHA 3U61B 3SQWA 2AXNA 4JSYA 2JEOA 3VR1A 3GP8A 5GJWC 1Q1EA 4IJMA 5BW8A 2GESA 2YVUA 5KO2A 1UFQA 3OHMA 1FNCA 1E9CA 3BRWD 2WPDD 3DL0A 4N1AA 4TQUS 5KSZA 3RWOA 2FGKA 1N3BA 3MWLA 4MRPA 2QGZA 3U44B 2J0UB 3OIYA 1N5KA 4M1TA 4PC3A 2CRVA 2FF7A 4NKRA 2IYYA 2VRWA 3CC2B 1TX4B 5FBVB 4MGKR 2FSFA 1KJYA 2PCLA 1Z29A 3QKRA 4C9BA 3VNUA 3K0EA 2GQFA 2J87A 3BIFA 3I4LA 4MUAA 2C5LA 4AKIA 1SZPA 2CEAA 4FXPA 2YKGA 4CF7A 2BGIA 2VQSA 3K0SA 4JLMA 5FFMA 2C95A 1VQ7B 2A5GA 1VYTA 2JJ1A 4DHEA 1S9DA 3PUVA 3WMEA 2PMDA 4PR0A 4IDHA 4MQBA 1PV4A 2C8VA 2RGXA 4AC9A 5KSPA 3WXMA 1UJ2A 4QHTA 1P9RA 3CBQA 1JR3E 1CR2A 1DBSA 2OCBA 2Q6TA 5E4FA 4BLTA 4IEIA 2FE4A 2W58A 4MRNA 3W5IA 4U9UA 3NC1C 4PSVA 1II9A 1YJ5A 5DN6A 4BFZA 3T1VA 3TR5A 4PPQA 2WSSD 2J41A 4PSKA 4C30A 3W3ZB 5HZHA 3EPKA 2LWIA 2EWVA 3KJGA 2IYQA 1TQ2A 1TAGA 2ZSEA 3BERA 3GLHE 1GZSA 1C9KA 3D6TB 3P20A 4E5UA 1TQ6A 1MABB 2GCPA 1FP7A 3CRRA 1UKYA 4N0DA 1OHHA 5JEDA 3TUIC 4AURA 2QAGB 2B5OA 4IHQA 2NTYC 1QHGA 4GMXA 4OK6A 3RDPA 3QBTA 1FMLA 3VO1A 3I72A 2WJVA 4PPNA 2Y8EA 4N3GA 2N46A 4LYJA 3VHLB 4ZV4A 1S4QA 5HZKA 3L43A 2JLVA 3VNVA 1TNDA 1X3SA 2Q3MA 4DT1B 3WP1B 2YINC 1G291 4B47A 4NONA 2NZ8A 3CONA 4IDNA 2XB2A 1MO3A 5CJPA 2PT7A 2BC9A 2QL6A 1KOFA 1D9ZA 1SQ5A 1NF3A 1U9IC 1L4UA 3SOPA 3GCGA 1KMHA 1COWD 3HPRA 3A1WA 1W48A 5HKKD 1JJVA 5JMTA 1VG9B 4Q4AB 5ANRB 5BN4A 4RZ2A 1Q81D 2FZLA 1P2TA 1BIFA 2KI5A 1H8ED 3B1YA 5KOYA 4MRSA 1E0AA 4C0AC 1LV7A 2FSGA 2W2VA 2XEXA 2DBYA 4DXAA 1J8YF 1OT3A 2BSAA 1Z6AA 2J7PD 4KBFA 5CYOA 1US8A 4YXWD 2ZRPA 3E70C 4IFEA 5LDDC 4EDHA 1XMVA 4RZUA 4IEEA 5HR5A 4YAFA 1U0JA 2XOKD 4U5XA 3EA5A 2I1QA 1OGIA 1PZNA 2ORWA 4YONB 3PEYA 2HV8A 1QHHB 1OXUA 2R62A 3OE7D 4MKIA 2XJ4A 3OAAA 4PHTA 3LQRA 5TV2A 4O2LA 4HZIA 1IN5A 3PCRB 3T34A 4M53A 1VQOB 2VYFA 2HJVA 3PG5A 2V1UA 1O87A 3IIJA 2QPOA 4Q9HA 2IBMA 4EJSB 3W8RA 1GP2A 1IY2A 1KSFX 2ZEJA 3LRPA 3TNFA 1X8JA 3LY5A 2R8RA 4RJLA 2BKEA 4LYHA 5IDVA 3ZIAA 3W2EA 2V6IA 4DDUA 2QE7A 2B7CA 3EC2A 4GMDA 4GP7A 1PLKA 4HLUA 5DHAA 1N25A 2O8CB 2PIAA 4UJ3A 4HDOB 3AP1A 1T8UA 1D8TA 5DI3B 4K46A 4M1YA 1M7GA 2GZDA 2GXQA 2BGJA 3D31A 3CRW1 4KSCA 1TVCA 3LO5A 2HMAA 2A9KA 1JECA 4NYJQ 3B5JA 3OIWA 3OIVA 4ZKEA 2P2LA 3ZVRA 1R7RA 1QRAA 3A4MA 4Y7CA 2V54A 3ND8A 3QSYA 2MSDB 1FRNA 4Q18A 2W0SA 4DUGA 3AEZA 4BECA 4F93B 4QRHA 2FN4A 3GJ6A 2UVQA 2G1KA 1BOFA 3G6EB 3PFIA 1W1WA 2ZRHA 4P4TA 4QXAA 1UKVY 4LX0A 3C14C 3BB1A 2MSEB 2OLJA 4XH9B 3O47A 1LTQA 1OGJA 2FJUA 3F0TA 2GXUA 1ZYUA 3TUZC 4L9WA 3KXIA 1EG7A 2VHJA 4G0NA 3BWDD 2D2EA 2X2FA 5JRZA 1XCMA 3A37A 1T0JB 1JBKA 2ATVA 1KGDA 1XRJA 1ETUA 3AF2A 4PO9A 3CMAB 5FL7A 3FPAA 4B34A 4DLYA 3ICEA 2DWQA 3T06B 1SHKA 1E2HA 4HLCA 2QRNA 4HAWA 3VAAA 3N70A 3KL4A 1FFHA 2A30A 4CDGA 2ZVPX 221PA 2ZJOA 3TLXA 2ONJA 1E2FA 2FPKA 3TVTA 4R71A 2GEDA 4QM7A 4TSFA 4YLGA 1XF9A 5TARA 4R9UC 2ODBA 4XVQA 4B6FA 2IYZA 3G4SB 2X77A 1E9BA 4AKEA 5JFGA 2VNIA 5L3SA 3E20A 2WWXA 1KD1D 1XBTA 2CNDA 1DAIA 2ZTSA 3KKOA 2ODNA 1G5PA 2I4IA 1OXTA 2VTKA 2FFQA 1CRQA 4UXJA 3IPXA 4JLBA 1R0YA 2QT0A 1JPNA 4DLVA 1RC8A 4FCTA 4Q7MB 1G7CA 5AUPB 2PJZA 4AK9A 5BWMA 2BIFA 1J9ZA 2IF0A 2R6GA 2WWHA 3I92A 1SVIA 2PLFA 2JLSA 2RGNA 2GBLA 2WKRA 3PENA 3MCAA 5FPHA 1KO7A 5CDFE 5JZVA 1T9HA 1HA3A 3SC3A 4D4JA 1CLUA 2QEQA 3W34A 1AQUA 2JLRA 2ZRKA 4LPKA 2F55A 3RS7A 1CNFA 1B0UA 3FPKA 4QJ4A 1BX0A 1C4OA 4KO8A 1QGAA 1MKYA 2HXSA 4LJYA 1N0UA 1HE1C 1KI8A 1SVKA 1WCV1 4LOAA 2Z4RA 5CJ2A 1XNJA 4RCYA 1QVAA 2HDNB 3BOSA 4HAZA 4UNRA 2ZRGA 4E07A 1NSFA 4PO8A 5GJCA 4BFXA 1IN8A 4PQRA 3TJZA 1OKKD 4PQFA 3REFA 1K73D 4PFSA 2IYRA 4X8MA 2VBCA 2P65A 5D3MA 1WBDA 1Q82D 1BYIA 3PEWA 3CCEB 4EFNA 3KTAB 3CCQB 2ORIA 3UWKA 4OQFA 3K09C 1OFHA 3LX8A 3HU1A 4B3DA 1QBKC 2IYLD 2C77A 3N5CA 2WMNB 2YOHA 3R9IA 5M04A 3WNDA 2WWGA 2AN9A 1MR3F 4M1MA 5FL7D 1VPLA 3U4QB 1KK0A 1E32A 1YJWB 2CL7X 3DM9B 1NN0A 1VQ8B 1Z6TA 2BPOA 4NYIR 3JQQA 4ZGNB 3CRQA 1R0ZA 3AVXA 3IBGA 2DFNA 5DLQC 1NVXQ 3HWSA 2PLRA 4B3XA 4Q5IA 3H2YA 4TYPA 4G5GA 4MRVA 3AP3A 4IOLA 1ZNWA 3OIUA 3R7WB 1SGWA 4P6VF 2WIBA 1MO4A 1YHNA 4NPHA 2Z0MA 2WTUA 4HUQA 1YZUA 3AKYA 4WAUA 1W0JD 5JJLA 1G7SA 2XSZD 3SR0A 3ZVLA 1KHTA 4GP6A 2A5YB 5L3RA 5A4JA 1GAQA 2BCGY 5FOVA 4A2PA 1IB0A 1EFTA 2G88A 5CM8B 4NCNA 1HTWA 4OJKA 4DSNA 1Z0JA 1YHQB 1FZQA 1VHTA 4HE6A 2FX3A 2BMJA 3OESA 4LRWA 3GLFE 1CR4A 1M1YE 4B71A 3FHCB 2CCKA 1J99A 5GADl 4A2WA 2JLUA 5H59A 2TMKA 4QHYA 3OFNA 5H70A 2G6BA 2AK3A 1B23P 1E9AA 2Z6VA 2ZS8A 3U3RA 1JQJC 3DPUA 4I81A 2YWGA 3IDQA 3GPLA 4JLDA 2WHXA 1AZTA 4JVLA 2C99A 3BGWA 1II8A 2AR7A 3WYGA 2GJAA 3H1TA 3CCMB 3SNHA 2AXPA 1E2QA 4Z1MD 2NOAA 4ZDKA 1TLLA 5JBQA 5FPKA 3ADKA 1KQSB 1YI2B 1XX6A 5SZJA 4H1VA 4P32A 5DGXA 5FOUA 2IYSA 4FK8A 5B2ZA 2P5TB 2RGDA 5KDOA 2CNWD 3FKSD 4NDZA 1IM2A 1CULC 3GFOA 4HB3A 2FEOA 2F43B 4UAJA 2CLCX 2A3RA 4NZYA 3QENA 3ZD6A 2ZJBA 1P72A 1UPTA 3SJBA 2AFIE 1Q44A 3I32A 4O0MA 1EXMA 4G5SA 2AKYA 3B9QA 1D2MA 2W6IA 2J5XA 4XOIA 2EFDB 2D4HA 4ASUD 4LCBA 3WBJA 1OH8A 2PCJA 1EX6A 1OH6A 2EW1A 2F6RA 2XAUA 1N5LA 4JLKA 3WMGA 2YV5A 4BPBA 4DQLA 4G1VA 2QU8A 3CCVB 3W2IA 5GV7A 1E1RD 4F4CA 1W4CA 3FMFA 2ZR9A 4OI4A 4K81B 1E69A 2OTJB 2GZHA 4JKIA 4Z8XA 5G3YA 3GLIB 3ECCA 4O25A 4RVCA 1SXJA 1FRQA 4C0QC 3QVVA 3GJ3A 3MMPA 1CBUA 1EGAA 2QAJA 1JEEA 1OPXA 2FA9A 3IO5A 4C0LA 421PA 1KK3A 2QPAA 1E1QA 4BEJA 2BJVA 4EUNA 3VR4A 4Q9JA 4NL4H 5AJWA 3X1YA 1WE2A 4PC7A 1JPJA 3MRSA 4B2IA 3JZAA 3BB4A 2RCNA 3X1DA 4R2HA 2PZFA 4C3ZA 1DAMA 1Z6XA 3MD0A 4Q4LA 2WWWA 3LBIA 2WJYA 3NBYC 2ZRNA 2NO6A 2AX4A 4P4SA 4F4IA 3NH6A 3THXA 4Q4JA 2D62A 3OFND 3IGFA 4OQLA 3CPEA 3D3QA 4LWZA 5LD2C 4PAQA 5A0FA 3V9PA 5SZIA 2ANBA 1P9NA 2HUPA 1YR6A 4LPSA 3C41J 4OK3A 1GSIA 1W4RA 5C1BA 4M9XA 2XNDA 4BLQA 1MRSA 2ZRIA 5JECA 5KNBA 1U0LA 4ZI2A 1HYQA 1N6PA 3K53A 5KPJA 1U0HC 4EQ6A 1N6IA 5F9HA 1YR8A 5C4GB 4DLUA 3BH7A 5CLLA 2ZJZA 2G83A 2BOVA 4A1FA 2CJWB 1OH7A 1KO8A 3LXXA 1I4DD 5HXBA 4DSOA 2R6CA 2ZRDA 3ETLA 4M9QA 3HU3A 1JNYA 1KMQA 1H85A 3CNNA 5JJKA 1OB2A 1OYYA 2BBOA 2FPMA 5JWRA 2ZRLA 4NTZA 2ODWA 1PJRA 1JJ7A 1G6HA 4RD1A 2OXRA 1FUUA 2OBNA 2ZQ5A 1NMXA 2VHQA 4PPFA 1H8HA 1HY3A 2P5SA 1VQKB 2DWOA 1ZBDA 1ZC4A 3OF5A 4JL6A 4KODA 4RKFA 3PV0A 3RS4A 3UMSA 1WDTA 1QFZA 3BK7A 4Y0VA 3SS8A 1OW3B 3SBDA 4GOKA 5GVSA 3V4FA 1E2LA 4KSBA 4A8JA 3ZZUA 1E2IA 3VHXA 5C18A 2XGJA 4GL2A 3TQCA 4QHSA 4NCJA 4CEIA 1IY1A 4D81A 4LYAA 2I3BA 2H92A 4FINA 3ZH9B 1ZIPA 4RFVA 1SHZA 1T3SA 1PVOA 4ZKDA 3AM1A 3W2HA 4KHZA 2FSHA 4Q66C 3IKJA 5FUXA 1QDEA 1YZQA 2FDCA 1TQ4A 1J7KA 2BV3A 3I3SR 2OFXA 3RC8A 1GILA 4KCGA 1HH4A 3HYTA 3HYRA 5JI2E 3REGA 3CR8A 2B21A 1QGYA 4XD7A 2DR3A 4PSAA 3T15A 1E0KA 4PAMA 3DKPA 4HE5A 4TTPA 3BH0A 4US0R 4GFDA 3U44A 2YWHA 1VQPB 1SVSA 1NN3A 5FOSA 1QUEA 1F2TA 4Y9RA 1M74A 1U98A 1XE1A 4C7OB 3T1OA 4TYWA 2RAPA 2FWRA 1X8KA 2FFHA 3QXXA 4BGDA 1YU9A 5FH9A 2RGCA 2XXAA 1K5DA 4NCKA 2WIAA 5P21A 3W3AA 5BN3A 3RHFA 5G41A 3TH5A 3GLHB 4BRWA 4TZ6A 4EPWA 2WOOA 4EPRA 2I1VB 4JYCA 2BF4A 1C1YA 2BJWA 1GNPA 1KI7A 2QMEA 2YJTD 3IO3A 2OEPA 3F5FA 4TLCA 3DZDA 3CUEF 1NJFA 2BBTA 4BLSA 2EQBA 4A2QA 4DLTA 1E79A 4DIDA 4WBSA 3MAAC 1R8QA 2O8DB 1E3MA 4K1XA 3W2GA 1P62B 1Q1ZA 3FFAA 3T12A 2CMKA 5G53C 2HXYA 3TW8B 3UMFA 2JDIA 4Q19A 4HLUC 2QQEA 1OXXK 2R2AA 4QBFA 2ZU6A 4Q47A 5EP4A 2IYUA 5EZ6B 2O8BB 3CH5A 3TKLA 1HEIA 5HE8A 4D4KA 3CO5A 2V55B 4TWZA 4FWTA 1BKDR 4KFTA 2ZR0A 1NLZA 2O8EB 4LI0A 3JVUA 4TT3D 1E2GA 1G4AE 2RC5A 2XB4A 1R5NA 3TUJC 3I1FA 1BJKA 4OI1A 4Q9IA 3QPVA 4TMZA 2ZYVX 1AA9A 2FNAA 3OEEA 2JATA 5LB4A 5FI0B 5GJVC 2HCJB 4V0OA 3ZJYA 4DT1A 3B2EA 2XX3A 1E2DA 1YJ9B 3QFCA 4UNNA 5TY0A 5IK2A 2IUSA 3TE6A 1W0KA 2ZAOA 4XD7D 3NEJA 1IN7A 1BH2A 1U94A 1KRHA 4Q7JB 1CJVC 5FUWA 1G8GA 4TQAA 1E9SA 1UF9A 4AF7A 3NC0C 4TL8A 3WNBA 1BQEA 1ZJ6A 1JB9A 4LV6A 4US1R 3TBKA 1QG0A 3KB1A 1D1NA 2QZ4A 5BYJA 1OH5A 3CF6R 1PLLA 2ASEA 2KB0A 3QEOA 3NVAA 1D6JA 2HF9A 3OEHA 3WRYC 1QX4A 4TMTA 1G3MA 1BO6A 3WHLA 3QKSB 4PZYA 4U02A 4D0LB 3A6PC 4A36A 5J4HA 4HSEA 3SE0A 1HQCA 1X8LA 1FX0B 3DKVA 5FUYA 3EZFA 4LJ6A 1W34A 2GNOA 4CEJB 3E1YE 1N6RA 4C2UA 4OHVA 5JCZA 3LWNA 1KTVA 2CHQA 2V7QA 2IHYA 3QXJA 3Q7QA 2J45A 2QGNA 2ONKA 2GAOA 3C5CA 2CVHA 4D82A 2WZQA 1NVVQ 4RZ3A 3THYA 3ZD7A 2DY1A 3EZ6A 5DH9A 4DQKA 3MFYA 3VU9B 4LBYA 2VO1A 4HI0E 4B35A 2RGNC 2GBLC 3BBPA 3G0HA 3AGPA 1Z8FA 1DS6A 3GD7A 2IWRA 5CB6A 2ZU0C 4ESHA 4C0BA 3BORA 1VG0B 3M1IA 3RS3A 4F7WA 1WMSA 1VHLA 3BXZA 1UBCA 2A78A 4TMVA 1AMOA 1IJFA 3EWSA 1G8PA 3WRXC 3H0KA 4ZDWA 2J9RA 3UPUA 5FUVA 1FNMA 3N2IA 4IVPA 1RYHA 1T0HB 4HUTA 5AJXA 1YQTA 3NBXX 3GMTA 1VQLB 2GCOB 2D7DA 4GOXA 2O8CA 4FWIB 2XTMA 2JLQA 1S72B 4C0SA 5AUOB 2R6AA 1G19A 2ZSFA 3CX7A 2Q9AA 1XCPA 3Q8XB 1UM8A 3LLMA 3L8ZA 4I99A 4XSHA 5CK4A 4F92B 4JLVA 3OZWA 2W6JD 4NHOA 4HLDA 2OESA 3DHWC 2DYKA 3DMNA 2ZS7A 4LJ4A 2DB3A 1B2RA 4XTRA 4B6EA 3KB2A 4RD0A 4Q00A 4MDEA 4QOSA 1CR1A 3LVRE 1E63A 4X8HA 1QHYA 1QFJA 3ZBUA 1OIVA 2VHCA 3JQPA 3Q3JB 5SZHB 1VYUA 4JLJA 2WBLC 2MMGA 4CT5A 4I1SA 2XITA 1ZUIA 3ASYA 2ZPTX 1KZ7B 4YQFA 2GEVA 2VPPA 1K8RA 2H1LA 2PEYA 3OJXA 1DELA 2B7BA 1GDDA 3IIMA 5J4KA 4MKHA 1NVWQ 1U90A 5FI1B 4C0JA 3L0OA 3WP0A 4AKHA 4Q1CA 2PH1A 4QNRA 1KY2A 4V02A 4F91B 5DO9A 2Q3HA 4JJKA 4IKEA 4JBYA 1G8FA 3GQBA 3WYAA 2RGEA 4JYBA 4R7ZA 3QKTA 3Q5DA 1P3JA 3A1VA 4YMTA 4PTLA 5L3VA 3SJZA 3MHPA 2WWIA 5DSZA 2F3TA 3RVBA 2IUUA 4YDHB 5C2JB 4HLQB 1VMAA 4DKXA 3AF0A 2QPTA 3QQ5A 4OL0A 2Q21A 2ZITA 4M1KA 2ZSBA 1GAWA 1LS6A 2JJ1D 2FOLA 3QXHA 4WXPA 4A8JB 1EFHA 3VX3A 1KK1A 1EFUA 2X3UA 2VH5R 3MWJA 4N3NA 2J3EA 1IAQA 2J0QA 2X2EA 4C0KA 1IY0A 4URVR 1RJ9B 1WQ1R 1Z5ZA 3C16C 4DDVA 4WZBE 2PX0A 1X1SA 2X1VA 2Q0HA 2DHRA 1LB1B 3X1WA 1N0VC 2UZIR 5DN6D 5IF9A 2FV8A 1BX1A 4KU4A 3AKEA 5F2EA 2KE5A 4HAYA 4IOJA 2NO1A 2REBA 4UNSA 4JBXA 2GRJA 3AVPA 4M8NE 2FFAA 3QKRB 3VTKA 1OHHD 3Q85A 4M0LA 3AF3A 3C5HA 3K9NA 1M7BA 1ZM2A 2QBYA 3PUWA 4QG7A 4YMSA 1L7VC 2ORVA 1W46A 1YE8A 3W5JA 4UXHA 3NHBA 4HAUA 2Z5FA 2J7KA 2FSIA 1E2JA 3D7MA 1I4LD 4UNPA 3TAUA 1VIYA 3KQUA 4BLRA 3NXSA 2V8OA 1A1VA 1ZAKA 1AS0A 2G0TA 3FDIA 4NE2A 2OK8A 2B6HA 2GETA 1ZINA 2IA5A 2ZI9A 2C2HA 5JS7A 4XSGA 1YITB 2WAYA 4L15A 2CL6X 1E0JA 3LLUA 2GEUA 2NGRA 4PXAA 1QVFB 3KTAA 4ZCLA 5E7IA 5L3QB 4BZQA 1OFUX 5EXXA 4JLPA 4DLZA 2OAP1 1T4GA 4BZPA 5DI9A 2FFBA 1AKYA 2QP4A 4B75A
chains in the Genus database with same CATH superfamily
1XMJA 4HMOA 4XLFA 4JP3A 3LUHA 1AE1A 4L4XA 5EJ2A 1V3TA 3DAGA 4IEFB 4UM9B 5HQ3A 3LCUA 3D02A 3ZNQA 5E1DA 1EZZA 5EYPA 4JI6B 4IQFA 1VQMB 4K6HA 3PQ4A 3WLJA 5BQFA 4OQXA 4P3NA 5EPOA 5LDGA 4BFLA 4CEHB 1JQ5A 2WQZA 1FTWA 1DTSA 3NTQA 1P18A 1AY0A 4RF5A 4CLHA 1W6RA 3ZWQA 3DM5A 4GXNA 1FP1D 1KMIY 5AWFC 2B4AA 2FRVA 4GQBA 2QG6A 4IFTA 2WUDA 4IXTA 4TTJA 4EX6A 1H66A 1YR9A 1QIGA 3R7WA 3OQ6A 2GD1O 2JFUA 4EUNA 3K70C 3I5UA 1CUSA 2IW3A 5E95A 1RQPA 5IS2A 1UQRA 3SJUA 1Y1TA 1XAGA 3LV8A 1PGQA 2OPHA 2BVNA 3EXIA 1XE3A 4DNXA 1K2VN 5BT8A 4E21A 1I2AA 2YN4A 4LXTA 2X8AA 3THWA 1FNNA 4OYHA 3V8NA 3OF2A 1BDHA 5KW9A 3IUEA 3KETA 2XBMA 2R6DA 3WGGA 1U2RA 3GVLA 3WLPA 5BN4B 3IRUA 5IEBA 1LDBA 5DHRA 5K8LA 1Q95A 3AVVA 3ZE8A 1FUEA 2L18A 3SCZA 4RJTA 4ZI3A 2LIPA 1Q22A 1R9NA 4GF5A 2DHDA 2H31A 4FHGA 3HU5A 3QG1A 1NJSA 1GKLA 1Q12A 1XU4A 1GL3A 4JBHA 4LHZA 3RFVA 1NQWA 1J8QA 1B43A 4CL8A 1BJTA 4F5EA 3EDYA 5KTPA 3TLMA 1UBGA 4AROA 2PYZA 4H6XA 2G07A 1FQWA 2Z98A 4FYJA 2DUJA 5IJ0B 4RSRA 2WHQA 1EQUA 5FTJA 4PC2A 2PRSA 4G5OA 1SWVA 1W19A 3O5AA 2I76A 4GQIA 1C9JA 3CLVA 4P54A 1KERA 1XJQA 3ST7A 3TW6A 1UEIA 2CYBA 2I22A 1NDQA 3IAS1 5E1BA 1P0QA 3ENWA 1U7HA 1E9EA 3DWIA 4A4DA 5U4XA 2BHNA 5HWSA 4TKMA 4YWHA 3C3PA 3ZWCA 121PA 2JIZA 3A4IA 3IIKA 3IMKA 4NQRA 4RADA 4QDXA 5CA0A 2EFGA 4MV0A 3UIEA 3A9UA 3R0JA 3G8CA 4O4IF 4DUGD 1RM3A 1QK5A 2XVXA 5ESDA 2XNJA 1N6NA 3H42B 4PAOA 3K5WA 4YRDA 3U3DA 1OY1A 2H7VA 2YV3A 3BL5A 4BJ5A 5JZBA 1KEPA 5ILQA 4HVAA 5LR6A 3I2FA 3CW2A 1TCUA 4LTNA 4BDTA 1PK8A 4XB6B 4HEHA 3DH0A 3UYLA 5JJIA 4K9RA 3CU5A 2CBXA 5B53A 3ZCPA 2R1TB 3A1DA 2OAGA 4U63A 1Y63A 2V9CA 4XVHA 3U48A 3NDBB 5TMEA 1U1CA 1DCFA 1KYXA 3TMKA 2VUSA 1GR1A 1DHTA 3QHAA 1ICEA 1BE0A 3M4ZA 4UQPA 1T9GS 2ESRA 4XJXA 2GYWA 3OMWA 1K8AD 1OI2A 2GVZC 3LNCA 4W7IA 5L51A 2QYHA 4PGOA 3DTTA 3F78A 3UB4A 2XMPA 5BRJA 5JS6A 5B3LA 2PXCA 4Q3CA 4INOA 3T95A 3L6CA 3DONA 4NCIA 2QL5A 2AZDA 5DOVA 1YB6A 1VHEA 2H16A 4L51A 5HPYB 3EZNA 4DV4B 4XARA 3R5FA 4TSFD 3KKLA 2AMVA 4B3BA 2CW5A 3IUNA 2CMHA 2H5JA 2HSEA 3NBFA 2VP6A 3RRBA 4XR9A 2A1UA 1NYTA 3T7JA 1F0NA 5I8WA 4CKCA 3E27A 3DXZA 4G86A 2OZVA 1K4YA 4OHWA 1ZU4A 4U2CA 3LXRA 1Z5NA 4S1TA 3SIPA 2DTEA 3SC6A 5K45A 1D5WA 1NASA 1P75A 3D2AA 1FXWA 3M1YA 2D2FA 3CVYA 3UW3A 1E0AA 2UZ1B 4HV4A 4NLLA 3IRVA 5CPBA 1AGPA 2IIVA 4YJ2F 1P2UA 2WG2A 5LZ7A 5EVJA 3CGWA 3PC8C 4Y2PA 1KNXA 1L5LA 4BQOA 5ICEA 2NU6B 4PX9A 4Z99A 4RPDA 4QOFA 5EESA 1TAUA 3A05A 3U2QA 1A72A 1A5SB 1DL5A 1SUEA 5DWVA 1D2AA 2JJ2D 3D8TA 3T5BA 1T1SA 1FXUA 3GR6A 2P77A 1NF8A 4G9EA 2HK8A 1PS8A 1IEXA 4URYR 1PFQA 1V37A 4LRQA 4EELA 3ZHRA 3BA1A 5G40A 1Z4NA 1Q7RA 3EZXA 3K9LA 1DJOA 1JSRA 2CVOA 2OA0A 1T5IA 4MV4A 2SKDA 1LW7A 4W5TA 2GXSA 3GELA 1F4VA 1MJGM 2B2CA 4I4CA 3OWHA 1EFRA 4JS0A 2JHPA 2BHTA 3CQ9A 4BB5A 2ZQYA 5A7FA 4PC6A 3WA7A 1YZLA 3ZHXA 3LYLA 2B82A 3AF4A 4OQZA 5HF8A 5DTEA 5D85A 4JMPA 2JFFA 3FMPB 3ZKWA 4AZ3B 4HQOA 4B40A 4DC9A 1GRQA 4MKXA 4TVSA 3D4BA 2QTHA 2HPAA 2Q9UA 3DAHA 3VHQA 1ISHA 3A6LA 5JYCA 2JVKA 3KQPA 3ZEIA 4ITRC 1GWNA 2OB1A 2SKCA 3N8DA 1GPUA 3FYUA 4TGLA 2LRHA 2NSHA 2VUTA 4ZU6X 1YR7A 1G0NA 3EXAA 4MVJI 5E7MA 2B30A 4E0BA 4Z2AA 4HYEA 3U7GA 4J0QA 2VWHA 2WSMA 4PZ9A 4QGAA 1B16A 1I13A 2DWPA 2WAAA 5KYVA 5IBQA 5BV2P 4E09A 5I7VA 1TJ4A 1YULA 4MV6A 4YCSA 2DEUA 4X65B 3GDHA 3U4GA 3HMKA 4CHGA 2QX6A 2F1KA 1FVFA 1NC1A 4Y6PA 3ZWOA 5H1YA 3QHPA 1AQIA 1KFCB 1MAUA 1IZZA 1WX1A 2PZAA 2VF4X 1Y5LA 4L8VA 1W2HA 3QVUA 3OO0A 4QBHA 4Y1EA 3H8JA 4WJZA 5DHQA 4BMVA 4BQPA 4DV0B 5GVRA 2D8MA 3ZPXA 3OJEA 1ST2A 2WZNA 1ETHA 5FI5A 1TXGA 3GVIA 3AEKB 2EX1A 4YQZA 3FVVA 4AJHA 1ZCJA 3DZFA 4ZDIA 4HWSA 2BFFA 1JFFA 2RGAA 3E5RA 4GUDA 1FBNA 1P4AA 1QC5B 1X7GA 2AJCA 4BO1A 3SYNA 4JI0B 3U4AA 2GFHA 1J0XO 2NVUA 1G64A 4TVKA 3SJPA 1UMBB 1T8SA 3MUOA 4HVTA 5B1HA 4Q1BA 3EGDB 3VC2A 1NMYA 5G4LA 4TM7A 2ZRCA 4BLWA 5IABA 1A0OA 1C81A 2ABWA 4IIBA 1Y8RB 2C9YA 2EF0A 4UUQA 1Z25A 5GONA 1NHWA 1VMIA 4JXXA 1L7AA 4UPEA 4L4RA 5REQA 3KWLA 1HNXB 1WTAA 3ZE6A 3LC2O 2B7LA 4LOIA 2PIDA 3R3ZA 3JYNA 2ZTHA 4RPKA 4ZTBA 1JXQA 3A1FA 3I6BA 5EE9A 4WCVA 3KHSA 2B1RA 4L28A 4XMYA 2HQOA 3ER6A 4IVNA 1Z6YA 4FE7A 4LSGA 3G82C 2Y4NA 2VNJA 2XZLA 1B2LA 2C9OA 5ALQA 1OZHA 3ZTTA 2VXBA 1QRTA 3OY2A 3NHRA 3FTEA 3K16A 2FSVA 2QHXA 1TPZA 1LDMA 2PL9A 3HDHA 5E0OA 1ZM3A 2QU7A 4IWYA 2ZJ7A 3C1OA 3GUCA 1SPXA 3L5OA 3TLZA 5ALVA 4BP3A 3GCXA 4O4HF 2YOGA 2GPWA 5JDCC 5IU6A 3C74A 3CN7A 1RKXA 2G9RA 4PANA 4X1IA 3TMAA 1K63A 1MAWA 1XP8A 3DZ8A 4J4HA 1ZJWA 4LNHA 2NM0A 3B38A 2ZJ8A 2D5LA 4J0CA 5AK0A 3GVPA 3LDUA 4AI6A 4RVDA 4F71A 1ORDA 1KE1A 1OLUB 4EQZA 3C3DA 5B12A 1AS3A 1FLVA 3RUAA 3WTBA 4LSWA 1D9XA 5FTLA 3N58A 3T4UA 1U7TA 4Q93A 1Q0QA 3TSZA 1S02A 2FFRA 2V98A 2HYDA 1SKYE 1DOAA 2VEDA 4FLFA 1YZFA 4X84A 3ILYA 1M1NA 2YJ6A 4RK0A 2V6FA 2AWNA 2CLSA 2NUPA 4IUYA 2IV7A 1EUZA 5B1IA 3WHPA 1N7GA 3PEFA 3K96A 3E7FA 4BEBA 1K7SN 3RYFB 3S2IA 5CFQA 1NQUA 5AJUA 1W36B 3B52X 3N0WA 4RLHA 4YUAA 4B5LA 3SXUB 1ZS9A 3DO5A 3NPAA 1N5DA 3IDAA 1BVHA 4QXMA 1YBHA 4ZO6A 4RTMA 3EVDA 3QKIA 5FEMA 4JX9A 1PR9A 1HRKA 5ERYA 1XTJA 3CJQA 1F0YA 4PRKA 2EZ4A 4K86A 3ZY6A 2O8EA 4QBIA 3RRZA 4HTFB 1YE3A 2ZL5A 2HF8A 2RJNA 1PSWA 1SXJD 4MUIA 1WA5A 3EBLA 4ME6A 4ALIA 1J22A 1IQUA 1YRBA 2VDVE 4LGMA 4DEYA 2CK3A 4HGQA 4NECA 1EP9A 3ACBA 1EK0A 2AYZA 1M2JA 2ZTVA 1AF4A 3FPHA 3M3PA 3O95A 2HU2A 3AIIA 2QQ0A 1TF5A 4NFSA 3L1UA 3CXCB 4OI0A 3IEUA 3AERB 4LJ8A 5FPYA 4A26A 4D0GA 1JSLA 3C1TA 3LXUX 1U8FO 3DE6X 4U2GA 4Q02A 3DDZX 2BUCA 2Q2NA 4TQ9A 4WZ6A 1JT2A 1YSCA 4MV3A 1F6WA 4OUDB 4BMYA 3OMXA 1PJQA 1HETA 2YHBA 2YWJA 2FOXA 4D0SA 1YV9A 2XCRB 2TSYB 3C4JA 3SHOA 1JIKA 3HBLA 2I7VA 3KE8A 1X6VA 2YHIB 2PMKA 4XLHA 1NRWA 2X8JA 2Z4SA 3G68A 3OZBA 2HJGA 4JGIA 4BV3A 2NIPA 1TJYA 1QUFA 4B4VA 1LVGA 3NFYA 2ZZEA 4I1IA 5DHUA 2Y68A 3GXOA 3KCNA 3G9TA 1C0IA 1GG2A 2YVKA 2HAEA 3FFWA 3Q5GA 5A02A 5KNBD 3II6X 2AG1A 5HS4A 4WZLA 1H0RA 3CLUD 3QWFA 5DT2A 2Z5VA 4EB8A 2RG7A 5K0BA 3I61A 1L5FA 4URFA 2VDWB 1U1EA 1NUQA 2Y0CA 1H42A 1VCOA 5TE9A 2O5EA 4IZOA 2RI6A 4G56A 4LNUA 4P5EA 4E12A 3DMDA 3HFJA 4A82A 3KZKA 5I3CA 2XD9A 4K88A 3BCDA 4CEJA 3ABSB 1VJDA 1RMYA 1XVUA 4V0NA 4H7HA 2CDAA 2PGIA 4KLZA 1JTEA 2J6IA 4EUSA 4ALNA 1E99A 3NT5A 1T9KA 3FUUA 2RBKA 3G8AA 1QHFA 1Q3HA 3FR8A 4RHYA 2BFEB 2IITA 3NHPA 3R5JA 1Y5IA 4P4SB 2Y1LA 3THXB 2BFWA 3A14A 3U4HA 4RH1A 4F2PA 3KAQA 3KR9A 3P2MA 1NXSA 3DKIA 4QOIA 3TQOA 5C4MA 1D0SA 5FPTA 3C8HA 5ALEA 1YTLA 4TKVB 4PHHA 5YASA 1NBOA 3UV7A 5I4KA 2IXFA 3NTVA 4WZAB 1IPHA 4BO4A 2Q0QA 1CQIA 1ZJZA 5ALXA 1J9GA 1V25A 5BMVF 1MDFA 4B8ZA 3IEKA 1VJTA 3BRWA 3G0IA 2WPDA 1V35A 3BD9A 4Z7QB 1XPOA 3HAGA 4HC4A 1L5RA 4CTJA 3T61A 2JEYA 3Q3EA 3W5VA 3IP6A 1T2NA 1M0TA 1V5EA 4CW7A 4LJ5A 1TF7A 2WJJA 3F8WA 3JQ6A 3C2QA 4QU0A 3KKZA 4OLFA 3L4EA 1IQRA 3UMYA 4IUCS 5F73A 3UT5A 5AI9A 4D6PA 5ALGA 2BYTA 1KNQA 2ODEA 3BQMB 4MS4B 4ZO8A 4PABA 1N1EA 2RHWA 1XO1A 1GQQA 4YRJA 4I50F 4ZCIA 2X19A 4CKZA 3ORQA 3E4DA 1DIBA 2VAXA 3OLWA 4MQEA 3ROEA 1ML4A 4GOJA 2PFGA 3GWZA 1Z7EA 4EGFA 3U7FB 1W30A 3HXQA 1DE0A 1Z8DA 4TUYB 1M1ZA 2IPLA 3R0XA 1N0HA 3RRMA 5F77A 3TQRA 4NFHA 4CIAA 5BOSB 2DQKA 5JY6A 2FF5A 2C9CA 4Y2VA 4DV3B 1N92A 1BYUA 3N7UA 2JKYA 1KFJB 4XKVA 2GEJA 3NUZA 3I55B 5TIIA 2Q9CA 4I4TA 4I08A 1ULZA 1HUQA 1VYVA 1Z0KA 5FULA 3P9YA 2WTMA 2AUTA 4P98A 3MB8A 5KYYA 4LWQA 1CCWA 2ZBFA 1IHUA 1G8HA 2G80A 4HPJB 1F6BA 1RE1A 1UJ6A 2EFCB 1L2TA 3BS4A 3DEAA 3M6XA 3N59A 1KC8D 4IRUB 4KPUA 4BE4A 4Z4UA 2H5IA 3IQWA 3AF6A 1B76A 2BCJQ 1V5WA 1GITA 4H7EA 1PG0A 1WABA 4GT1A 2IVZA 2ON6A 1XZAA 4MV9A 2AEJA 1VCMA 2OZLB 4PZAA 5SY4A 1FS4A 1OLOA 1PK9A 1XEFA 3G1TA 4MPTA 3A3KA 1G1AA 4OBBA 5AJYA 3RBXA 4AJKA 5CCXA 1U1DA 1SJ9A 3KWFA 1W2GA 4F56A 4C0HA 1HYHA 3CM0A 1T5EA 4F97A 3PE4A 4FX5A 3EZLA 1KH1A 2BMDA 4Y2GA 3F71A 1BVRA 2ZSIA 1YZNA 1UP7A 4Y0NA 1CNMA 1GCIA 1VSUA 2O05A 4BWYA 5JSKA 3ONWA 1E6UA 3GXBA 5KWJA 1H2WA 4UU1A 1BD4A 1O95A 4YJ3F 1VKRA 2IELA 3VH1A 4DV7B 1SY7A 1Z2CA 3OT4A 3AU9A 2I71A 4TV8F 3BE8A 4G3XA 4YUVA 3RHTA 4ARZB 2ZJYA 4KAJA 5ITVA 3MT0A 2X9NA 3U62A 3HP1A 5DBIA 3DCYA 4ICIA 4R6XA 4IG4A 2B8NA 3C70A 3SBOA 1V45E 1F2TB 1NX6A 4UM5A 4ZQHA 3S7TA 5IKXA 3OCCA 4I1VA 1EFDN 1GZ4A 1SCIA 3GBPA 1VJ0A 3OIGA 4KN8A 4LY0A 5HF5A 3K5PA 4D4MA 2D3WA 3RIHA 3SQNA 1B4DA 3BJIC 3IUQA 2FG5A 4UUBA 1FJXA 1H3NA 1KY3A 3GN1A 2XXAB 2J67A 1EAYA 4B31A 1EVIA 1JDUA 1HX7A 5CB4B 3KJQA 2GM5A 5LYJA 4KPYA 2L0XA 3PUXA 2LV8A 3RUFA 1A7UA 2VJMA 4LIPD 1KHHA 1ZMXA 2CB9A 2IC5A 2P6NA 2WF8A 4IH9A 2AZ4A 2OKGA 4F04A 1CQWA 1I01A 3EDRA 4Z4IA 4LBVA 5LOVB 4I8DA 4G63A 3T9DA 3GVHA 4XIFA 4XLTA 1Z6GA 2JGFA 2YQ5A 3V7FA 3ZXSA 5I5EA 3KQNA 3ER9A 1JAZA 3A3PA 3TLGB 4BFCA 2VF2A 4DMLA 1O6CA 1YA6A 1OQAA 1RQXA 3ECSA 3R75A 4Q7QA 1CQZA 3SFZA 1HDRA 2D7JA 2YRWA 3G3EA 3O94A 5FOWA 1C14A 1T43A 1CUBA 3IV9A 5AW8A 2PE5A 3O1IC 3SHTA 5AW4A 3TLYA 3ETGA 2RKWA 1M6HA 1VL1A 4ZGWA 1DG3A 3BJRA 5CW2A 1KEUA 5JCXA 3CH7A 4Z86A 4B9EA 2X8KA 1C0KA 3RHZA 4ZMBA 1Z4LA 4FFVA 1JEYA 2PGXA 1Y0RA 4IDOA 4JJIA 1IK4A 3GJSA 3V6MA 4E5YA 2AW3A 1RD4A 2FVYA 3OE1A 2JL1A 4INJA 3ROXA 1MC5A 1JB1A 1MW8X 1HO3A 2E1PA 4CLEA 1RYFA 4LE0A 4WACA 1VE3A 1OSNA 4WLFA 1DB3A 1MUUA 2AGVA 3GEIA 2Y1DA 3OZRA 4EYQA 3OQNA 4OHRA 1W44A 3PHCA 3QGMA 1QNLA 2HBRA 3HNPA 3KOZA 5ECYA 2VK1A 3I8SA 1T2DA 3CEPB 4MQFB 5JO0A 4C43A 4YJHA 1R8XA 3W1VA 4NX2A 3N87A 1QANA 3H8WA 1Z4OA 3CF2A 4R84A 4X8LA 2VCYA 1U28C 1DWPA 2ZI7A 4J0EA 1YVUA 1RKVA 2R65A 1ZNXA 2ZSDA 3C6MA 3P32A 4EI8A 1KYTA 2WP0A 3TIFA 2J32A 1SZCA 2JAOA 4ACAA 1EDDA 1XTTA 2OV4A 1ENOA 1XZ8A 2VHUA 3KT8A 4HL6A 4ZEWA 3Q72A 4DCNA 1QDLB 1RWBA 5CVTA 2QDKA 3LHSA 5GPBA 2OXIA 3V46A 4BBZA 2OSVA 4D9IA 3L4JA 3HJAA 4LHVA 4YV2A 3CX6A 4IILA 3U80A 1MXFA 1RS0A 3EQ6A 1KKUA 4LX8A 3WL7A 2R7AA 1G7RA 1HZEA 1SOWA 3DZGA 5LMCA 4A10A 1WRBA 1S2NA 4M55A 2LBPA 4LCJA 3PNMA 5A03A 4Y6LA 1M5UA 2FPPB 2RMKA 3QMVA 4DBLC 3SIWA 5A4KA 1N7JA 4PRLA 1NRJB 2Q0XA 2VQ3A 1L5MA 3EUAA 3AEUA 3GFSA 3GF4A 3MRXA 4MYUA 1V1RB 4AY5A 2C4UA 3GP5A 1JH8A 2C5FA 3EZ2A 4JC8A 3THYB 4GNKA 3RAEC 2RH5A 3R6GA 3EASA 1FSZA 1DNPA 1NYRA 4O2AA 3VGJA 4HNAB 1YFJA 2QDXA 1PL8A 2ZR7A 4MR7A 2BM1A 2YR0A 3HZOA 3V3TA 2ID4A 3LD9A 1UDRA 2WTEA 4V1CI 4B4UA 5AVSA 4M8SA 3IODA 2Y1XA 3AW8A 1SIWA 5TQ2B 3ZXXA 1E2NA 4R1TA 3ZS8A 5AKHA 2KPOA 2C98A 3DEKA 2P90A 1T26A 2MIIA 2J1LA 4IWNA 5K8TA 2Z83A 3JQ7B 4KOAA 4TWBA 1LQUA 1D8AA 5AVJA 1E6EA 1IZ9A 4Z1OA 1XAHA 2H5LA 1EGHA 2E5WA 2EJUA 2CCGA 1WORA 3BBLA 4FU0A 1GKUB 5EXPA 2O6HA 5HE9A 3JAWB 3OTIA 4ER5A 3L6DA 3DE0X 3PC7A 4M22A 5A89A 3AL0C 4RVFA 4CIVA 3DLHA 5CH8A 1Y3AA 3JZIA 3SOZA 1EP1B 1HT0A 2WPNA 3GGOA 3NT4A 4G9GA 2P6OA 3OCXA 3ZCSA 2ODTX 2HYIC 1KYVA 2OFOA 3NOOA 4NBTA 3RIGA 4WZTA 1LXCA 4KGDA 3VZSA 5FO1A 3OUTA 1CY1A 3OP4A 1PRYA 4G1UC 1WW8A 4KWIA 4QEKA 1SEPA 2HPZA 3P52A 4FFMA 1DEKA 4EPTA 1TA0A 1LSSA 2UAGA 4X24A 1S8NA 2PQ0A 3EZGA 5KTRA 3KX2A 1DBIA 3K30A 1JWAB 4IUDS 3N0XA 3R7FA 4R8RA 5DDIP 5BRAA 2LCQA 1QTIA 4QYMA 1U7ZA 3QVMA 4WKCA 4DDMA 1OKKA 1JR6A 3K9CA 5IN4A 3GYBA 4M37A 2CCJA 4R2JA 1A7JA 1Y7IA 3A26A 2PFKA 1K3FA 2VJCA 3K9WA 2I67A 1XZLA 1V7PC 3SWWA 4G5FA 4XDYA 4EKDA 1CZRA 4MQ4A 1IK6A 3AXSA 4DLBA 1KMHB 4KQEA 3ZJ5A 1HT1E 2FJ0A 2JCGA 4RVSA 3VQTA 2XPCA 2QB5A 4CT0A 2O19A 5JJLA 3FFTA 2RHLA 3DOOA 4G4JA 2WM8A 2CHVA 3G8YA 4XRRA 4JVOA 1Z0FA 4P34A 3TRIA 3FWHA 2A5LA 3KWJA 1VQ6B 4JELA 2H17A 4NHEA 4S35A 3CKLA 3G8DA 4S04A 4JKYA 4V0ME 3H9UA 2JAQA 2AOTA 2YQZA 4LMAA 3PQCA 1YIJB 3T5DA 2FXVA 1C0LA 4X93A 2PTHA 5DJ5A 3PIDA 1FMFA 3LU1A 4L5YA 3EA4A 4DB2A 3DNPA 3LBHA 4UM8B 4HQNA 3AHCA 3QF4A 1AJEA 1SUCA 2QGFA 4XQCA 1PSDA 4JODA 3KZ1E 1Q2XA 1R10A 2IKQA 2IUYA 2OV8A 3MNFA 3G2OA 1P31A 3N3AC 5T6MA 4BVBA 3F96A 3RYHA 4YAWA 1W0JA 2OUIA 2XGOA 4PYJA 2OGUA 4IOKA 1DFIA 2RFLA 3V3KA 5IW8A 1GPJA 5F4MA 1RYDA 3I3OA 4LQDA 4GMKA 3LQ6A 2J09A 3F47A 4I1PA 4CNBA 3E3LA 1NN5A 3AUXA 4LYDA 1Z35A 3DMTA 1N5MA 5KDLA 2WMOB 3GN2A 1HPLA 3GARA 3JQ8A 1WXFA 2ISSD 1NTRA 3KKPA 3V4SA 3AVQA 3TKAA 3CCSB 3SN6A 3VOSA 4XWKA 4U9HS 2GTPA 2IH2A 4PGGA 3HWWA 3W4JA 1GFSA 5K2MA 1T3TA 5JVDF 1WKBA 2V7WA 4CKYA 2I4TA 3EXEA 4DZTA 2H18A 3B1XA 2HW8A 3ICVA 4REQA 1XZGA 2BKLA 5IVDA 2FN3A 5TNXA 1O08A 3T3MB 3A28A 3T1HB 1YBFA 2JIQA 1GCGA 1TIKA 3KRTA 1K1EA 3DVSX 1KO1A 1TU3A 2R1UA 2R8YA 3H1GA 1BXRA 3RQSA 1SOVA 3WV5A 4BZXA 4CG3A 5IUNC 1Q0SA 3IDFA 5BMOA 3OETA 3DVAB 4IIUA 4QGHA 2V9PA 2EV9A 2D0IA 3M6IA 2O3QA 1WM1A 3AR3A 3DOUA 4IZIA 3C98A 4II7A 2B4YA 3VC7A 3A8JA 1KF0A 1X42A 1VZ2A 3EXHA 3R77A 1VIMA 5IYPA 3TXAA 4G2TA 4DDKA 3IUYA 4JVNA 3MWYW 1P6UA 1XEXA 1DC5A 1O94C 3NM5A 3ZQ6A 2Q3BA 2J4FA 4MZDA 2PL5A 1RZUA 4Y1RA 1NIPA 1ULHA 2BDTA 1ISSA 1XTKA 2CV0A 4ASUA 4ZXFA 2FEKA 1OC2A 2GPYA 2L2QA 3H2IA 2X53S 4K05A 1SKMA 2X0RA 1THMA 1GVHA 3FNFA 2ZSAA 3MJTA 2DXIA 2JVJA 4KACA 3SBXA 1MFZA 2O0KA 1TT5B 4FPXA 2GD6A 4LJLA 1AMNA 3FOZA 1P61B 5LQMA 3U16A 5EQTA 2XUJA 5CXXA 3LTNC 1UXJA 3PJDA 4EHNA 1B26A 5CA1A 1KVQA 3HTXA 1DXYA 4QECA 4Z0PA 1DMSA 1TK3A 2JIZD 1NXOA 1U7OA 4BIIA 5AM3A 4PS1A 3OOYA 1C2TA 3DV0B 3E03A 3K20A 4MP3A 4RMGA 3PI6A 2AQ8A 4NZMA 5B7NA 4Q0MA 5KWSA 5H8WA 3FZEA 3VR4H 4O1IA 2IEZA 4B4OA 4RE5A 4D8UA 4TLBA 2BW0A 2O7QA 4LSMA 4QM6A 2EG9A 2C3MA 1N6OA 4MB2A 4TZ0A 2AI2A 4Y2HA 3VVMA 3VZQA 2GSWA 1W7AA 3C7AA 1JSCA 2IXTA 1HRDA 3KSUA 5A5EA 2H7XA 4CR7A 1QTQA 4HEJA 3U3OA 2RH4A 3R3YA 3VR2A 1A8QA 2O06A 4RJJA 1G5IA 4BNYA 3KSAC 1A5TA 4I4NA 1DDGA 4LF8B 5EE0A 4R8LA 1JBEA 3IS3A 2V7TA 13PKA 4P6YA 3OQBA 2UUAB 1NLYA 3UUFA 4CM7A 4DQVA 1XMSA 3QJ5A 2YWEA 4DK0A 3OZIA 2I6UA 4QYIB 3VOTA 4D6XA 3M9LA 3ONDA 3AP2A 4EMSA 4G0YA 4CMCA 4QA9A 3NNNA 4RCZA 3K15A 2GDZA 4RE6A 1A8PA 5BQ5A 1P5ZB 5ADWA 4RW0A 4C6SA 1C3JA 3UAWA 3RNOA 1Q7EA 4RWEA 3PQFA 2SCUB 5DKFA 4YPVA 5J23A 1KRXA 3GJYA 3I62A 2ZUBA 4FTWA 1QH1B 4C4AA 1T36B 2QW0X 4F84A 2JF0A 4FONA 2G4CA 3WQQA 1BCRB 4QFCA 4Q3NA 1OIWA 1ZRHA 1YO6A 3ID6C 2WD7A 3IE0A 4YRRA 1NJ1A 4H1HA 4Q6WA 4I55A 2QM8A 5BSMA 3GVJA 4RKQA 1ZNQO 3TD9A 5ULLA 1SVLA 4V0LA 1I51A 1V95A 4CM8B 4K5QA 1EFKA 2YMQA 3VUEA 1XWIA 5G02A 4E7PA 4ZZ3A 1YRQA 4IDQA 3BNWA 3AKDA 5EIOA 3GLGB 2IZ7A 1CUHA 3DZBA 1L4MA 1XJ0A 4H16A 3UK6A 5JAOA 5JJ5A 4HDKA 2YXLA 3LIIA 4IFIA 1QORA 4RLFA 4KVGA 1EESA 2WFZA 5BWOA 5B64A 5JRJA 1HTTA 1I2DA 5DBEX 4A0GA 2ZUVA 4MPJA 3NGXA 4AD8A 4PZLA 4YQEA 3WLMA 4QODA 3EVAA 3RBAA 4EW2A 3EIEA 2REOA 4QT4A 1NC3A 1J9EA 1L4EA 1OWOA 1FUKA 3SEJA 1U3DA 2J3QA 2PRZA 3BGIA 3BXEA 3CE9A 3CVJA 4S0XA 3WHIA 1M75A 5KYXB 1CF4A 3L8HA 5LB2A 3N7AA 3NEYA 3C6QA 2G82A 3K4PA 2G1JA 1TIBA 2I2CA 4L6IA 1SD2A 5ALOA 4MKGA 4Z3KA 2GEFA 1J7JA 1JR3A 2EOAA 3HBJA 5B6IA 4YCMA 1UKZA 3SI7A 3H4IA 3OTWA 1DG9A 2YXPX 3U9LA 1ZGZA 2BP7B 1E5TA 1NVBA 1EFRD 1U9JA 1XD2A 2BL4A 2VF8A 4LBZA 3OEYA 3NBZC 1MU0A 4QKQA 2SICE 1GAXA 3TS1A 3M8KA 4R2WA 4IQ0A 1VLOA 1Q74A 4ZIRA 4QXPA 2CL0X 3IP1A 1RAEA 2VP2A 1GSAA 3EGOA 5B4TA 4WFJA 3A9VA 4BDSA 4H3HB 4IDBA 1U8XX 2CNBA 2XKAA 1NMZA 2Q6KA 2XLBA 5C8YB 2AXQA 2V8BA 3K8YA 4ND7A 4C07A 2ZRJA 2WM2A 1QQ5A 1WP6A 4OK5A 1NGSA 1BZYA 5ES3A 3GMDA 5HZMA 1QB8A 4XWOA 4CF6A 3O2NA 5D7NA 1JDSA 1T34A 3AEXA 4S2UA 3AMVA 1BS1A 1DC3A 1OXKB 1MGOA 2NU9B 2HEIA 1REQB 1YVEI 3B2QA 3KIPA 1NJ5A 3L0IB 1VDZA 2WYUA 1T5HX 3EYAA 5JBNA 1BFUA 1IN4A 1Q3TA 3QLEA 4PLTA 3B36A 5A9SA 2PD6A 2OBXA 1EM8B 1UXIA 5TS3A 2RONA 5LZ2A 1I0IA 1COZA 1L5ZA 2DKFA 2FZ5A 3QOWA 1S1MA 4HXGA 4QPCA 4EL0A 3VFDA 4URHA 3GVKA 2B8WA 2O0JA 2EJBA 1WZUA 4MZXA 3AINA 3IEPA 1JDPA 3N53A 3VKVA 4ZJZA 3NYRA 4YJKA 4EY6A 4GICA 1QYRA 3N0TA 4QTYA 3CF4G 4JLOA 4R9SA 3S99A 5C51B 3MTBA 3DL7A 3ZQUA 1GL9B 4ZV9A 3GX1A 1WXEA 1FNSA 2GASA 3BSWA 3ASTA 1CZUA 4TLDA 3VV3A 5E9AA 1LJLA 1TGYA 1GGHA 4RIHA 1UEJA 2FWIA 3SDZA 5KU1A 1IOVA 2JA1A 3WLLA 4IXNA 1TEZA 4BCBA 3GMIA 3HVHA 3I0NA 1XD9A 1SQFA 2OE2A 2XDAA 1P0MA 1SBZA 1PHPA 3AWDA 1H1DA 1AK1A 5CEEA 2G04A 1FZTA 4PFJA 5MN5A 4RS3A 3LXMA 1SKUA 1KOGA 3N74A 4RZSA 5G3ZA 3GNTA 3ABOB 3GGCA 4ZGBA 2DBQA 2YV4A 3PR1A 1ONSA 4I6JA 3VX4A 1RQRA 4L57A 2G71A 2MYTA 3H2BA 4FYVA 5IH7A 1I24A 2IY8A 3RT9A 4WZBA 3EA0A 1DO8A 2O8NA 2IX3A 3F5MA 3K09A 5BWBA 4OMCA 1CRLA 2RKBA 3OIFA 4U6QA 5B7PA 4GAEA 1ZVJA 4FNMA 1DINA 1GZDA 5DXFA 5DB4A 3A7EA 3DMHA 2QF7A 1WWKA 1G4UR 2F9MA 3V4RA 3SZRA 1ENPA 1SCKA 3M6VA 2QGGA 2QNIA 3TQQA 3HP7A 4JVSB 3OP1A 1XRPA 3RPEA 3QFRA 1F48A 4FMDF 4FW8A 2JIOA 3MGKA 4JC4A 2C0QA 2PMCA 4O63O 5EIAA 1P8JA 5I9SA 3ZHSA 1L7BA 1GCUA 3KQOA 1NUUA 1ATZA 2OHVA 3F8SA 3LPLA 1SXHA 1X13A 2O2CA 1N9GB 3C7TA 4FFWA 3OX1A 5KAMA 3G05A 2DP4E 2PNFA 3G1UA 4F8YA 5IMBA 3FHTA 4ESVA 4HDRA 2VUUA 2E85A 5BNZA 3IKLA 1A95A 2Q2OA 4ILKA 1RYZA 3LGSA 5I5GA 3VU9A 2IGBA 3V00A 5JAQA 1X7XA 1JE1A 1X7YA 1QIDA 5BYBA 1I3CA 1EGVB 2R8BA 3C3YA 2BRUA 3HO8A 1G5HA 4ZEVA 1XCGB 4AB1A 5M34A 2A84A 1MORA 1R4NA 2NT4A