1IKCA

Nmr structure of alpha-bungarotoxin
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords long neurotoxin 1
publication title NMR structure of alpha-bungarotoxin free and bound to a mimotope of the nicotinic acetylcholine receptor.
pubmed doi rcsb
molecule tags Toxin
total genus 4
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ikcA00
1COEA 2H62C 2MFAA 2OFSA 5DZ5A 1TXAA 6EBXA 1CDTA 1NYUA 2LA1A 1TGXA 1BTEA 2J8BA 1I02A 1LXGA 1TFSA 1KBAA 1FSSB 2L03A 1DRSA 1YWHA 1QKDA 1CXOA 1F8UB 1KBTA 2CRSA 3U74U 1G6MA 1IDGA 2MUPA 4BIKB 2LCRA 2CRTA 1IJCA 2N99A 2QC1A 1FSCA 2UWRA 5EBXA 4RUDA 2H8UA 2MJ4A 2ERAA 2PJYC 3BT2U 4EY8B 2MJYA 1XT3A 2FD6U 2JVEA 4ZQYA 3NH7A 1VB0A 1S4YA 2CDXA 1F94A 3FEVA 2CTXA 1ES7B 1HC9A 1LJZA 1CDRA 2HLQA 1KTZB 1CRFA 1ABTA 2PJYB 3ERAA 1JGKA 1MAHF 2JQPA 1FASA 1LSIA 3VTSA 1KL8A 2L5SA 3BT1U 1HAJA 1HC9B 2QJ9C 2CCXA 1LXHA 1ZADA 1KBSA 2GOOC 3PLCA 1CVOA 1L4WA 2X8BB 1CODA 1REWC 1FFJA 2H5FA 2VLWA 4BDTB 4DO8A 1RL5A 2BTXA 1CREA 1PLOA 2UX2A 4FAOC 3HH7A 5IMTD 4UY2C 1NORA 4HQPF 3EBXA 2GOOB 1LX5B 2H62D 1H0JA 1ERGA 1CHVS 2BHIA 3EVSC 5IMYC 2H7ZA 1B41B 4LFTA 1BXPA 2MUOA 3NEQA 1IQ9A 1M9ZA 1QKEA 1JBDA 1ONJA 1CXNA 4FAOE 1CTXA 1MR6A 3LAQU 2ABXA 3KFDI 1IDHA 1W6BA 2MJ0A 2H64C 2H7ZB 1CDSA 1NTNA 2QJAC 4P7UA 5DO6A 1KFHA 4QTIU 4OM4A 2HLRA 1IKCA 1NTXA 1FF4A 1KXIA 2H64B 3KFDE 1V6PA 2MHYA 2I9BE 1CCQA 1HOYA 1IDIA 1FRAA 1NXBA 1IK8A 2K3GA 1NEAA 1NYSA 1IDLA 4IYEA 4XJJA 1RGJA 1CDQA 1JE9A 5DU1A 1TXBA 3QB4B 1KU6B 1KC4A 3U73U 1KS6A 2NBTA 4AEAA 1CB9A 1HAAA 2QJBC 3NDSA 1QM7A 1UG4A 1ERAA 4OM5A
chains in the Genus database with same CATH superfamily
1COEA 2H62C 2MFAA 2OFSA 5DZ5A 1TXAA 6EBXA 1CDTA 1NYUA 2LA1A 1TGXA 1BTEA 2J8BA 1I02A 1LXGA 1TFSA 1KBAA 1FSSB 2L03A 1DRSA 1YWHA 1QKDA 1CXOA 1F8UB 1KBTA 2CRSA 3U74U 1G6MA 1IDGA 2MUPA 4BIKB 2LCRA 2CRTA 1IJCA 2N99A 2QC1A 1FSCA 2UWRA 5EBXA 4RUDA 2H8UA 2MJ4A 2ERAA 2PJYC 3BT2U 4EY8B 2MJYA 1XT3A 2FD6U 2JVEA 4ZQYA 3NH7A 1VB0A 1S4YA 2CDXA 1F94A 3FEVA 2CTXA 1ES7B 1HC9A 1LJZA 1CDRA 2HLQA 1KTZB 1CRFA 1ABTA 2PJYB 3ERAA 1JGKA 1MAHF 2JQPA 1FASA 1LSIA 3VTSA 1KL8A 2L5SA 3BT1U 1HAJA 1HC9B 2QJ9C 2CCXA 1LXHA 1ZADA 1KBSA 2GOOC 3PLCA 1CVOA 1L4WA 2X8BB 1CODA 1REWC 1FFJA 2H5FA 2VLWA 4BDTB 4DO8A 1RL5A 2BTXA 1CREA 1PLOA 2UX2A 4FAOC 3HH7A 5IMTD 4UY2C 1NORA 4HQPF 3EBXA 2GOOB 1LX5B 2H62D 1H0JA 1ERGA 1CHVS 2BHIA 3EVSC 5IMYC 2H7ZA 1B41B 4LFTA 1BXPA 2MUOA 3NEQA 1IQ9A 1M9ZA 1QKEA 1JBDA 1ONJA 1CXNA 4FAOE 1CTXA 1MR6A 3LAQU 2ABXA 3KFDI 1IDHA 1W6BA 2MJ0A 4KSNA 2H64C 2H7ZB 1CDSA 1NTNA 2QJAC 4P7UA 5DO6A 1KFHA 4QTIU 4OM4A 2HLRA 1IKCA 1NTXA 1FF4A 1KXIA 2H64B 3KFDE 1V6PA 2MHYA 2I9BE 1CCQA 1HOYA 1IDIA 1FRAA 1NXBA 1IK8A 2K3GA 1NEAA 1NYSA 1IDLA 4IYEA 4XJJA 1RGJA 1CDQA 1JE9A 5DU1A 1TXBA 3QB4B 1KU6B 1KC4A 3U73U 1KS6A 2NBTA 4AEAA 1CB9A 1HAAA 2QJBC 3NDSA 1QM7A 1UG4A 1ERAA 4OM5A
chains in the Genus database with same CATH topology
1COEA 2H62C 2MFAA 2OFSA 5DZ5A 1TXAA 6EBXA 1CDTA 1NYUA 2LA1A 1TGXA 1BTEA 2J8BA 1I02A 1LXGA 1TFSA 1KBAA 1FSSB 2L03A 1DRSA 1YWHA 1QKDA 1CXOA 1F8UB 1KBTA 2CRSA 3U74U 1G6MA 1IDGA 2MUPA 4BIKB 2LCRA 2CRTA 1IJCA 2N99A 2QC1A 1FSCA 2UWRA 5EBXA 4RUDA 2H8UA 2MJ4A 2ERAA 2PJYC 3BT2U 4EY8B 2MJYA 1XT3A 2FD6U 2JVEA 4ZQYA 3NH7A 1VB0A 1S4YA 2CDXA 1F94A 3FEVA 2CTXA 1ES7B 1HC9A 1LJZA 1CDRA 2HLQA 1KTZB 1CRFA 1ABTA 2PJYB 3ERAA 1JGKA 1MAHF 2JQPA 1FASA 1LSIA 3VTSA 1KL8A 2L5SA 3BT1U 1HAJA 1HC9B 2QJ9C 2CCXA 1LXHA 1ZADA 1KBSA 2GOOC 3PLCA 1CVOA 1L4WA 2X8BB 1CODA 1REWC 1FFJA 2H5FA 2VLWA 4BDTB 4DO8A 1RL5A 2BTXA 1CREA 1PLOA 2UX2A 4FAOC 3HH7A 5IMTD 4UY2C 1NORA 4HQPF 3EBXA 2GOOB 1LX5B 2H62D 1H0JA 1ERGA 1CHVS 2BHIA 3EVSC 5IMYC 2H7ZA 1B41B 4LFTA 1BXPA 2MUOA 3NEQA 1IQ9A 1M9ZA 1QKEA 1JBDA 1ONJA 1CXNA 4FAOE 1CTXA 1MR6A 3LAQU 2ABXA 3KFDI 1IDHA 1W6BA 2MJ0A 4KSNA 2H64C 2H7ZB 1CDSA 1NTNA 2QJAC 4P7UA 5DO6A 1KFHA 4QTIU 4OM4A 2HLRA 1IKCA 1NTXA 1FF4A 1KXIA 2H64B 3KFDE 1V6PA 2MHYA 2I9BE 1CCQA 1HOYA 1IDIA 1FRAA 1NXBA 1IK8A 2K3GA 1NEAA 1NYSA 1IDLA 4IYEA 4XJJA 1RGJA 1CDQA 1JE9A 5DU1A 1TXBA 3QB4B 1KU6B 1KC4A 3U73U 1KS6A 2NBTA 4AEAA 1CB9A 1HAAA 2QJBC 3NDSA 1QM7A 1UG4A 1ERAA 4OM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1COE A;  2H62 C;  2MFA A;  2OFS A;  5DZ5 A;  1TXA A;  6EBX A;  1CDT A;  1NYU A;  2LA1 A;  1TGX A;  1BTE A;  2J8B A;  1I02 A;  1LXG A;  1TFS A;  1KBA A;  1FSS B;  2L03 A;  1DRS A;  1YWH A;  1QKD A;  1CXO A;  1F8U B;  1KBT A;  2CRS A;  3U74 U;  1G6M A;  1IDG A;  2MUP A;  4BIK B;  2LCR A;  2CRT A;  1IJC A;  2N99 A;  2QC1 A;  1FSC A;  2UWR A;  5EBX A;  4RUD A;  2H8U A;  2MJ4 A;  2ERA A;  2PJY C;  3BT2 U;  4EY8 B;  2MJY A;  1XT3 A;  2FD6 U;  2JVE A;  4ZQY A;  3NH7 A;  1VB0 A;  1S4Y A;  2CDX A;  1F94 A;  3FEV A;  2CTX A;  1ES7 B;  1HC9 A;  1LJZ A;  1CDR A;  2HLQ A;  1KTZ B;  1CRF A;  1ABT A;  2PJY B;  3ERA A;  1JGK A;  1MAH F;  2JQP A;  1FAS A;  1LSI A;  3VTS A;  1KL8 A;  2L5S A;  3BT1 U;  1HAJ A;  1HC9 B;  2QJ9 C;  2CCX A;  1LXH A;  1ZAD A;  1KBS A;  2GOO C;  3PLC A;  1CVO A;  1L4W A;  2X8B B;  1COD A;  1REW C;  1FFJ A;  2H5F A;  2VLW A;  4BDT B;  4DO8 A;  1RL5 A;  2BTX A;  1CRE A;  1PLO A;  2UX2 A;  4FAO C;  3HH7 A;  5IMT D;  4UY2 C;  1NOR A;  4HQP F;  3EBX A;  2GOO B;  1LX5 B;  2H62 D;  1H0J A;  1ERG A;  1CHV S;  2BHI A;  3EVS C;  5IMY C;  2H7Z A;  1B41 B;  4LFT A;  1BXP A;  2MUO A;  3NEQ A;  1IQ9 A;  1M9Z A;  1QKE A;  1JBD A;  1ONJ A;  1CXN A;  4FAO E;  1CTX A;  1MR6 A;  3LAQ U;  2ABX A;  3KFD I;  1IDH A;  1W6B A;  2MJ0 A;  2H64 C;  2H7Z B;  1CDS A;  1NTN A;  2QJA C;  4P7U A;  5DO6 A;  1KFH A;  4QTI U;  4OM4 A;  2HLR A;  1IKC A;  1NTX A;  1FF4 A;  1KXI A;  2H64 B;  3KFD E;  1V6P A;  2MHY A;  2I9B E;  1CCQ A;  1HOY A;  1IDI A;  1FRA A;  1NXB A;  1IK8 A;  2K3G A;  1NEA A;  1NYS A;  1IDL A;  4IYE A;  4XJJ A;  1RGJ A;  1CDQ A;  1JE9 A;  5DU1 A;  1TXB A;  3QB4 B;  1KU6 B;  1KC4 A;  3U73 U;  1KS6 A;  2NBT A;  4AEA A;  1CB9 A;  1HAA A;  2QJB C;  3NDS A;  1QM7 A;  1UG4 A;  1ERA A;  4OM5 A; 
#chains in the Genus database with same CATH topology
 1COE A;  2H62 C;  2MFA A;  2OFS A;  5DZ5 A;  1TXA A;  6EBX A;  1CDT A;  1NYU A;  2LA1 A;  1TGX A;  1BTE A;  2J8B A;  1I02 A;  1LXG A;  1TFS A;  1KBA A;  1FSS B;  2L03 A;  1DRS A;  1YWH A;  1QKD A;  1CXO A;  1F8U B;  1KBT A;  2CRS A;  3U74 U;  1G6M A;  1IDG A;  2MUP A;  4BIK B;  2LCR A;  2CRT A;  1IJC A;  2N99 A;  2QC1 A;  1FSC A;  2UWR A;  5EBX A;  4RUD A;  2H8U A;  2MJ4 A;  2ERA A;  2PJY C;  3BT2 U;  4EY8 B;  2MJY A;  1XT3 A;  2FD6 U;  2JVE A;  4ZQY A;  3NH7 A;  1VB0 A;  1S4Y A;  2CDX A;  1F94 A;  3FEV A;  2CTX A;  1ES7 B;  1HC9 A;  1LJZ A;  1CDR A;  2HLQ A;  1KTZ B;  1CRF A;  1ABT A;  2PJY B;  3ERA A;  1JGK A;  1MAH F;  2JQP A;  1FAS A;  1LSI A;  3VTS A;  1KL8 A;  2L5S A;  3BT1 U;  1HAJ A;  1HC9 B;  2QJ9 C;  2CCX A;  1LXH A;  1ZAD A;  1KBS A;  2GOO C;  3PLC A;  1CVO A;  1L4W A;  2X8B B;  1COD A;  1REW C;  1FFJ A;  2H5F A;  2VLW A;  4BDT B;  4DO8 A;  1RL5 A;  2BTX A;  1CRE A;  1PLO A;  2UX2 A;  4FAO C;  3HH7 A;  5IMT D;  4UY2 C;  1NOR A;  4HQP F;  3EBX A;  2GOO B;  1LX5 B;  2H62 D;  1H0J A;  1ERG A;  1CHV S;  2BHI A;  3EVS C;  5IMY C;  2H7Z A;  1B41 B;  4LFT A;  1BXP A;  2MUO A;  3NEQ A;  1IQ9 A;  1M9Z A;  1QKE A;  1JBD A;  1ONJ A;  1CXN A;  4FAO E;  1CTX A;  1MR6 A;  3LAQ U;  2ABX A;  3KFD I;  1IDH A;  1W6B A;  2MJ0 A;  4KSN A;  2H64 C;  2H7Z B;  1CDS A;  1NTN A;  2QJA C;  4P7U A;  5DO6 A;  1KFH A;  4QTI U;  4OM4 A;  2HLR A;  1IKC A;  1NTX A;  1FF4 A;  1KXI A;  2H64 B;  3KFD E;  1V6P A;  2MHY A;  2I9B E;  1CCQ A;  1HOY A;  1IDI A;  1FRA A;  1NXB A;  1IK8 A;  2K3G A;  1NEA A;  1NYS A;  1IDL A;  4IYE A;  4XJJ A;  1RGJ A;  1CDQ A;  1JE9 A;  5DU1 A;  1TXB A;  3QB4 B;  1KU6 B;  1KC4 A;  3U73 U;  1KS6 A;  2NBT A;  4AEA A;  1CB9 A;  1HAA A;  2QJB C;  3NDS A;  1QM7 A;  1UG4 A;  1ERA A;  4OM5 A; 
#chains in the Genus database with same CATH homology
 1COE A;  2H62 C;  2MFA A;  2OFS A;  5DZ5 A;  1TXA A;  6EBX A;  1CDT A;  1NYU A;  2LA1 A;  1TGX A;  1BTE A;  2J8B A;  1I02 A;  1LXG A;  1TFS A;  1KBA A;  1FSS B;  2L03 A;  1DRS A;  1YWH A;  1QKD A;  1CXO A;  1F8U B;  1KBT A;  2CRS A;  3U74 U;  1G6M A;  1IDG A;  2MUP A;  4BIK B;  2LCR A;  2CRT A;  1IJC A;  2N99 A;  2QC1 A;  1FSC A;  2UWR A;  5EBX A;  4RUD A;  2H8U A;  2MJ4 A;  2ERA A;  2PJY C;  3BT2 U;  4EY8 B;  2MJY A;  1XT3 A;  2FD6 U;  2JVE A;  4ZQY A;  3NH7 A;  1VB0 A;  1S4Y A;  2CDX A;  1F94 A;  3FEV A;  2CTX A;  1ES7 B;  1HC9 A;  1LJZ A;  1CDR A;  2HLQ A;  1KTZ B;  1CRF A;  1ABT A;  2PJY B;  3ERA A;  1JGK A;  1MAH F;  2JQP A;  1FAS A;  1LSI A;  3VTS A;  1KL8 A;  2L5S A;  3BT1 U;  1HAJ A;  1HC9 B;  2QJ9 C;  2CCX A;  1LXH A;  1ZAD A;  1KBS A;  2GOO C;  3PLC A;  1CVO A;  1L4W A;  2X8B B;  1COD A;  1REW C;  1FFJ A;  2H5F A;  2VLW A;  4BDT B;  4DO8 A;  1RL5 A;  2BTX A;  1CRE A;  1PLO A;  2UX2 A;  4FAO C;  3HH7 A;  5IMT D;  4UY2 C;  1NOR A;  4HQP F;  3EBX A;  2GOO B;  1LX5 B;  2H62 D;  1H0J A;  1ERG A;  1CHV S;  2BHI A;  3EVS C;  5IMY C;  2H7Z A;  1B41 B;  4LFT A;  1BXP A;  2MUO A;  3NEQ A;  1IQ9 A;  1M9Z A;  1QKE A;  1JBD A;  1ONJ A;  1CXN A;  4FAO E;  1CTX A;  1MR6 A;  3LAQ U;  2ABX A;  3KFD I;  1IDH A;  1W6B A;  2MJ0 A;  4KSN A;  2H64 C;  2H7Z B;  1CDS A;  1NTN A;  2QJA C;  4P7U A;  5DO6 A;  1KFH A;  4QTI U;  4OM4 A;  2HLR A;  1IKC A;  1NTX A;  1FF4 A;  1KXI A;  2H64 B;  3KFD E;  1V6P A;  2MHY A;  2I9B E;  1CCQ A;  1HOY A;  1IDI A;  1FRA A;  1NXB A;  1IK8 A;  2K3G A;  1NEA A;  1NYS A;  1IDL A;  4IYE A;  4XJJ A;  1RGJ A;  1CDQ A;  1JE9 A;  5DU1 A;  1TXB A;  3QB4 B;  1KU6 B;  1KC4 A;  3U73 U;  1KS6 A;  2NBT A;  4AEA A;  1CB9 A;  1HAA A;  2QJB C;  3NDS A;  1QM7 A;  1UG4 A;  1ERA A;  4OM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...