1IJZA

Solution structure of human il-13
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
MGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of human IL-13 and implication for receptor binding.
pubmed doi rcsb
molecule keywords INTERLEUKIN-13
molecule tags Cytokine
source organism Homo sapiens
total genus 25
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2001-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1ijzA00
1M4RA 1LK3A 5D28B 1INRA 1I1RB 2D9QA 1M4CA 2LMSA 1BP3A 3LB6A 2B5IA 3S9DA 2O26A 3DUHC 1Z92A 1P9MB 2KZ1A 1ITIA 1EMRA 3D85C 1IRLA 1RCBA 1GA3A 4NKQC 1CNT1 2CYKA 2E9WC 1HWHA 1PVHB 3BPLA 1RFBA 2L3OA 3HMXB 1V7MV 4Z5RD 2Q98A 3VA2A 3QWRB 3D48P 1GNCA 1LQSL 1BBNA 1IJZA 1WU3I 3N0PA 4WRLB 3MZGA 4FA8E 1FYHA 4NEMA 1M49A 3NCCA 3LB6B 4I77Z 2B8UA 1VLKA 3EJJA 3L5XA 4GRWA 1HIKA 3BPNA 2GMFA 5D71A 1HWGA 1HULA 3QB1A 3NCFA 4YDYI 1IK0A 3B5KA 2B91A 1HUWA 5E4EA 1BCNA 3G6DA 4PS4A 3QB7A 1BGDA 1AX8A 1SCFA 2Q7NB 1D9CA 3NPZA 3DGCL 5L6YC 3PIVA 4NI9A 3NCEA 1QVNA 4YPGC 3UF5A 3SE4B 1Y6NL 4O6KA 1M4AA 2LAGA 4MHLA 1ITFA 5D22A 1NBPA 1IARA 1HZIA 1CD9A 3UEZE 4NI7A 2B8XA 1RW5A 2HYMB 2INTA 3NCBA 3G9VB 5LQBA 4RS1A 1FG9A 1EVSA 1HIJA 3QT2C 1Z7CA 4NEJA 3PIWA 3WCYI 3OQ3A 5FHXA 2O27A 5D72A 1M48A 5C7XA 1KF9A 4ZS7A 1N1FA 3D87A 1D9GA 4O9HA 1V7NV 5D70A 1IL6A 3EW3A 1LKIA 2B8ZA 2IL6A 3DLQI 1BGCA 1JLIA 1EERA 4YQXA 4X51A 1PY2A 4YUEC 1Y6KL 1A22A 2D48A 2H24A 1F6FA 1ITLA 1PGRA 1EKUA 3BESL 1M4BA 3BPOA 1CYLA 1AXIA 1M47A 3SE3B 1BGEA 4DOHA 4ZF7A 2B8YA 3UF2A 1ITMA 1Y6ML 2ILKA 2ERJD 2B90A 4J4LC 5FUCA 1PW6A 3QAZA 5KNHI 3HHRA 3L5WI 4CNIC 3INKC 1CN4C 1BUYA 3Q1SI 1EXZA 3UX9A 1ALUA 3N06A 1B5LA 1J7VL 1F45B 1AU1A 1ETEA 1A7MA 1RHGA 1CSGA 1YKBA 1ILKA 2L3YA 1HGUA
chains in the Genus database with same CATH superfamily
1LK3A 4A3GD 4JREA 2D9QA 1ITIA 1RCBA 1GA3A 4NKQC 4GC0A 3BPLA 4A3CD 3HMXB 2JA8D 2R92D 3QWRB 1BBNA 1WU3I 4WRLB 3NCCA 5C4XD 3L5XA 4GRWA 4IU8A 4U4VA 5C3ED 2B91A 1HUWA 5E4EA 4TPJA 1BCNA 4TPHA 4A3ED 5L6YC 3H0GD 5EQGA 3NCEA 5D59A 3UF5A 2VUMD 1Y6NL 1Y1WD 4U4TA 4NI7A 2B8XA 1RW5A 5LQBA 4RS1A 1FG9A 3QT2C 4NEJA 2O27A 5IYDD 4DKDA 5D72A 1M48A 4EXPA 5D70A 4JR9A 1LKIA 4A3ID 4X51A 1Y6KL 4ZWBA 5D58A 1EKUA 1M4BA 4DKFA 1AXIA 1M47A 5C65A 4BBRD 4Q65A 3QAZA 5KNHI 1ALUA 4GBZA 1J7VL 1RHGA 1CSGA 1YKBA 4J05A 1M4CA 4LDSA 1BP3A 3LB6A 3H3VE 5IYBD 1Z92A 4A3DD 1P9MB 2KZ1A 1EMRA 2Z3QA 3DI3A 5EQIA 4NN6A 2XUTA 1RFBA 4OAAA 4IU9A 3VA2A 1GNCA 2OQPA 1Y14A 3HOVD 2C35A 4FA8E 1FYHA 4NEMA 5A2NA 3LB6B 4I77Z 2B8UA 4W6VA 3IRHA 5D71A 2GMFA 5FLMD 1HULA 3B5KA 4NN7A 3I4ND 3G6DA 4YBQA 4PS4A 3QB7A 1BGDA 1AX8A 2Q7NB 3PIVA 4D2CA 4IKVA 1QVNA 4O6KA 4ZW9A 4OH3A 5D22A 1NBPA 1IARA 3WDOA 2B63D 3WCYI 3OQ3A 3DI2A 5FHXA 4ZWCA 1KF9A 1N1FA 2CFQA 1D9GA 3D87A 3OG4A 3EW3A 2B8ZA 2IL6A 4XNJA 1BGCA 1JLIA 1PY2A 2D48A 4YB9D 1CYLA 1PW4A 4IKZA 4ZF7A 1BGEA 2ILKA 3L5WI 1WCMD 2V8NA 3Q1SI 3HOYD 1AU1A 2O6IA 1ETEA 1M4RA 5D28B 2Q14A 2LMSA 3HOZD 1PV6A 2B5IA 3S9DA 2O26A 3DUHC 2R93D 1IRLA 2CYKA 3HOWD 2PSMA 1V7MV 4Z5RD 3D48P 1LQSL 1IJZA 2JA7D 4APSA 3N0PA 4GS7A 3MZGA 4QIQA 3TGXB 1Y1VD 5GXBA 1VLKA 3EJJA 5TS9A 3BPNA 2Y5YA 3NCFA 4YDYI 5D6KA 3O7PA 5EQHA 1SCFA 1D9CA 3NPZA 4NI9A 4YPGC 3SE4B 4UVMA 2CFPA 1HZIA 1CD9A 3UEZE 3G9VB 1EVSA 1Z7CA 3HOXD 3PIWA 4LEPA 4DKEA 2XQBA 3HOUD 5C7XA 4ZS7A 4O9HA 1IL6A 4DKCA 3DLQI 1EERA 4A3LD 4YUEC 1PV7A 1F6FA 1ITLA 1PGRA 3BPOA 3FKID 4GBYA 3UF2A 1Y6ML 2ERJD 5IYCD 4J4LC 1PW6A 5IP7D 3HHRA 4BBSD 3INKC 1BUYA 4U4WA 1EXZA 1F45B 1A7MA 3HHCA 4D2BA 1ILKA 1INRA 1I1RB 4A3MD 4IKYA 3D85C 1CNT1 2E9WC 1HWHA 1PVHB 4JA3A 2L3OA 2R7ZD 2Q98A 4EXNA 4IKXA 1M49A 1HIKA 4BXXD 1HWGA 3QB1A 1IK0A 2JA6D 3AYHA 3DGCL 4TPGA 4XNIA 1M4AA 2LAGA 4MHLA 1ITFA 4IKWA 4A3FD 4PYPA 3NCBA 2HYMB 2INTA 4LRLA 4NN5A 1HIJA 4BY1D 4A93D 5A2OA 3PO3D 2Z3RA 1V7NV 4A3JD 4YQXA 4ZYRA 1A22A 2JA5D 2H24A 4BY7D 3O7QA 3BESL 3PO2D 4A3KD 3SE3B 4DOHA 3I4MD 2B8YA 1ITMA 4A3BD 4D2DA 2B90A 5C44D 5FUCA 5IP9D 4CNIC 1CN4C 3UX9A 3N06A 1B5LA 3OG6A 2L3YA 1HGUA
chains in the Genus database with same CATH topology
1M4RA 1LK3A 5D28B 4A3GD 1INRA 2Q14A 1I1RB 2D9QA 1M4CA 2LMSA 4A3MD 3HOZD 1BP3A 3LB6A 3H3VE 2B5IA 3S9DA 2O26A 3DUHC 2R93D 5IYBD 1Z92A 4A3DD 1P9MB 2KZ1A 1ITIA 1EMRA 3D85C 1IRLA 1RCBA 1GA3A 4NKQC 1CNT1 2CYKA 2E9WC 2Z3QA 1HWHA 1PVHB 3BPLA 3DI3A 4NN6A 3HOWD 1RFBA 2L3OA 2PSMA 3HMXB 2R7ZD 1V7MV 4Z5RD 2Q98A 3VA2A 2JA8D 2R92D 3QWRB 3D48P 1GNCA 1LQSL 1BBNA 2OQPA 1IJZA 1Y14A 2JA7D 3HOVD 1WU3I 3N0PA 4WRLB 4GS7A 4EXNA 3MZGA 2C35A 4FA8E 1FYHA 4NEMA 1M49A 3TGXB 1Y1VD 3LB6B 3NCCA 4I77Z 5C4XD 2B8UA 1VLKA 3EJJA 3L5XA 3IRHA 4GRWA 1HIKA 3BPNA 2GMFA 5D71A 5TS9A 5FLMD 4BXXD 1HWGA 1HULA 3QB1A 5C3ED 3NCFA 4YDYI 1IK0A 3B5KA 2B91A 1HUWA 4NN7A 5E4EA 3I4ND 1BCNA 3G6DA 2JA6D 4PS4A 3QB7A 1BGDA 1AX8A 1SCFA 3AYHA 4A3ED 2Q7NB 1D9CA 3NPZA 3DGCL 5L6YC 3H0GD 3PIVA 4NI9A 3NCEA 1QVNA 2B63D 4YPGC 3UF5A 2VUMD 3SE4B 1Y6NL 4O6KA 1Y1WD 1M4AA 2LAGA 4MHLA 1ITFA 5D22A 1NBPA 4A3FD 1IARA 1HZIA 1CD9A 3UEZE 4NI7A 2B8XA 1RW5A 2HYMB 2INTA 3NCBA 3G9VB 4LRLA 4NN5A 1FG9A 1EVSA 1HIJA 3QT2C 4RS1A 5LQBA 1Z7CA 4NEJA 3HOXD 3PIWA 4BY1D 3WCYI 3OQ3A 3DI2A 5FHXA 4DKEA 2O27A 2XQBA 4A93D 5IYDD 4DKDA 3HOUD 3PO3D 5D72A 1M48A 4EXPA 5C7XA 1KF9A 2Z3RA 1N1FA 3D87A 1D9GA 3OG4A 4O9HA 4ZS7A 1V7NV 5D70A 4A3JD 1IL6A 4DKCA 3EW3A 1LKIA 2B8ZA 2IL6A 3DLQI 1BGCA 1JLIA 1EERA 4YQXA 4X51A 4A3ID 4A3LD 1PY2A 4YUEC 1Y6KL 1A22A 2JA5D 2D48A 2H24A 1F6FA 4BY7D 1ITLA 1PGRA 1EKUA 3BESL 1M4BA 3BPOA 1CYLA 4DKFA 3FKID 3PO2D 4A3KD 1AXIA 1M47A 3SE3B 1BGEA 4DOHA 4ZF7A 3I4MD 2B8YA 3UF2A 1ITMA 4A3BD 1Y6ML 2ILKA 4BBRD 2ERJD 5IYCD 2B90A 4J4LC 5C44D 5FUCA 1PW6A 5IP7D 5IP9D 3QAZA 5KNHI 3HHRA 1WCMD 3L5WI 4CNIC 4BBSD 3INKC 1CN4C 1BUYA 3Q1SI 1EXZA 3UX9A 1ALUA 3N06A 1B5LA 1J7VL 1F45B 1AU1A 2O6IA 3OG6A 1ETEA 3HHCA 3HOYD 1RHGA 4A3CD 1A7MA 1CSGA 1YKBA 1ILKA 2L3YA 1HGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M4R A;  1LK3 A;  5D28 B;  1INR A;  1I1R B;  2D9Q A;  1M4C A;  2LMS A;  1BP3 A;  3LB6 A;  2B5I A;  3S9D A;  2O26 A;  3DUH C;  1Z92 A;  1P9M B;  2KZ1 A;  1ITI A;  1EMR A;  3D85 C;  1IRL A;  1RCB A;  1GA3 A;  4NKQ C;  1CNT 1;  2CYK A;  2E9W C;  1HWH A;  1PVH B;  3BPL A;  1RFB A;  2L3O A;  3HMX B;  1V7M V;  4Z5R D;  2Q98 A;  3VA2 A;  3QWR B;  3D48 P;  1GNC A;  1LQS L;  1BBN A;  1IJZ A;  1WU3 I;  3N0P A;  4WRL B;  3MZG A;  4FA8 E;  1FYH A;  4NEM A;  1M49 A;  3NCC A;  3LB6 B;  4I77 Z;  2B8U A;  1VLK A;  3EJJ A;  3L5X A;  4GRW A;  1HIK A;  3BPN A;  2GMF A;  5D71 A;  1HWG A;  1HUL A;  3QB1 A;  3NCF A;  4YDY I;  1IK0 A;  3B5K A;  2B91 A;  1HUW A;  5E4E A;  1BCN A;  3G6D A;  4PS4 A;  3QB7 A;  1BGD A;  1AX8 A;  1SCF A;  2Q7N B;  1D9C A;  3NPZ A;  3DGC L;  5L6Y C;  3PIV A;  4NI9 A;  3NCE A;  1QVN A;  4YPG C;  3UF5 A;  3SE4 B;  1Y6N L;  4O6K A;  1M4A A;  2LAG A;  4MHL A;  1ITF A;  5D22 A;  1NBP A;  1IAR A;  1HZI A;  1CD9 A;  3UEZ E;  4NI7 A;  2B8X A;  1RW5 A;  2HYM B;  2INT A;  3NCB A;  3G9V B;  5LQB A;  4RS1 A;  1FG9 A;  1EVS A;  1HIJ A;  3QT2 C;  1Z7C A;  4NEJ A;  3PIW A;  3WCY I;  3OQ3 A;  5FHX A;  2O27 A;  5D72 A;  1M48 A;  5C7X A;  1KF9 A;  4ZS7 A;  1N1F A;  3D87 A;  1D9G A;  4O9H A;  1V7N V;  5D70 A;  1IL6 A;  3EW3 A;  1LKI A;  2B8Z A;  2IL6 A;  3DLQ I;  1BGC A;  1JLI A;  1EER A;  4YQX A;  4X51 A;  1PY2 A;  4YUE C;  1Y6K L;  1A22 A;  2D48 A;  2H24 A;  1F6F A;  1ITL A;  1PGR A;  1EKU A;  3BES L;  1M4B A;  3BPO A;  1CYL A;  1AXI A;  1M47 A;  3SE3 B;  1BGE A;  4DOH A;  4ZF7 A;  2B8Y A;  3UF2 A;  1ITM A;  1Y6M L;  2ILK A;  2ERJ D;  2B90 A;  4J4L C;  5FUC A;  1PW6 A;  3QAZ A;  5KNH I;  3HHR A;  3L5W I;  4CNI C;  3INK C;  1CN4 C;  1BUY A;  3Q1S I;  1EXZ A;  3UX9 A;  1ALU A;  3N06 A;  1B5L A;  1J7V L;  1F45 B;  1AU1 A;  1ETE A;  1A7M A;  1RHG A;  1CSG A;  1YKB A;  1ILK A;  2L3Y A;  1HGU A; 
#chains in the Genus database with same CATH topology
 1LK3 A;  4A3G D;  4JRE A;  2D9Q A;  1ITI A;  1RCB A;  1GA3 A;  4NKQ C;  4GC0 A;  3BPL A;  4A3C D;  3HMX B;  2JA8 D;  2R92 D;  3QWR B;  1BBN A;  1WU3 I;  4WRL B;  3NCC A;  5C4X D;  3L5X A;  4GRW A;  4IU8 A;  4U4V A;  5C3E D;  2B91 A;  1HUW A;  5E4E A;  4TPJ A;  1BCN A;  4TPH A;  4A3E D;  5L6Y C;  3H0G D;  5EQG A;  3NCE A;  5D59 A;  3UF5 A;  2VUM D;  1Y6N L;  1Y1W D;  4U4T A;  4NI7 A;  2B8X A;  1RW5 A;  5LQB A;  4RS1 A;  1FG9 A;  3QT2 C;  4NEJ A;  2O27 A;  5IYD D;  4DKD A;  5D72 A;  1M48 A;  4EXP A;  5D70 A;  4JR9 A;  1LKI A;  4A3I D;  4X51 A;  1Y6K L;  4ZWB A;  5D58 A;  1EKU A;  1M4B A;  4DKF A;  1AXI A;  1M47 A;  5C65 A;  4BBR D;  4Q65 A;  3QAZ A;  5KNH I;  1ALU A;  4GBZ A;  1J7V L;  1RHG A;  1CSG A;  1YKB A;  4J05 A;  1M4C A;  4LDS A;  1BP3 A;  3LB6 A;  3H3V E;  5IYB D;  1Z92 A;  4A3D D;  1P9M B;  2KZ1 A;  1EMR A;  2Z3Q A;  3DI3 A;  5EQI A;  4NN6 A;  2XUT A;  1RFB A;  4OAA A;  4IU9 A;  3VA2 A;  1GNC A;  2OQP A;  1Y14 A;  3HOV D;  2C35 A;  4FA8 E;  1FYH A;  4NEM A;  5A2N A;  3LB6 B;  4I77 Z;  2B8U A;  4W6V A;  3IRH A;  5D71 A;  2GMF A;  5FLM D;  1HUL A;  3B5K A;  4NN7 A;  3I4N D;  3G6D A;  4YBQ A;  4PS4 A;  3QB7 A;  1BGD A;  1AX8 A;  2Q7N B;  3PIV A;  4D2C A;  4IKV A;  1QVN A;  4O6K A;  4ZW9 A;  4OH3 A;  5D22 A;  1NBP A;  1IAR A;  3WDO A;  2B63 D;  3WCY I;  3OQ3 A;  3DI2 A;  5FHX A;  4ZWC A;  1KF9 A;  1N1F A;  2CFQ A;  1D9G A;  3D87 A;  3OG4 A;  3EW3 A;  2B8Z A;  2IL6 A;  4XNJ A;  1BGC A;  1JLI A;  1PY2 A;  2D48 A;  4YB9 D;  1CYL A;  1PW4 A;  4IKZ A;  4ZF7 A;  1BGE A;  2ILK A;  3L5W I;  1WCM D;  2V8N A;  3Q1S I;  3HOY D;  1AU1 A;  2O6I A;  1ETE A;  1M4R A;  5D28 B;  2Q14 A;  2LMS A;  3HOZ D;  1PV6 A;  2B5I A;  3S9D A;  2O26 A;  3DUH C;  2R93 D;  1IRL A;  2CYK A;  3HOW D;  2PSM A;  1V7M V;  4Z5R D;  3D48 P;  1LQS L;  1IJZ A;  2JA7 D;  4APS A;  3N0P A;  4GS7 A;  3MZG A;  4QIQ A;  3TGX B;  1Y1V D;  5GXB A;  1VLK A;  3EJJ A;  5TS9 A;  3BPN A;  2Y5Y A;  3NCF A;  4YDY I;  5D6K A;  3O7P A;  5EQH A;  1SCF A;  1D9C A;  3NPZ A;  4NI9 A;  4YPG C;  3SE4 B;  4UVM A;  2CFP A;  1HZI A;  1CD9 A;  3UEZ E;  3G9V B;  1EVS A;  1Z7C A;  3HOX D;  3PIW A;  4LEP A;  4DKE A;  2XQB A;  3HOU D;  5C7X A;  4ZS7 A;  4O9H A;  1IL6 A;  4DKC A;  3DLQ I;  1EER A;  4A3L D;  4YUE C;  1PV7 A;  1F6F A;  1ITL A;  1PGR A;  3BPO A;  3FKI D;  4GBY A;  3UF2 A;  1Y6M L;  2ERJ D;  5IYC D;  4J4L C;  1PW6 A;  5IP7 D;  3HHR A;  4BBS D;  3INK C;  1BUY A;  4U4W A;  1EXZ A;  1F45 B;  1A7M A;  3HHC A;  4D2B A;  1ILK A;  1INR A;  1I1R B;  4A3M D;  4IKY A;  3D85 C;  1CNT 1;  2E9W C;  1HWH A;  1PVH B;  4JA3 A;  2L3O A;  2R7Z D;  2Q98 A;  4EXN A;  4IKX A;  1M49 A;  1HIK A;  4BXX D;  1HWG A;  3QB1 A;  1IK0 A;  2JA6 D;  3AYH A;  3DGC L;  4TPG A;  4XNI A;  1M4A A;  2LAG A;  4MHL A;  1ITF A;  4IKW A;  4A3F D;  4PYP A;  3NCB A;  2HYM B;  2INT A;  4LRL A;  4NN5 A;  1HIJ A;  4BY1 D;  4A93 D;  5A2O A;  3PO3 D;  2Z3R A;  1V7N V;  4A3J D;  4YQX A;  4ZYR A;  1A22 A;  2JA5 D;  2H24 A;  4BY7 D;  3O7Q A;  3BES L;  3PO2 D;  4A3K D;  3SE3 B;  4DOH A;  3I4M D;  2B8Y A;  1ITM A;  4A3B D;  4D2D A;  2B90 A;  5C44 D;  5FUC A;  5IP9 D;  4CNI C;  1CN4 C;  3UX9 A;  3N06 A;  1B5L A;  3OG6 A;  2L3Y A;  1HGU A; 
#chains in the Genus database with same CATH homology
 1M4R A;  1LK3 A;  5D28 B;  4A3G D;  1INR A;  2Q14 A;  1I1R B;  2D9Q A;  1M4C A;  2LMS A;  4A3M D;  3HOZ D;  1BP3 A;  3LB6 A;  3H3V E;  2B5I A;  3S9D A;  2O26 A;  3DUH C;  2R93 D;  5IYB D;  1Z92 A;  4A3D D;  1P9M B;  2KZ1 A;  1ITI A;  1EMR A;  3D85 C;  1IRL A;  1RCB A;  1GA3 A;  4NKQ C;  1CNT 1;  2CYK A;  2E9W C;  2Z3Q A;  1HWH A;  1PVH B;  3BPL A;  3DI3 A;  4NN6 A;  3HOW D;  1RFB A;  2L3O A;  2PSM A;  3HMX B;  2R7Z D;  1V7M V;  4Z5R D;  2Q98 A;  3VA2 A;  2JA8 D;  2R92 D;  3QWR B;  3D48 P;  1GNC A;  1LQS L;  1BBN A;  2OQP A;  1IJZ A;  1Y14 A;  2JA7 D;  3HOV D;  1WU3 I;  3N0P A;  4WRL B;  4GS7 A;  4EXN A;  3MZG A;  2C35 A;  4FA8 E;  1FYH A;  4NEM A;  1M49 A;  3TGX B;  1Y1V D;  3LB6 B;  3NCC A;  4I77 Z;  5C4X D;  2B8U A;  1VLK A;  3EJJ A;  3L5X A;  3IRH A;  4GRW A;  1HIK A;  3BPN A;  2GMF A;  5D71 A;  5TS9 A;  5FLM D;  4BXX D;  1HWG A;  1HUL A;  3QB1 A;  5C3E D;  3NCF A;  4YDY I;  1IK0 A;  3B5K A;  2B91 A;  1HUW A;  4NN7 A;  5E4E A;  3I4N D;  1BCN A;  3G6D A;  2JA6 D;  4PS4 A;  3QB7 A;  1BGD A;  1AX8 A;  1SCF A;  3AYH A;  4A3E D;  2Q7N B;  1D9C A;  3NPZ A;  3DGC L;  5L6Y C;  3H0G D;  3PIV A;  4NI9 A;  3NCE A;  1QVN A;  2B63 D;  4YPG C;  3UF5 A;  2VUM D;  3SE4 B;  1Y6N L;  4O6K A;  1Y1W D;  1M4A A;  2LAG A;  4MHL A;  1ITF A;  5D22 A;  1NBP A;  4A3F D;  1IAR A;  1HZI A;  1CD9 A;  3UEZ E;  4NI7 A;  2B8X A;  1RW5 A;  2HYM B;  2INT A;  3NCB A;  3G9V B;  4LRL A;  4NN5 A;  1FG9 A;  1EVS A;  1HIJ A;  3QT2 C;  4RS1 A;  5LQB A;  1Z7C A;  4NEJ A;  3HOX D;  3PIW A;  4BY1 D;  3WCY I;  3OQ3 A;  3DI2 A;  5FHX A;  4DKE A;  2O27 A;  2XQB A;  4A93 D;  5IYD D;  4DKD A;  3HOU D;  3PO3 D;  5D72 A;  1M48 A;  4EXP A;  5C7X A;  1KF9 A;  2Z3R A;  1N1F A;  3D87 A;  1D9G A;  3OG4 A;  4O9H A;  4ZS7 A;  1V7N V;  5D70 A;  4A3J D;  1IL6 A;  4DKC A;  3EW3 A;  1LKI A;  2B8Z A;  2IL6 A;  3DLQ I;  1BGC A;  1JLI A;  1EER A;  4YQX A;  4X51 A;  4A3I D;  4A3L D;  1PY2 A;  4YUE C;  1Y6K L;  1A22 A;  2JA5 D;  2D48 A;  2H24 A;  1F6F A;  4BY7 D;  1ITL A;  1PGR A;  1EKU A;  3BES L;  1M4B A;  3BPO A;  1CYL A;  4DKF A;  3FKI D;  3PO2 D;  4A3K D;  1AXI A;  1M47 A;  3SE3 B;  1BGE A;  4DOH A;  4ZF7 A;  3I4M D;  2B8Y A;  3UF2 A;  1ITM A;  4A3B D;  1Y6M L;  2ILK A;  4BBR D;  2ERJ D;  5IYC D;  2B90 A;  4J4L C;  5C44 D;  5FUC A;  1PW6 A;  5IP7 D;  5IP9 D;  3QAZ A;  5KNH I;  3HHR A;  1WCM D;  3L5W I;  4CNI C;  4BBS D;  3INK C;  1CN4 C;  1BUY A;  3Q1S I;  1EXZ A;  3UX9 A;  1ALU A;  3N06 A;  1B5L A;  1J7V L;  1F45 B;  1AU1 A;  2O6I A;  3OG6 A;  1ETE A;  3HHC A;  3HOY D;  1RHG A;  4A3C D;  1A7M A;  1CSG A;  1YKB A;  1ILK A;  2L3Y A;  1HGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...