1IKXB

K103n mutant hiv-1 reverse transcriptase in complex with the inhibitor pnu142721
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POL POLYPROTEIN
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 110
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikxB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxB03
4MIBA 4XPEA 4DEZA 1UWBB 3LP0B 2ILZA 2IM0A 2WCXA 3ISND 4Y2AA 5J2PA 4KV8B 5KFKA 4H54A 1EETA 4ICLA 4QWBA 4KO0A 5KFFA 3H4BA 2C28A 4J9SA 2VG6A 3V6HA 3CJ2A 3DRPA 1JIHA 4ECZA 2VA3A 1TL3A 3KLFB 4IH5A 3CDEA 4Q0BA 4O4RA 1HPZA 1EETB 1FKPB 3KLGA 3TQ1A 3BQ2A 3T5JA 1RT3B 1J5OA 4ZPBA 2ILYA 1HYSB 1SH3A 3IRXA 4RW4B 1S0OA 4K4UA 4O3QA 3DRPB 4KE5A 2YNIA 1RT5A 4NZ0A 4Q0BB 1NNDA 3BQ1A 4RUAA 4JV2A 4NLXA 4F50A 4LQ3A 2OPSA 1N5YA 3MR6A 2I5JB 4IDKA 5KFSA 1TP7A 2W7PA 4O4GA 2V9WA 2YNIB 3Q8RB 5C25B 3T5KA 3SFUA 4K4TA 4O44A 1BQNA 2FLNA 5KFJA 4RW9A 3NL0A 4DL2A 1TKXA 1N4LA 1N5YB 3M8QA 5F9LA 3KJVB 3PR5B 3KHHA 4IRCA 4TY8A 3ISNC 4ZPAA 1BQMB 5KG4A 4EYIB 4QWDA 1NHUA 4MKAA 3RB0A 3QLHA 3QO9B 1IKXA 1TKXB 3DM2B 2FVSA 1MU2B 2XI3A 3PR4A 2JEIA 2YKMB 2UVVA 3CJ0A 3PJXA 3H98A 4I2QA 4KFBA 2FJXA 5KG6A 2XGPA 2HNDA 3CDWA 5C5JA 2ASJA 4MK8A 3PVXA 5EWGA 3RBEA 1D0EA 3DMJB 1K1SA 3QLHB 4O3RA 2VA2A 3BREA 3ITHB 4MK9A 3M9NB 4ED8A 3LAMA 3DLGA 1S1WB 5L1LA 4ED3A 1JLEA 3I0RA 4R8UA 3KLHA 4RW7B 3T19A 1TQLA 3GIKA 3JSMB 1OS5A 4ECUA 4J9PA 4IR1A 2YNFA 3CVKA 4Q8FA 4Y3CA 1IKYA 4ZHRB 4EEYA 4MFBB 5FDLA 5J2NA 3OSNA 1HQEA 4IG3B 4IFYA 3MR5A 4YP3A 2ZD1B 4RNFA 1LWFA 2HNZA 4QPXA 2JLEA 2YKNB 4DL5A 5J2QA 3I5CA 3NGDA 1IKYB 3OLAA 5EWEA 2DPJA 3DRRA 3MEDB 2HWHA 2E9TA 1S1UA 3V81A 2C2EA 1RDRA 1HQEB 4ECYA 3MEGB 2E9RX 1JLQB 3RBDA 2OPPA 2HNZB 4I7FB 1KHVA 2J6SA 3DYAB 4IG0B 4LSNB 3DI6A 4ZMMA 4Q45A 1N6QB 3NBPA 3KNAA 1S1VB 2UVRA 1IKWA 1LWCB 3FFIB 3KMSA 5KG1A 4DG1B 3V81B 1R0AB 3OL9A 3RB4A 5J1EA 1XR6A 4WZQA 2OPPB 3TVKA 3QIPA 1C1CA 5L9XA 2YNGB 1C1BA 3KK1A 4QW9A 3N6LA 2HNYA 3IS9B 1S6PB 5KFWA 3KK3A 1S9EB 4URQU 4K4WA 2JC0A 4M95A 5F9NA 1S10A 1S49A 3DOKB 4O3SA 3E51A 1QE1A 2O5DA 1C1BB 2YNHA 2BRLA 2VG5B 2HNYB 3QGHA 1S1TA 3KK3B 2JEGA 1TKTA 4FBUA 4MK7A 1LWEB 5EDWA 3JYTB 1KLMB 2B5JA 3C6UB 1RTHA 4RW8A 4NLUA 2OPRB 4GC7A 3QGGA 4TYBA 5DG7A 3SI8A 3CO9A 2FVQA 3MR2A 2HAIA 3EPGA 3PHEA 3G6VA 4ED0A 3V6KA 3DOLB 5D3GA 3HVTA 4O3PA 4KKOA 1DTTB 2ASDA 1WNEA 4YR2A 4DL7A 2FLPA 1UWBA 4PQUB 3H2LA 5KT6A 3H40A 4KV8A 2FJVA 5KT5A 3IN5A 1HNVA 3BSNA 3NAHA 1S9FA 4RZRA 5F8GA 4KKOB 2CJQA 3QIDA 5DG9A 4Y2CA 1RTIB 3MF5A 3H5SA 5DQIA 4LSLB 3CJ5A 3KK2B 3KLFA 5CYMA 4YR3A 3GV5B 3OSPA 1N48A 1HNVB 4NLGA 4O3OA 1FKPA 2W8LA 3V4IB 4K4ZA 2BANB 1DTQB 1RT3A 2BQUA 5EWFA 3HHKA 1HYSA 3GYNA 3DRSA 4RW4A 4IH7A 2ALZA 2IM2A 1FK9A 4RW6B 5CYMB 1I6JA 3PJWA 4KAIA 4U7CA 3G6XA 4K4YA 2JC1A 2FVRA 5KFRA 3Q8PB 5C24B 3DRSB 2I5JA 3QZ7A 3H5XA 1FK9B 4ZP7A 2JEJA 3MFIA 5C25A 4NLTA 4R5PB 4NLDA 4H4OA 5I42A 5KG0A 3KJVA 2RF2B 5KFGA 2W9CA 2EC0A 1RT4A 1RA6A 3T5HA 3SFGA 2JEFA 2OH2A 4NLPA 1LW2B 1BQMA 4YR0A 1RT6A 2XCPA 3MECB 1RTDB 5F8NA 1REVB 2WTFA 3MTKA 4H4OB 3QO9A 5I42B 4H4MB 2QE5A 3GIMA 3DM2A 1MU2A 2W9CB 2YKMA 1RT4B 5KFMA 4ECVA 1RAJA 4Q44A 4IQXA 3BSOA 5J2MB 4K50A 1S48A 5KFQA 1RT6B 4ZVHA 3DMJA 3ITHA 3UPFA 2D41A 1S1WA 1S9GB 2XWYA 5KFIA 2GIRA 4RW7A 3MFHA 3JSMA 2D3UA 2CKWA 2IC3B 2E9ZA 3VQSA 4ZHRA 1RA7A 5KFBA 4ZPCA 4MFBA 1N56A 3I0SB 3DLKB 5KFPA 3CWJA 2UUTA 4IG3A 5KFEA 1IM4A 1Z4UA 2ZD1A 4G3IA 4NLRA 2YKNA 4NLWA 2WRMA 4ZPDA 2ZE2B 2WK4A 4YQWA 2W9BB 5CYQA 3GILA 4FBTA 3MEDA 2RDJA 5KFYA 4QWCA 3MEGA 1JLQA 4RNOA 3LALA 4I7FA 2I1RA 4ECXA 3DYAA 4IG0A 4LSNA 4XO0A 4DL6A 2C22A 2IBKA 4U6PA 1N6QA 1S1VA 5CYQB 4KBIA 1LWCA 3CJ4A 2XC9A 3FFIA 3KLIB 3PW0A 2BR0A 2UVWA 1NHVA 1JLCB 4DG1A 1R0AA 3NKYA 3BSAA 4WE1A 3KHRA 2GIQA 5DLFA 2BRKA 4ED6A 1SH0A 2WHOA 1HNIB 2YNGA 2HWIA 3IS9A 4ID5B 1S6PA 3FQLA 3PZPA 3LP1B 1S9EA 3H5UA 4K4SA 3HKWA 3DOKA 4WE1B 4IR9A 4J9NA 1JLFB 1IKVB 1D1UA 1C0UA 4XPCA 2VG5A 3E01B 4KB7A 3CJ3A 4RNMA 1GX5A 4IRKA 4FS1A 2XGQA 2D3ZA 4YMEA 1LWEA 3H4DA 3JYTA 1KLMA 2AX0A 3MEEA 4RUCA 3C6UA 4WYWA 3M9OB 1DLOB 2OPRA 1CSJA 1KHWA 3IG1B 4EO6A 1C0UB 5C42B 4R0EA 4NYZA 5DQGA 1JLAB 1JLBB 4RU9A 2J6UA 2B6AB 1TVRB 2W7OA 2BQ3A 3OL7A 2FVCA 5KFDA 4M94A 5KFZA 2AGPA 3MEEB 3DOLA 1DTTA 2IM3A 5DGAA 5KG2A 1EP4B 3I5BA 3EZUA 5L1JA 4PQUA 3IGNA 4O3NA 2HMIB 5JXSA 5KFOA 3KLEA 2AWZA 2ASLA 2R8KA 2C2RA 2WONB 3FQKA 4ED7A 3Q8SB 2V4QA 4ECTA 1RTIA 4ZP6A 2QV6A 1TL1A 4J9MA 4LSLA 5KFCA 4PUOB 4IFVB 3KK2A 4J9OA 1RT1B 3KMQA 3I5AA 1C0TB 3KLEB 3UQSA 1S1XB 5F8LA 5KFAA 3V4IA 1RTJB 3BSCA 4X2BA 2BANA 1DTQA 3LP2A 2DPIA 5KT7A 4K4VA 4F4YA 3HVAA 1TL1B 4EBCA 1XR7A 3G6YA 2R2UA 4ECSA 3KHLA 4RW6A 1TV6B 1VRUB 3RB6A 3T1AA 3GIJA 1TKZB 1LW0A 1RT2B 5KFXA 3IGVA 3T5LA 3LP2B 4Q8EA 1HMVB 1XR5A 2UVUA 5C24A 5HLFB 1JKHB 2GC8A 3GIIA 1U09A 3C6TB 4B3OB 3DDKA 4Y34A 5HBMB 4JUZA 4IRDA 4I2PB 3OL6A 1S97A 4R5PA 1LW0B 5HROA 4KHMA 3PW2A 2RF2A 1SUQB 4ZP8A 4Q43A 4TQSA 1FKOB 2XCAA 5F8MA 1LW2A 4WFZA 3OL8A 3RB3A 3MECA 1RTDA 2B43A 3G86A 4TYAA 1REVA 4FS2A 1MMLA 4KSEB 4H4MA 5HROB 3V6DB 1T03A 4WFYA 3FRZA 1S6QB 4QWEA 2V4RA 5L1KA 3LAKA 5J2MA 1VRTA 1JX4A 4QW8A 2D7SA 2ZKUA 4JV1A 2AGOA 3D28A 4J9LA 4DL4A 5J2PB 2F8EX 4GC6A 4WYLA 4ICLB 5F8IA 1T03B 3QGIA 2W9AA 3QYYA 1S9GA 4KO0B 2VG6B 1VRTB 4EO8A 3GV7B 3BR9A 2FLLA 2IC3A 4DL3A 1TL3B 1QAJA 2FVPA 4TY9A 1T3NA 1T94A 1HPZB 1GX6A 3I0SA 3DLKA 4PWDA 1S0NA 3N6MA 4URSA 3KLGB 2R8HA 2XI2A 3FDSA 5JUMA 5L1IA 1J5OB 4EYHB 4RNHA 1JLGA 3IRXB 4J9RA 4HKQA 4NLOA 5DG8A 4TLRA 2IM1A 2ZE2A 1RT5B 4MH8A 5KFNA 3KLVA 2W9BA 3FSIA 2AX1A 4TN2A 2FJWA 5I3UA 4PWDB 3ICLA 4NRUA 4OL8A 1W25A 5KG3A 2OPSB 2RDIA 1JLGB 3PW5A 2WOMA 4IDKB 5K14A 1ZTWA 3KHGA 4O4GB 3BGRA 4ED1A 3EPIA 4KHRA 4HYKA 4O44B 1BQNB 3KLIA 5I3UB 4RW9B 2BE2A 1JLCA 1T05A 3UR0A 5KG5A 2IA6A 2J6TA 3M8QB 3UDLA 2WOMB 3GQCA 1HNIA 4TY8B 5K14B 3RAQA 4G1QA 5DQHA 3BGRB 5DLGA 2R8IA 3PW7A 1HQUA 4ID5A 4QWAA 3LP1A 3RAXA 1T05B 2BE2B 1S4FA 4NRTA 3MR3A 1IKXB 3OLBA 3TAMA 5DGBA 1JLFA 1IKVA 4I2QB 4G1QB 4KFBB 2AU0A 5KFHA 4LQ9A 1HQUB 2HNDB 3E01A 4IH6A 4F4WA 1SH2A 1RT7A 2UUWA 1RYRA 2IAJA 4ECWA 2AQ4A 1S0MA 3TAMB 3D5MA 2R8JA 3DLGB 5HP1A 1ZTTA 1JLEB 3I0RB 4ZVFA 3KLHB 1DLOA 4NLYA 4R8UB 3IG1A 5EUHA 5C42A 1K1QA 5KT4A 2RKIA 2YNFB 1JLAA 1JLBA 4RNNA 3M8PA 4ECRA 1RT7B 3NAIA 2B6AA 2AGQA 1TVRA 5FDLB 4ZP9A 3H5YA 1JXLA 2IAJB 5J2NB 1RYSA 3Q8QB 4WXWA 3OHBA 3NMAA 5HP1B 4IFYB 4F4XA 1LWFB 4URGA 1EP4A 2RKIB 5J2QB 2IJNA 2R2TA 3M8PB 5T14A 2HMIA 4EBDA 3DRRB 3GV8B 1S1UB 2WONA 2IJFA 3OHAA 4WZMA 4ZVGA 3LANA 2ATLA 1SV5A 2BQRA 1QUVA 4EBEA 1ZETA 2WB4A 3DI6B 1YVFA 4ZVEA 4PUOA 4IFVA 4F4ZA 4WXOA 3NBPB 1RT1A 3DLEA 4NLSA 3QZ8A 1C0TA 1IKWB 1HARA 4TXSA 1S1XA 4J9KA 3PW4A 1RTJA 5KG7A 1SV5B 5J1EB 5KFLA 3BQ0A 5KFTA 3QIPB 1C2PA 1C1CB 4ECQA 3KK1B 3H59A 3BJYA 3N6NA 4J9QA 3HVWA 5KT2A 2W8KA 3DLEB 4MKBA 5KFUA 2R8GA 1TV6A 1VRUA 2OPQA 2R2SA 3KOAA 4NLQA 1TKZA 4ED2A 2C2DA 1RT2A 3M9MB 4K4XA 1HMVA 1QE1B 5HLFA 1JKHA 4IOBA 3C6TA 4B3OA 4MIAA 2YNHB 5HBMA 1S1TB 3CIZA 2OPQB 4I2PA 4TQRA 1TKTB 4IKAA 2VG7A 3CDUA 5KFVA 1SUQA 2B5JB 1FKOA 4NCGA 2V0NA 1RTHB 4RW8B 4NLVA 2R2RA 4JV0A 5KT3A 3V6JA 3LP0A 5F8HA 3V6DA 2VG7B 1QAIA 2IMWP 1S6QA 5D3GB 4WFXA 3HVTB 4NCGB 5F8JA
chains in the Genus database with same CATH superfamily
3PY8A 4MIBA 1IBMF 3K0JA 1B64A 5KFFA 3AQOA 5D15A 1NAQA 2OMOA 4UZCA 3CJQA 4Q0BA 1UA0A 3BQ2A 1U1KA 1J5OA 3MMBA 3FCWA 3KG4A 2HLUA 3K2YA 3D1QA 3TJ8A 1U1NA 1KKHA 3RRHA 1SJFA 1ZBTA 3CMQA 3SV3A 3JSBA 5KFJA 4RW9A 2UUAF 2CPJA 3TX8A 3K58A 3MOZA 1EKRA 2FVSA 3U27A 3CJ0A 3PJXA 2J7UA 1FFGB 2UXBF 3DMJB 2Y1IA 1TK5A 2VPYB 4K5RA 3F0NA 4OZ2A 1JLEA 1MLAA 3P5BP 4J9PA 4M5IA 2WSEC 3N9UC 3MD3A 4YUDA 3W8GA 4CLUA 3AH6A 2PC6A 1JNRB 1Y3KA 1RDRA 3GYXB 5GAHU 4ECYA 1JLQB 4WFAQ 3EXYA 3NG8A 4Q45A 2K06A 1Q53A 3QJJA 4DG1B 1XR6A 1C1CA 4K4WA 1NUEA 1UVIA 1NH8A 2HRYA 5E3AA 1EQMA 1GMUA 4FBUA 1ZZFA 4ZPVR 2V63A 2Q43A 4NLUA 1BQXA 2HAIA 4ZLNA 5CZXA 1DHMA 3BYRA 1DBDA 2E5JA 3CJ8A 1VQNS 1IWAA 4AL6A 2MGZB 2CJQA 2XMKA 2OFGX 3KLFA 5CYMA 7AT1B 4AQYF 1O8BA 3HHKA 4UOHA 4UW2A 2HFNA 2CZ9A 2OFHX 3WC2A 3C14B 5KFRA 2J7KA 3MFIA 1N8RT 2MYFA 3PTWA 4NLTA 1NSAA 2CPXA 4MAKA 5T7LA 1FCAA 3K8WA 5KFMA 1NB7A 1OSCA 1E6YA 4B9VA 2M9KA 2NREA 1YZ6A 3BF4A 2WAQD 2MPUA 5D77A 3R9LA 2VQFJ 1DJ0A 3CC7S 4RNOA 3A13A 5DDRC 3G82B 2GIQA 2GVDA 3IS9A 1S6PA 3QBCA 4K4SA 2GCFA 1HI0P 2LLZA 1NU4A 4D3GA 1YTYA 4HACB 3E01B 4CYUA 3U1NA 2XGQA 2LFVA 2G2OA 2DBBA 1JB0C 1C0UB 5DQGA 2FHJA 2RQ4A 1TVRB 3RJMB 1Q7LB 3OD2A 3VAJA 4Y65A 4KGZB 4ZLPA 2ACYA 4P6QA 4IFVB 2EPIA 3R1HA 1Y4ZB 2ZVSA 4EBCA 1TV6B 3T1AA 1JQGA 1TKZB 4JYAF 1Y5LB 5HLFB 1U1OA 3IR7B 2F8HA 2K2PA 4UOGA 2Y1LB 2D3OR 1NDCA 3EDRB 2K8GA 2CNKB 4OI4A 3NWRA 4CLSA 3QAUA 4LF6J 1KOOA 2XG8A 4I64A 4PWUA 3RRKA 5F0UA 4WYLA 4ICLB 2W9AA 1S9GA 1N34F 1YBUA 4WK1A 2DR5A 1GX6A 2V4JB 3RZAA 3KG0A 4DPUA 3DXSX 2FB0A 4NRUA 4OL8A 4ZA1A 1H2UX 1GAOA 3CUNA 1PYOB 3W8PA 4ED1A 1UWAA 2MQOA 4M1KA 1YJUA 3BH6B 2WOMB 1IBMJ 4I6YA 4I6AA 3BGRB 2JFDA 4FXWA 1T05B 4HTJA 2MKCA 4USKA 1Q7YT 5HN0A 1HQUB 2ZH1A 1SPBP 1TKDA 4R8UB 5K8OA 5A8KA 1RYSA 1ZM4A 2F4FA 2KN4A 1LWFB 4YB6A 2BJ1A 2HMIA 2WONA 3GB0A 2UUAJ 4NZ6A 3DI6B 4ZITA 3U7JA 3B4MA 4ANDA 4J9KA 5KG7A 4X4UA 2PFFB 5THWA 1HNWF 1H2TZ 1WWHA 4JBCA 2R8GA 2IBOA 4ZCLA 5M2RA 3M9MB 3FBEA 4OZ3A 3D0GE 1HA1A 3M6WA 4X4PA 2HW3A 2KHDA 2RE1A 4RW8B 4JV0A 3BS9A 1TAQA 2N4DA 1WHVA 5EN1A 1JXVA 2E7VA 4ZJQA 3TZWA 3J7A1 4JB8B 4ZN1A 5J2PA 1EETA 4B3RF 3OFGA 4DBQA 1JIHA 3GCWP 3TANA 2BVZA 2Z2ZA 1SH3A 2HGMA 4YDXA 1XQIA 1X4HA 1T9VA 4WP8A 5HJXA 1FE0A 1DFDA 1ZS6A 3MAQA 1CC8A 1MNEA 5B0FA 3W63A 3FSYA 1M1HA 2VA2A 2OP5A 3EGVA 4AE5A 3K5NA 4DN0A 4ED3A 4RW7B 3JSMB 2EFQA 4IR1A 1URRA 2KZMA 5J2NA 3VVTA 4DV7F 2HPUA 4QR0A 3RRGA 5IOLA 3NGDA 1X4EA 2NCKL 3DRRA 4I68A 1PO6A 2HNZB 1LFWA 3KNAA 1IKWA 1R0AB 3MWBA 3KTQA 5L9XA 2L48A 3O5TB 2ZKTA 2JC0A 4U8VA 1TL7A 1NKCA 2VDHA 5IC6B 2GJIA 1S1TA 2Y0BB 1LK7A 4ZVTB 5IT9U 4HT5A 3HD2A 4MK7A 4LF5F 1RTHA 1YGYA 5DG7A 3HHLC 3BR8A 4YN3B 2AEMA 4O3PA 2ASDA 3QRRA 3FEYB 1UWBA 3KNGA 1HNVA 2ZH2A 1PC5A 4Y2CA 5AJ3F 5E3QA 2RIJA 8ATCB 2BANB 2J8SA 3GCXP 2P9GA 3M2VB 3T9ZA 1RK8A 3CULA 2HEKA 1DY3A 3H5XA 3MI7X 4ATNA 4M5MA 1KQFB 4P2XA 4EZ9A 3KUEA 3KJVA 4WKYA 2UU9F 3KWMA 2R7SA 4LF7F 1B0PA 3FEZA 1F2GA 1WC0A 2KH9A 3MTKA 2O67A 4K50A 3D9BA 1LOUA 3UPFA 1QVGR 1P8GA 2CPDA 4KGXB 1Y0HA 2NXNA 5K9FA 3MM8B 1BXNA 4JYAJ 1Q0NA 3VGTA 2FHKA 1CC7A 2WK4A 3GILA 3MEDA 1GMVA 1UPMB 3FC9A 2APOA 3PDNA 1NHVA 1JNZB 3DGPB 1DZ5A 3VWSA 4UQTA 5A76A 4USJC 4AT1B 1NK0A 5A8RB 2BEFA 5A6WA 1VQLS 1N34J 2NXEA 2FLOA 2CQHA 1RU1A 2D74B 1M90T 2W7AA 5JMNA 4UQGA 3JYTA 1QTNB 1HLWA 2ZOGA 3OV7A 1RGVA 1HW8A 3EWGA 5KFZA 4M5NA 3GG0A 5KG2A 1C4AA 2EBEA 4GKKJ 3FQKA 2XBPA 4RR5A 1U2FA 2V4QA 1Q78A 4PQAA 3SSRA 1C0TB 2CPYA 1NK8A 4Z37A 5A0YA 1DTQA 4K4VA 3DXBA 4ECSA 3G6YA 2Y0SD 1RABB 3GIJA 3SMZA 1WC4A 2KT2A 2E1RA 1S7HA 3CC2S 3KXDA 3G4SS 1N5SA 4MIWA 3TRGA 4ZP8A 5H1SV 4WFZA 1H2VZ 2AJ2A 4ITSA 5HROB 1T11A 2XZDB 2V4RA 2CJBA 2CWKA 2VQEJ 4CI0B 4NWBA 1T0TV 3I96A 2DHXA 1HNWJ 4S0MA 3VGVA 2FLLA 2MZ1A 1QAJA 4WTOB 1UETA 2R8HA 5L1IA 1J5OB 3MMBB 3UE2A 1P27B 1HWJA 2IDEA 2PD1A 5BJRA 4YB7A 2CDRB 3QRQA 4RW9B 1JLCA 2W4CA 3A8JA 2MSTA 1D3WA 5HQ8A 5DLGA 4B3RJ 1FFSB 3MR3A 4UY8T 4CLPA 2VBXA 2FDNA 4Y6IA 1NBEB 3TP2A 2CZVC 1NHKL 1Y00A 5HP1A 1JLEB 4M63A 1JLAA 4K2XA 2MLYA 5BYSA 4OHWA 3DFEA 3GPAA 1XEZA 1SV5A 1WELA 2FPHX 4WXOA 3HULA 4F67A 2E29A 4TXSA 4WTYA 3QT8A 1C2PA 1C1CB 2QJ3A 3N6NA 3HVWA 4A48A 1EB0A 1T9TA 1NPPA 5B0DA 4WP9A 1HMVA 5K20B 4E0DA 4DV7J 4OJ1A 4RO0A 5HQMA 4O0IA 2KM8C 1M5OC 5KT3A 1YJNS 2XSJB 1RQ0A 1H6KX 2IMWP 4WFXA 4IUFA 3GJTB 2V69A 1LV5A 1WF1A 1F9HA 4DFJA 4FXVA 2DNKA 3KLFB 1HR0F 1RAFB 3IRXA 4KE5A 1VJWA 1RT5A 1SC6A 3SDEA 4LF5J 2G9OA 4DCOB 3MR6A 2FGCA 1UW4A 2DNGA 5G0RA 2FY1A 4DCJB 3AY0A 3QT5A 4LFBF 4ETZA 2ZJPQ 1S79A 1MMDA 1E6YB 3WIUA 1K1SA 4CZCA 3JXOA 5LL6d 4B3MF 3I0RA 4C11B 1SKUB 1FWKA 2XLIA 3T6BA 1RCOB 4IFYA 4DUZF 1IKYB 1PYTA 3H20A 3Q8YA 1ZAWA 4H4KC 4V1Ak 1KFSA 4LF7J 3NBPA 1LEOA 3CCQS 2W4DA 3NCPA 2Z0GA 3IS9B 1S6PB 3GONA 4EK2A 2Q79A 5GADU 2BRLA 1J5EF 2DR7A 1MROB 4CDIA 3DLHA 3ZNJ1 2GHVC 2MJNA 1KSPA 1NH7A 2KB2A 5A2QU 2IVYA 1SJ4P 1Y11A 3I56S 4MYUA 2K1RA 1FDAA 2ALZA 2IM2A 1VK8A 5DETA 4FYVB 3OTEA 1U2RA 4C0OC 2OEKA 3VGUA 1DARA 3EMTA 3QATA 1BQMA 4ES3A 2NS1B 4H4OB 3QO9A 1G2EA 1MU2A 2W9CB 4ZVOB 4X62F 1XTZA 1S9GB 1WEYA 4USMA 2BJ8A 1N56A 1XMOF 2XS2A 5KFPA 1JJCB 2J9EA 2HVDA 2YKNA 3OTOF 3VVUA 1K8AT 4ED4A 3DYAA 4IG0A 2J0SD 4NCAA 2ZUAA 1LWCA 3BB5A 1FRXA 4DPTA 2XY6A 1XJWB 2QTWA 1UEKA 1PGZA 4WE1B 4P74A 1ZPWX 4QU7A 3A3PB 2HSEB 4RNMA 3L7PA 1FE4A 3M9OB 1NJIT 2BJEA 2XYGB 2XEXA 2D9OA 4N8OA 3GR0A 4EWTA 4PXBA 1IBLF 2HMIB 5IZHA 1VYAA 2WONB 2JL9A 4NL5A 4J9MA 2X51A 4DV0J 4ZVSB 2GAHC 2RB7A 2J0XA 3AJDA 4DV4F 3A8KA 2UVUA 1HQ2A 1RAHB 2MDAA 3OFFA 5J1NA 2ADBA 3OL6A 2R7WA 3MAAA 4ZCMA 3HT3A 4U7UK 1PJ6A 3GJQB 1FERA 4J9LA 5J2PB 2HFOA 3AA9A 5F8IA 4V19X 3NS6A 4K0KF 4ZOSA 4PYAA 1RACB 1RTZA 1NSQA 3IBFB 3SCIE 1D9DA 2ZDOA 1RBAA 3TVZA 1BUXA 3MMCA 4OI2A 4TLRA 3KLVA 2Z30B 4LF1A 3LA0A 4YB5A 3KHGA 2IA6A 1FRJA 3LWLA 4BBYA 4OZLA 2HHQA 1HNIA 2EBGA 2LKZA 3DN9A 2C3UA 4C8OA 1HR0J 2H4YB 2AQ4A 3TAMB 2R8JA 5HJYA 1VK3A 2NR0A 2CQ2A 1NJXA 5J2NB 3DLLQ 1H3DA 4ANCA 2B4VA 1N54B 3DRRB 4LFBJ 3LUYA 1Q8KA 1TL4A 5IWAJ 4NLSA 3IWLA 1IKWB 1S1XA 4A4JA 4BWMA 4ZJLA 4K7QA 5F3ZA 1JJ2R 5KFUA 2BV3A 4JP8A 4C2MA 4CNZA 5M2UA 2H5EA 1VHFA 1VQ7S 1S1TB 4IKAA 3CDUA 3QSYB 1RTHB 4DUZJ 1C4CA 2RD5C 3GU0A 4OYPA 2YX7A 2KFZA 4CLFA 5F8JA 1U0SA 2GV1A 1I94J 1UWBB 3LP0B 2ZHOA 3MOJB 3R7BB 4AL7A 1N5QA 2VG6A 4A8XA 2ILYA 1RXOB 2DO0A 1J5EJ 2ZUGA 2PDAA 1NNDA 3ZTRA 1T7PA 2AJ0A 3WQPA 4AYBD 4DQQA 3HXMA 1KQGB 2HZAA 3KJVB 1K0VA 5DRKA 2XLKA 3QLHA 2XB2D 2DD8S 2NQPA 4I2QA 4O3RA 3M9NB 4ED8A 4WFBQ 4DX6A 3GIKA 3CVKA 1FEHA 1TUWA 1IR2A 4PKDB 2RRBA 1S5ZA 4RNFA 3ENVA 3G87A 2LA6A 3I5CA 2L9NA 2O1PA 3MEDB 2OPPA 4M5DA 3SQGA 3Q2SC 1D9FA 4I6WA 5J1EA 4WZQA 2W25A 5KTQA 3AODA 2HQFA 1OPZA 3G8QA 2DITA 2CNOB 4G6VB 4HLBA 3UFCX 1XMOJ 3JYTB 3DDIA 1VHIA 4QBUA 2HAFA 3OTOJ 2GNKA 1NM2A 3GFZA 2AW0A 2NSCA 2Q1LA 2Z8QA 4QCLA 1IBKF 4KKOA 2FLPA 1KTQA 1NSPA 2C3YA 3H2LA 3IN5A 2CNLB 5F8GA 3MF5A 2ZBQA 2B51A 3OSPA 4OJ3A 5A0YB 1DTQB 5EHHA 1D09B 1LXNA 1F9EB 2DH9A 2PT0A 4RWXA 1T9XA 2YWGA 3U02A 1ZM3A 2MEWA 1NMEB 1SC3B 1OYDA 1RWMB 1F60B 3QRPA 4A8MP 3VQSA 4ZHRA 4JI3F 3CTRA 3TUIC 3VR1A 3M1VA 1NRKA 4DR2J 3UD3P 5KFYA 3SYZA 1CG2A 2XSFA 1VQYA 1VR6A 1U6BA 1JLCB 1VLYA 4ZVRB 3NKYA 3BSAA 2YNGA 2HWIA 5SZTA 5HSPA 3PZPA 4PEOA 3IC1A 1TFYA 4K0KJ 2HBQB 2VG5A 2AYBA 1AYEA 5GAHI 2QIFA 2WVCA 3HFVA 4IQXA 1VCTA 1JLAB 2BQ3A 4QIEA 2NXCA 1KWMA 2HKEA 2VZ9A 2R3VA 1G7CB 4PQUA 3NCQA 2XMVA 3W5XA 3WHIA 4RBTA 1YRTA 2NPFA 3FCHA 1RWNB 5LMUF 3I5AA 4UZBA 1ZZNA 5F8LA 1S77D 1HKAA 2V2ZA 2W2QP 4U8YA 1YRUA 5GAGI 2DHGA 3IGVA 1HMVB 2GC8A 1B4SA 1CVJA 3EGZA 1N36F 1WEZA 3W5ZA 3RU0A 2OSQA 2YWHA 2AF6A 2B43A 1GEHA 2E5LF 4CM0A 4WKRA 2D7SA 2A18A 1T03B 4X64F 2MQPA 2VU5A 3LOUA 4JV5J 4G1PA 2Z58B 1IM6A 2XI2A 3IRXB 1JMTA 4MH8A 1RT5B 2EG2A 3SDEB 2JVRA 4A46A 1JLGB 4CO2A 4QU6A 4LBHA 5JVGQ 2W2OP 2R9LA 1S4FA 1XNRJ 1DQ9A 3OPKA 1VDHA 1UCNA 2D1CA 2QSFA 3ZXWA 4FZVA 1SJ1A 3I0RB 3IG1A 4R0JA 3TWZA 4OLPA 4IFYB 3OQ2A 2IJNA 2R2TA 2PGCA 1FTCA 1IJEB 1YVFA 4QIFA 3NBPB 1KVKA 5CCMA 1GXTA 1EAYC 5CH7B 1RTJA 5HMZA 2W2MP 1RADB 2I2YA 2PFDA 2OPQA 2RQCA 3G6ES 4L3NA 2Z2MA 3GE9A 2LU2A 3MGJA 1M5PC 4IO1A 5DZ6A 2R2RA 1N0UA 3V6JA 3HHDA 2VG7B 1ELOA 2DGXA 3N5FA 5ETMA 2J5AA 4J5OA 4WWSA 5MAOA 4OMFG 3TR5A 4L3KA 2K1RB 2F8MA 3RYLA 3ADAC 1Q81T 1S0OA 2B9XA 2BKOA 5D0HA 4PPZA 2DR8A 1X4CA 3LTOA 4F50A 3P6YC 3PKMA 2ACMA 4QYZK 2YNIB 4P71A 1IBKJ 4Z2XA 2ZBCA 4IRCA 3M8QA 1BQMB 3RB0A 3QO9B 3SSQA 1MU2B 4X4VA 5K5MA 3FK4A 3VAKA 3MPWA 3M2RA 3LAMA 1P1LA 1BGXT 2GA7A 3FRYA 4EEYA 2QMUB 3IA0A 3MR5A 3PIOQ 3ZZOA 2YKNB 2O66A 3OLAA 2E9RX 1M5HA 2QT7A 3DYAB 4IG0B 1RB0A 2C2OB 4USIA 1KNZA 1Q1KA 4FKYA 1LWCB 5KG1A 2J9CA 1NPKA 3CD7A 4DUTA 4QW9A 3N6LA 1KS2A 3RGIA 4M95A 4A8KA 3P96A 2YNHA 1RWVB 2B5JA 3EXCX 3D3CJ 5B08A 1R89A 2DISA 5G4DA 5D3GA 2VL1A 3HVTA 1WF2A 4PXDA 4DL7A 1R8AA 2G1DA 2MTLA 4ENOA 4OLOA 3AQPA 1U0HA 4ZIWA 4RW4A 4QOTA 3PJWA 1NDPA 1ZYQA 3IAM9 4K4YA 4ELTA 3BN7A 2QA4G 2RHQB 2DH7A 4NLDA 3MAAB 3PNIA 1KN6A 1EX8A 2ZOFA 5EX0A 1V3RA 2KI2A 4Q44A 2OHDA 5KFQA 3UVJA 4ZVHA 1YI2S 5KFIA 2CNNB 2D3UA 4J9VA 2M0GB 1IM4A 1Z4UA 5GVQA 3MMCB 4G3IA 4HDGA 1N36J 3ZZPA 1RJJA 3W2VA 4NLWA 1NZAA 3CNQP 3ZZYA 3D6HB 3ET6B 2LQ8A 2I1RA 2E5LJ 4JI8F 2BR0A 3OW2R 5D4NA 3HKZD 3D67A 1Y3JA 2CG4A 1HNIB 4KH0B 2CPZA 2OO4A 4X64J 4DV3F 5ADZA 5H9EJ 4DV6F 3CC4S 2DXEA 2E1CA 4F0MA 1Q16B 4FS1A 4ER8A 4YMEA 3H4DA 4F25A 2AX0A 2BX6A 3CDBA 2PMHA 3MUTP 4JI2F 5AE2A 3ZO7A 3R5JB 2X3GA 3VALA 2BBEA 2SXLA 2GFFA 1CQNA 4DR4F 1BD6A 4OYXA 2BDPA 4FNIA 2AP6A 1S1XB 3V4IA 2H5IB 5KT7A 1D8ZA 1LW0A 1VQKS 5C24A 2VC1A 1S97A 1YK9A 3KKFA 3P45B 5HANA 2OJ3A 1R0BG 3M2UA 3OTDA 4OIXA 2C2KB 3SIPB 3CJRA 2AJ1A 3BV8A 2HZVA 3DRYA 2VG6B 3L4BC 3BR9A 3PYDA 1GXLA 2PIIA 2CVIA 4MKYA 4B3TJ 1YJWS 2IM1A 2LA4A 4TN2A 4B9NA 4PWDB 1X60A 2HQCA 2R7OA 4J7CA 2QLJB 2EK6A 3MTJA 4KHRA 3UR0A 2BE2A 3RAQA 4G1QA 2OUGA 3LP1A 3K5MA 4NRTA 1XNQJ 4OYOA 2CJ9A 3BDEA 2RHSB 4I2QB 3WDOA 2CQ4A 1RWKB 4EU0A 1OSDA 2E1MC 3R1LA 4WBFA 1R0CB 1ZTTA 2P9CA 2DH8A 4GO5X 1VQ9S 2CQGA 3KJFB 1T3OA 2QLXA 2IAJB 2AJFE 4WXWA 3NMAA 2XZTB 1FO1A 2ATLA 4M5DB 3SQGB 5J1EB 1URNA 2V50A 2A6OA 3T3FA 1U6FA 2P8IA 4C9DA 4LIRA 3ZZRA 1MWQA 2GMJA 1Q79A 1WSRA 1FKOA 3AD9C 3M8SA 1FDDA 1EQ0A 4B08A 1L3TA 2LQ5A 3EVMA 4Y2AA 2RMLA 2I8EA 4H54A 2C3OA 4QWBA 1U24A 2O3DA 2DNZA 3A8EA 2FJEB 3FZ2A 3RAMA 4LBPA 3JS9A 4ZPBA 2EG1A 2AEJA 2G0JA 3D6FB 2MY7A 3AOAA 1GFWB 1F9FA 3CEDA 1NKBA 1FDNA 3MAHA 1N5YB 3IWXA 3BGFA 5GMEA 4ZLLA 4QWDA 5DDOC 2C3MA 2FJXA 3RBEA 1D0EA 2BE7D 2B9YA 4HHHA 3W2WA 2CFXA 2IHR1 3ENWA 4ZHRB 5FDLA 4OX7A 1YDLA 4YP3A 2CJYB 1WG5A 2JLEA 4RPFA 2KJVA 4JOUA 2YKQA 2HWHA 4HH1A 1RKJA 2J9DA 3UCZP 3C8YA 1TZ0A 3EVWA 3G8SA 1GNKA 2KHCA 3TJ9A 3RB4A 3TVKA 2YNGB 3FMWA 4CO3A 2O5DA 2VG5B 2HNYB 2KDOA 2JSXA 4GC7A 5HMYA 1G3OA 4OX8A 5E2QA 4ED0A 2K7KA 1YIJS 2KL8A 1WNEA 5DO2A 3VAMA 4PQUB 1AFJA 1NPRA 4F8RA 1PAUB 1PC4A 3IP0A 3IO1A 1LNQA 5DG9A 4N56A 1UJ4A 4DV3J 3O6QA 1FKPA 3KJQB 2BQUA 4DV6J 2PI5A 2U2FA 4KAIA 3BPSP 2JC1A 2I5JA 2EC2A 4JI2J 2ZM6F 3I87A 4QIWD 4U67Q 4YR0A 4DR4J 3EUNA 1PKUA 1RT4B 4DF8A 3D68A 2CPFA 1RT6B 5GAEU 1NDKA 2CPIA 2FY8A 3ITHA 2E44A 4FF3A 3MFHA 4IOCQ 2G2ZA 4Y2MA 1RA7A 4A8YA 2K3IA 1KVIA 2F1FA 1UEUA 4FBTA 2BUNA 3TI0A 1BLUA 4DL6A 1RZMA 4U6PA 5AXNA 3UN3A 3HZGA 4OYIA 2YKPA 5A8WB 4HACA 1X9SA 3I4PA 4NPOA 3H5UA 4Q2LA 4RU2A 5MLCV 1N52B 3FNNA 1C0UA 4J91A 1WDDA 1GX5A 8AT1B 1TU0B 2Z57B 2QEXS 3H7HB 3IG1B 1FX4A 1Q5VA 2LECA 3MEEB 2ZNZA 2ZC3A 2ZZNA 1QAXA 1KP6A 4DX7A 4FF4A 5GADI 1UTAA 3Q8SB 2PE8A 2ZWOA 1RTIA 2BJ9A 3MPVA 3LGHA 4B9UA 3T9NA 4X2BA 1RTJB 3T1HF 1WOPA 4OV1A 4FVMA 4ZVUB 1NLKL 2IYGA 3P5TL 2ZJQQ 3HJFA 3LP2B 1XR5A 3GIIA 1R8HA 5I3PA 2ZH6A 3PX6A 1U25A 4IRDA 2YWFA 2OD4A 4ZPTR 4TQSA 4Q43A 1KFDA 3KUHA 2HBZB 3MECA 2VKZG 1T9YA 4A8QA 4WFYA 1VS3A 4DQPA 3V2UC 4OYBA 1ZH5A 1OMSA 4DLEA 2V4JA 3GFHA 1XMQJ 4A8SA 1VOMA 1UVNA 4P7VA 4EYHB 4C3MA 3HCXA 4K8RA 3FBCA 1PILA 4WJBA 3TVYA 3Q89A 3CJTA 1PCAA 2HG4A 2WOMA 4JI4J 3BGRA 2X1GA 1T05A 4NEYA 3M8QB 1T8EA 2DVIA 4GMKA 1HQUA 5KFHA 2RUSA 3NGTA 1BWEA 3M2RB 3L3CA 2FYXA 1RWOB 3HHLD 5FIIA 3M8PB 4EBDA 1HD1A 1NK9A 4KY3A 2R7QA 1CJVA 4L76A 4B9SA 1Q82T 4C7QA 2VJVA 3SCKE 3DLEB 4CTAB 3IR6B 3MR7A 4YB1P 5CD4A 4PYDA 2YNHB 3QJLA 2DNLA 1ZM9A 1YJRA 2KRRA 1L3UA 3TARA 3VAGA 4NE9C 2B5JB 4KC5A 3NNCA 1X0PA 1U1LA 3V6DA 1QAIA 1KLNA 5D3GB 3HVTB 2LDYA 4G65A 1M5VC 2KU7A 4ECZA 1U0HB 4N47A 1TL3A 1SQEA 1SC1B 3JAMY 4RW4B 3Q22A 2MKIA 4R25A 1H98A 4C8ZA 1NEEA 2HK3A 5LMNJ 4IDKA 1TP7A 4P72A 5SUHA 5D0EA 3T5KA 1T95A 2VASA 3OXLA 3CMES 2WW8A 3MPUB 4HI2A 1BY9A 3HJVA 4NX9A 2JEIA 1VQOS 4KFBA 3EZ5A 3UVJB 2HVHA 2FIUA 1B7FA 1TQLA 3FCVA 1KBRA 5B0BA 4QPXA 2HNZA 4DV2J 3W2VB 3EZOA 2L08A 2ZM6J 2LXFA 2C2EA 2F9DA 1WKJA 1RHKB 2QLWA 5BYQA 3OL9A 2HFUA 2XO6A 2YWEA 2EI5A 3SV4A 1U8WA 3CW2C 4A47A 1C1BB 2R7TA 3QGHA 3UWTA 5EDWA 3MPDA 4TU8A 4OI6A 3MEKA 3OXFA 2R7XA 1LQ9A 3H40A 2V5HG 1S9FA 2N3LA 2MXYA 3RR7A 2HGNA 3EGNA 5K8PA 5DQIA 3H5SA 1OJ4A 4K4ZA 3V4IB 3NWGA 4M5JA 3WZ0A 3ZTPA 4DR5F 4NA1A 1RHMB 2GGPA 5C24B 1LK5A 3B8HA 1FK9B 2JEJA 1RLDA 5C25A 1MN7A 4DN9A 3IRWP 4U7UD 1X31C 2MZQA 2DNNA 1H73A 3TOQA 2CQIA 3T1HJ 2H65B 4WIIA 4C3KA 3R7SB 1QY7A 4IG3A 2BJDA 2MHNA 1DQAA 4YY3F 1Y9OA 4YQWA 3H2VE 2IBKA 1ZOTA 3EX7B 2XHCA 5EX3A 1FRMA 3KHRA 1U1RA 1N33F 2RVJA 2WHOA 3ETOA 2AYMA 1OO0B 4KJIA 3LP1B 3NP5A 4QZVB 1ACMB 3VZIA 2C2ZB 2IDLA 3C15B 1SIZA 3JTPA 3CD5A 3C6UA 4GO7X 1R7IA 1D8YA 2FZCB 3RTVA 1GMWA 3LF0A 1FD8A 2IM3A 1NSKL 3M6XA 2ALYB 3UO0A 4LF8J 3X3UA 3LPYA 4PG8A 4DLGA 3KMQA 4WF9Q 3H90A 3KLEB 2WVBA 3ZZTA 1QVFR 3E3XA 1X9WA 3RB6A 4CT8A 5ETSA 1HI8A 3FGVA 1TK0A 4B9TA 4JI6J 4HTIA 5HROA 1SQFA 4KHMA 1SIWB 1FKOB 2BKPA 4C8KA 1LW2A 3QJPA 1FVQA 4H4MA 1PYSB 1F1BB 4Y2KA 4QW8A 3I32A 1UVKA 1IR1A 4N41A 2ADCA 2IC3A 4CLYA 2QYCA 3FDSA 5JUMA 2EFNA 1WI8A 4HKQA 2OKQA 4J9RA 5DG8A 4ES1A 2FJWA 3IM9A 2FTRA 5CA5A 1RAGB 4KT0C 2BOPA 4ZCKA 1OPIA 2HHUA 4YEAA 4XTTA 3NLCA 1NDLA 1GT8A 3OLBA 1YRXA 3K89A 1V9OA 2A0FB 3UCGA 3W2WB 1GQEA 4ZVFA 5KT4A 3CJSA 4UY85 1JXLA 5FDLB 2ATCB 4LUBA 4PG6A 2NYHA 2YKAA 2FHMA 5CYJA 3WX4A 3RUBL 4DR6F 3ZNUA 2MSSA 2AZ1A 2MQMA 2WVDA 3Q86A 2WVEA 4LREA 7FDRA 3GSIA 2GJ2A 1YJ7A 2N7CA 5DS7A 2Q66A 3B82A 4KPCA 4CCHA 4ILLA 2DNMA 2XSJA 3THVA 3CCWA 3H42A 2E66A 5GAGU 2UV8G 2XMMA 3V5RA 2HRUA 1CJKA 2QA2A 1WKLA 1I5OB 1FJGF 1UEVA 3KUGA 4F3OA 4IH5A 1FKPB 4F7VA 4DR3F 2GMHA 4OV6A 3UW1A 3BKUA 2MLXA 2I5JB 4UOFA 2V9WA 4HT7A 3Q8RB 2H54B 4O44A 3KHHA 2BXJA 1HD0A 4HHUA 4JI0F 5F9LA 4TY8A 4MKAA 1WOOA 4CLLA 1TKXB 4BDPA 4NYOA 2KG0A 4OZ1A 4OQJA 2HNDA 4E2FB 2OI2A 4C11A 1WC3A 3ITHB 3HSJA 2CQPA 4N8NA 4DR5J 2Y1JA 1IKYA 1Q8BA 3UI3A 2KVIA 4Q7AA 2E9TA 4L75A 4LFAF 5J1PA 1WI6A 2L9DA 2DNHA 2AZ3A 6AT1B 1MROA 3N28A 2JOQA 1QE1A 2HHVA 2QX0A 3CMAS 4USUA 1JXEA 4DSEA 4YY3J 1Z2LA 5D78A 1U4BA 3PHEA 1VQ4S 5D4PA 1HWLA 3RG6A 1XN9A 2LCWA 2PA3A 1N33J 3QIDA 3TX0A 1RTIB 4DQRA 2YH1A 2DGWA 3JAMU 1P6TA 2MQQA 2VHGA 2VB6A 2NUUG 2IJRA 1FWLA 2O01C 4OX6A 1ZPVA 2RQKA 7FD1A 5L38A 4H4OA 3TA0A 1JJHA 1RWXB 2W9CA 2XY5A 1K73T 2OH2A 5F8NA 3MECB 3THTA 4CLWA 5DJBA 2QE5A 4FKXA 3F44A 2Y3YA 2F3JA 2B3TB 2DXFA 2KT5A 4K5SA 2U1AA 3OVAA 3FMBA 2CKWA 1KTVA 3R6GB 3CWJA 2P5VA 1VIOA 4OYMA 3TZZA 3C3LA 4DSLA 3CJ4A 2XNRA 4WE1A 2OTJS 1RHJB 3FQLA 1TUVA 1AUSL 2G2YA 4IR9A 1VBKA 4P2SA 2E1AA 1VMBA 2VODA 4FYWB 2L41A 3SCLE 3D7SB 1CSJA 3D1OA 1RWPB 1A7GE 2QLBB 3OL7A 4LIWA 1RISA 4LSZB 4OYWA 2BJ3A 1NZ8A 1RAOA 4ZP6A 4U9RA 5KFCA 1CJVB 2UXBJ 1ZAVA 4FF1A 2M8DB 2VUGA 2X1FA 2E5HA 3KHLA 4RW6A 4Q8EA 4X4QA 4ILMA 2B4PA 5IV3A 3FJ2A 2Z4PA 5L46A 1WD6A 4DR6J 3RB3A 3GFXA 4MJKA 3V6DB 1KDNA 1RKIA 1RHRB 3HM9A 1JX4A 5C2GA 3LGMA 4ETXA 3PFOA 2HYIB 3S6EA 3IXQA 3Q8UA 1TL3B 1FJ7A 1IJFB 3MMAB 2X7IA 3NOCA 4NLOA 4BC9A 1KONA 1HI1A 1D9AA 4IDKB 4LF4F 1RHUB 2GZOA 3W7BA 4OYZA 2A10A 5I3UB 4NA2A 1FDBA 2AYGA 5K14B 1H72C 4AQYJ 3HO1A 3RW6A 3TO8A 3TAMA 3OTCA 4PPDA 2DNYA 4XIUA 2HRTA 1IKVA 4KFBB 3CCJS 2JLFA 1WC5A 2UUWA 4ECWA 3D5MA 2C42A 3HF5A 5IV4A 4NMLA 5EGYA 2RKIB 1M5KC 1RE1B 4YOEA 3CCSS 1PSDA 4CH7A 2E5GA 5B0GA 5BYRA 4F4ZA 1AZSB 3QZ8A 4F04B 2QA1A 1FEEA 6FD1A 4OYAA 2W8KA 2IYIA 2G1HA 4ED2A 4LJMA 1KD1T 3CIMA 5HBMA 3K5PA 4TQRA 4CLKA 4NOHA 3LW5C 3LP0A 5F8HA 3PHTA 4NCBA 2Q6BA 4DEZA 4KRWA 4L72B 4UT4A 3V6HA 1I3OB 2W1BA 1AFIA 1HPZA 3KLGA 2YKOA 4FYDA 1W2IA 3BQ1A 1S0VA 2GGPB 5C25B 1F6TA 2FLNA 2K7JA 1K0TA 4LRFA 2ZNYA 3TW0A 4HR2A 2FZKB 3NS7B 3BO2A 3H98A 3EDQB 4DZDA 1O6XA 3ULHA 5LOQA 4JI7F 3KLHA 1HBOA 2YNFA 5HVFA 2P2CB 1WSVA 2M2BA 4JI1F 3ELHA 4IG3B 4DL5A 1SL1A 4MT1A 5E41A 1PAEX 3A3OB 5RUBA 4TU9A 4FYYB 3V81B 3QWUA 2AYEA 2AJQA 3RW7A 5E5NA 1S10A 2M70A 4O3SA 1N32F 4C8MA 3T1YF 4RL1A 4QYRA 4IO9Q 3C6UB 2UUBF 3CD0A 4B9MA 1EJ7L 3SI8A 3POTB 2PEBA 4LBIA 4KV8A 2FJVA 1NJZA 2RU9A 3NAHA 2VD3A 4CIOA 2C2NA 3ILIA 4NEZA 3C19A 1HYSA 4J9UE 4NYPA 2DO4A 1DAXA 1FNMA 5ETRA 1P1TA 3K7RA 1VC6A 1XMBA 1LW2B 1SCJB 4FVCA 4IQMA 4FNHA 4H4MB 2HHHF 3CCES 1VC0A 1S1WA 2DEJA 2HWTA 4Y2IA 5K8MA 2IC3B 2KYXA 5HAOA 1CULA 2KKHA 2UUTA 1DRZA 4DFPA 4C97A 2LQJA 4ZN3A 3MUMP 4U95A 1Z2ZA 4LSNA 2OIHA 2OLWA 1PG5B 2WVFA 5DLFA 1V3ZA 2EFVA 3R5BA 4TLQA 1R27B 3QNWB 3MM9A 2GIFA 4NASA 4C4WA 3V4MA 1H38A 2LXIA 3B54A 4M94A 3DOLA 4LF4J 4PABA 5JXSA 4BWJA 4DMZA 4LSLA 4J9OA 3BKFA 2RU3A 5A6PA 2F4VF 3EGWB 1TL1B 3PACA 3M7VA 4DFMA 4DS4A 2DXDA 3TQEA 2QYGA 3DDKA 4Y34A 4A8WA 2NPIA 2F9JA 2BM0A 3MM5B 3RBZA 1RTDA 2B9WA 4GVBA 1CJKB 1FJCA 3TYTA 1T03A 2Z2YB 3IAS9 3FKBA 1VBXA 5J2MA 2AGOA 2RJZA 3UNGC 1OQ3A 3TUJC 4DU7A 1VRTB 4DL3A 2FVPA 1B0VA 4HHJA 1L5UA 4KGVB 2WZ1A 1JLGA 1EKSA 2W9BA 3VHQA 3ICLA 2I0XA 2HS3A 1HBUA 3PW5A 3PYEA 5GAEI 2HS4A 2ZH7A 4O44B 3BPDA 4P9SA 1KOHA 5AJ3J 4TY8B 3UD4P 4BCAA 5D8HB 3RAXA 4DI6A 1HWIA 1UFKA 4USWA 1JLFA 1SXLA 2HNDB 3CCMS 3U1LA 1HL6A 4PG7A 1YX2A 3NRBA 4NLYA 4RNNA 1QUPA 2B6AA 2UU9J 3UN2A 4ZDNA 2AIRB 2W2NP 3BGOP 1UW9A 3T6JA 2LEAA 1ZETA 2DGOA 2OEJA 2HVIA 5KT2A 1UVLA 2DB1A 4QR2A 3I55S 4JI7J 1ROFA 1QE1B 3HK2A 4B3OA 1U45A 5KAKA 3CIZA 3AJ1A 4JI1J 3L9ZA 2VG7A 5L9NA 2D9PA 5AE3A 4NLVA 2V2KA 1L3KA 1S6QA 4I1TA 1Q4RA 3M8YA 3JSRA 1B99A 2AJ4A 2IM0A 3ISND 3VAIA 5KFKA 2PMZD 2MQ8A 4M5KA 3AOBA 1QSYA 4O3QA 4KTQA 4RWWA 2YNIA 3T1YJ 1UZHA 4ZK7M 3QAEA 2V94A 2UUBJ 2ZHAA 2W7PA 4O4GA 5IS2A 2DNRA 4K4TA 3C16A 4DL2A 3J7YU 2DGVA 4F3MA 2B56A 1X7VA 3PO5A 3H0PA 3JSYA 2XI3A 2Y8WA 8RUCA 5C5JA 3QT7A 4C0BA 2XULA 3BREA 2A1BA 3NCRA 4Q8FA 4V19J 4NA3A 4Y3CA 2AV5A 3TZXA 1VRQC 9ATCB 2EKNA 3UCUP 2NUHA 2VICA 1HQEB 2YX4A 1HWUA 1WTFA 1N5TA 5HMXA 2IRXA 2F40A 1RAIB 3Q0AA 3GLJA 1KRPA 4I0WA 2FC9A 3KK3B 1FT8A 3P8BB 4CT9A 5B7WA 2QGFB 2HHXA 3V6KA 2H4WB 5IT9Y 2HHWA 3I82A 4YR2A 1HBNA 1TL5A 2KYZA 5CCLA 3PCOB 1EARA 1TFWA 3ZZUA 4DHVA 3NOGA 5H9EK 3LWMA 4DZ6A 2G4BA 1LKZA 3K5OA 4YR3A 3TJAA 1YHQS 3W9JA 2FHOB 4RW6B 4N77A 3BEGB 2OAUA 1FF2A 2FVRA 2HK2A 3DRSB 5GMKa 5AXMA 1AXQA 1V3SA 4PR6A 3ZTOA 1RA6A 2MHEA 3MCNA 2XCPA 5CAAA 5I42B 5IQQA 3HVRA 1H7XA 1VQ6S 4Y28C 1PJ7A 5F3TA 2CIMA 3X1LB 1B7YB 2F4VJ 4P73A 5IC4B 3OXGA 2WW4A 4CNYA 4F4KA 1R31A 3ET6A 1UP1A 2AKWB 4I4BA 3BBBA 1SKSA 3O2IA 3N4WA 1KEKA 1N6QA 5CYQB 3OT9A 2XC9A 1BHNA 2BRKA 3K5LA 4AXIA 2P6SA 4C48A 3HKWA 2HQ3A 1Z1ZA 1IKVB 4N7TA 4DX5A 3C46A 4DL0C 1G6BA 4EYIB 4EO6A 4RU9A 2L9WA 3I4HX 2W7OA 1HNXF 1NK6A 5HATA 2YPYA 2UUCF 4LVOP 3AFGA 3MM7A 3IGNA 4KPYA 1JJ4A 5HQLA 2QO3A 2UP1A 2D69A 1OYEA 5KFAA 4B3MJ 3BSCA 1VISA 3I9V9 3QFWA 1VC5A 4P75A 2R2UA 3H2UB 2ZBRA 4ZVQB 2XMAA 3C2PA 5HBMB 4C0HA 2GX8A 2CG8A 1S6OA 3OL8A 3PM9A 4TYAA 3G86A 3HFZB 2F63A 1SL2A 2G0CA 3NGRA 4OZ0A 2XYPB 4OJHA 2F8EX 3AXMA 3M30B 3OFEA 3VQTA 1HPZB 2MKKA 4PWDA 1WUUA 3N6MA 3KLGB 3MM6B 2PSZA 2AX1A 5JJBA 3HHLA 2RDIA 3FVYA 4MMOA 2F7VA 3DU5A 3UDLA 3M6UA 1HBMB 1W2BR 2H9ZA 2AU0A 1YZ7A 2JH3A 2IMOA 2IAJA 2PMWA 1M1KT 3KLHB 1DLOA 1HBOB 2LDIA 2YNFB 3ZTQA 5HI7A 1S7IA 2HHPA 5T14A 5H9FJ 2V8GA 2HFVA 2IJFA 4DF4A 2BQRA 1FXRA 1QUVA 4ZVEA 4X62J 3PIPQ 2R4FA 3PEHA 4OZJA 2BABA 1NB2A 3BQ0A 2DT9A 5KFTA 1AROP 2V9KA 1QM9A 1YBTA 4Z7YA 1FHTA 1VRUA 3FBFA 1RT2A 3A12A 1W7WA 3IFEA 3O8WA 3C6TA 2RT3A 4FN5A 2GAGC 4CO5A 3OJSA 2BJ7A 1GTEA 1M1GA 3O1LA 4NXNF 4USHA 5FLXY 1FWPA 3B6BA 4KV8B 2BKNA 3PXGa 4P10A 2BOAA 5LJ3Y 5IXUA 2J0WA 4O4RA 1FNOA 3FEXB 5HMWA 1HYSB 3DRPB 1FRIA 4NZ0A 2V2VA 4JV2A 4NLXA 1N5YA 2MZJA 3BN4A 5KFSA 3VCDA 1IBLJ 4LF9F 1U7LA 1ZAXA 2C3PA 4WU2A 3D6TB 2GW8A 3NL0A 3AHPA 2UXDF 5D0GA 5KG4A 2AEFA 1WORA 3VTIA 3WC0A 4F4AA 4GKKF 1VJQA 3IM8A 5DDPC 5KG6A 2DRAA 4DV4J 4P2FA 1S1WB 2VFRA 5LSLA 3T19A 4PWWA 2EFOA 2KT3A 4LMZA 2H1YA 2ZZMA 1CULB 2G0IA 1BC6A 1IQZA 5DM7Q 5EWEA 4RKUC 2YH0A 1KHVA 4LSNB 4ZMMA 3HHEA 2AT1B 4M8LA 4HDHA 1R8PA 3QIPA 1VGYA 2HNYA 2VQEF 5BR8F 1W26A 4QJVA 1WOSA 4XDDA 4D3HA 1YJ9S 3MM9B 2QSWA 3PFEA 2M4MA 4OI1A 1SJ3P 3G6VA 1U48A 3DOLB 3ZFVA 1UFWA 3HI9A 3S8SA 1REGX 5A2QY 4LSLB 2VDIA 3CJ5A 3PX0A 4NLGA 4O3OA 3W1YC 2W8LA 1RT3A 5HVHA 1KQKA 4ZVPB 1BWVA 1I1GA 2FGOA 3JQKA 1HNXJ 4CWBA 3CJKA 3W9IA 2EC0A 1RT4A 2UUCJ 3SFGA 1RT6A 1RTDB 4GVBB 4C8YA 3SEOA 1F5AA 2W24A 1RAJA 5J2MB 2B9EA 3ENAA 2UV8A 1VQSA 2N4CA 2XWYA 2RUGA 3PV8A 4BLGA 3J7Z5 4ZPCA 2DGSA 2RQMA 4FXDA 4F02A 5KFEA 3M8RA 2EVZA 1YSJA 2V8DA 2W9BB 2HFSA 1HBUB 4ECXA 3FUYA 5A8WA 3FSXA 2XM3A 2DRDA 2R42A 3GZ7A 4KBIA 3WIVA 1VIXA 2HQDA 4GRSA 1Q8IA 4UF4A 3DOKA 1JLFB 3GMGA 3MEEA 3KDNA 3M05A 2YXLA 4KR0B 2ZBPA 2DR6A 2B6AB 2DY1A 4B02A 2ZBIA 5KFDA 2AGPA 3W65A 3DHWC 4LR8A 2QRRA 1Q86T 4F2SA 2C2RA 5DM6Q 3N5BA 2J8AA 3KK2A 3MCSA 3L7UA 3DLBA 3LP2A 1SJQA 3GP9A 6FDRA 2DCUB 3PYFA 5KFXA 1NJWA 4B3OB 1VBYA 5AT1B 4PAAA 4R5PA 2XCAA 3DHXA 1U47A 2YY3A 4I69A 4DDFA 4H4KA 1REVA 1QD1A 2JNJA 1RWUA 3CE8A 3JTNA 1S6QB 3NGSA 4FPIA 3P3DA 2HBYB 4WU3A 1SI9A 2VOPA 4KHPF 2XS5A 3QYYA 1P9YA 2N82B 1HWKA 1UPPA 4RLEA 2ZEJA 1YKWA 5E3RA 3FSIA 3O3LA 4LRBA 4UOCA 5E3CA 4X4RA 4PXCA 2IFXA 4O4GB 2XNQA 3EPIA 4NXNJ 3ZC4A 2HQIA 3C16B 2X1AA 1S72S 3D0HE 2B7CB 1TUGB 3PW7A 1N0VC 1U6ZA 3HPOA 2Q3PA 3R27A 5KOXA 1JLBA 3M8PA 1RT7B 1RBOB 5GMDA 5JVHQ 4LF9J 1EP4A 2IIHA 1NCLA 3GSDA 2UXDJ 1JK9B 2R7RA 3LANA 2MLZA 2WB4A 3K59A 4ZS6A 3DLEA 3W5YA 4OHYA 4CTAA 2DY9A 2YX1A 2ROGA 1U1PA 2BACA 4A8OA 4J9QA 4JI3J 1UJ5A 3MUVP 4ZLJA 2R2SA 3KOAA 4NLQA 4K4XA 2QZ8A 2EFGA 1U49A 3ZZZA 5KFVA 1SUQA 1FI4A 2QMWA 3AXKA 1T9UA 4RUBA 4NCGB 2YVSA 2DEIA 5LXRA 1HBNB 2A6MA 2ILZA 3HHNB 4OX9F 5KOWA 2GJFA 3WBZA 2CQ1A 3CJ2A 5BR8J 3CDEA 4MTPA 3MDFA 2GO8A 2I6WA 3TQ1A 2RAQA 2KZZA 2VIHA 4X65F 4K4UA 3VF0B 1VQMS 4ELUA 2P6TA 2PN6A 4PG4A 1A0OB 4Q0BB 4LQ3A 1LFPA 3ETMA 1FD2A 2MQNA 1BQNA 1MWZA 3OR2A 1N4LA 2H3EB 4C8LA 1YJTA 2LYVA 3ISNC 3BBFA 5LMUJ 3S7RA 2XS7A 2UVVA 4PXEA 2OEMA 2M8HA 4PCQA 3RR8A 4DV0F 4W4MA 4DWIA 3TNVA 3R6LB 2QFIA 4DJBA 3J81Y 4KQZA 4YDDB 2XMTA 1K9MT 3TUPA 5ITHA 2VPWB 3R7NB 3CCZA 2DPJA 2FD2A 2OD6A 1N6QB 5ETVA 1YWXA 2VOOA 3R2CJ 2VV5A 1C1BA 2B0GA 4URQU 4HL9A 1V5VA 4P52A 1Y5NB 4ILRA 1X9MA 1TKTA 2LP4A 2HLTA 4P2MA 5FLXU 1CQMA 2FVQA 2NZCA 3LQVA 2RRAA 1BMQB 3MM7B 3J7AN 2B4UA 5M2PA 1CJUA 3GV5B 4DPOA 4IH7A 1M0SA 1FK9A 5CYMB 2GHPA 3BGLA 1TK8A 4O0NA 1TELA 4EZ6A 5T41A 5KFGA 2POKA 3ENQA 3DM2A 3GG1A 2HZCA 1CJTA 3AB4B 5IWAF 5T7LB 1R8BA 1X4AA 4LRDA 1QSLA 1G1XA 2PA8D 3SCJE 1MN9A 2ASYA 2GHWA 5AXLA 5KFBA 1NK7A 4JI5F 1YBAA 2ZD1A 4N76A 3N01A 5ETPA 3BKTA 3HHLB 3Q83A 1X5PA 5LT5A 2B8PA 4X4SA 1S1VA 4OJGA 2VPXB 4N5SA 2UVWA 3PW0A 4AFFA 1I94F 2M3DA 4KHPJ 2FJBB 3C15A 2ROEA 2DKOB 2CQDA 2M7SA 2GVDB 2EXUA 1SL0A 1LWEA 1DLOB 4HH0A 4NYZA 4CYUB 2V8VA 4K2JA 2NSBA 2OSRA 1XERA 3UDEA 3KLEA 2YTCA 1WDTA 1UZDA 4Z7CA 4J90A 1FESA 1RAEB 3UQSA 2H51B 1CLFA 3OR1A 2MZSA 3HVAA 4LR7A 1VRUB 1RT2B 5I3QA 2XYHB 2MY8A 3C6TB 1ITPA 1WTBA 3MCMA 1S4EA 3D2WA 1FRHA 4QIGA 1SBRA 2A2DA 4K59A 2GQQA 2CUYA 2FC8A 2OGUA 5KFNA 3P4UB 2YQ0A 3CGIA 1V6HA 3A4TA 4XDCA 3KLIA 5KG5A 4FDFA 2V34A 2CWXA 2J6TA 2Y8YA 2K3KA 5DQHA 4QQBA 3F73A 4ID5A 3QFHA 4OX9J 1N5VA 9RUBA 1UJ6A 2W01A 5DGBA 3TAQA 3M32A 3DLJA 4LQ9A 4IH6A 1SH2A 5L39A 4X65J 3NNHA 5EUHA 5C42A 2PO4A 2AGQA 1X0FA 3Q8QB 3LH2S 4URGA 1LXJA 4QPTA 1CS4A 5A8KB 3RBXA 2CA9A 3OHAA 4WZMA 1UA1A 4PUOA 2COLA 3OVSA 1HARA 3G96A 4FPRA 4OZ5A 2HHTA 3HMJG 2CQ0A 3ILOA 5LSOA 3QIPB 4KYZA 3PO4A 5IQ6A 3CPWR 1TR0A 3AJ2A 1RHQB 2C2DA 5E33A 1JKHA 3Q23A 4W92B 2HURA 5B09A 5CQGA 4I2PA 1FJEB 2EWHA 4CH1A 2FJDB 4JI8J 3IWNC 4IOAQ 1GMWD 4DR2F 4ECRA 2XWXA 4XPEA 5DDQC 3NMRA 2JFKA 2HHSA 5ETKA 3IMQJ 4J9SA 2XQCA 1J27A 1EETB 1SB6A 3T5JA 1RT3B 3BBCA 4PZVA 1AB8A 1OY8A 2KXNB 1UFLA 4DR1F 3MCOA 1SKWA 2XZWA 3CF5Q 1TKXA 4CQ1A 3CJKB 3NY0A 2QA4S 3THPA 2WBRA 4DX8H 2Y1RI 4MK8A 2ZC4A 2W4PA 2BA9A 3JTOA 1OS5A 4NMXA 2EW9A 4OHZA 1F3VA 2ZWPA 3ONQA 3G2XA 2KM8B 5C2CA 5LSRA 2D3O1 4M5HA 1TMJA 1QTMA 3Q24A 3KMSA 3IR5B 2JJ4D 1FA0A 5B0AA 1R8CA 3M4XA 3DNCA 3DOKB 2LMIA 3UR3C 3E51A 3HFKA 3QPIA 1FKAF 1QAYA 4JV5F 4JI5J 1TL7B 2DK2A 4PG5A 3MURP 2AD9A 3G9CA 4ALZA 4AXJA 3KK2B 2CJXB 2VBWA 3ZZ0A 1HNVB 3M6VA 1XNRF 3F56A 1MMNA 5B0CA 2UXCF 3G6XA 2CJAA 2QLFB 4ZP7A 4R5PB 4G1IA 3MZIA 3R2DJ 3L7OA 1REVB 4IYQA 4OHVA 3EM1A 2YKMA 1OWXA 1XK8A 4CH0S 2NYIA 3J81U 3HD1A 4NI2A 3J7YI 1GH8A 3KJNB 1IQTA 2KFNA 3S1TA 1F5BA 2WRMA 3T41A 3HX9A 1FX2A 3CCUS 1F2HA 4QWCA 4I7FA 1DQ8A 2AMCB 2NXJA 1WHXA 2GMLA 3R5CA 4WFNQ 3IBWA 1NJYA 1S9EA 3LPEA 3NGKA 4LVNP 2QC3A 4L74A 4W90B 1KLMA 2ZH5A 1S6UA 1JLBB 2FQQB 2FVCA 2QN6B 2HVZA 5FD1A 3CCVS 4ELVA 1TAUA 4GVLA 1DTTA 1EP4B 4O3NA 2ASLA 2R8KA 2XMWA 1CEZA 4ECTA 2QV6A 2KVQE 2JDJA 2QFJA 5IT4A 3M8WA 2KO1A 2WSFC 3BGUA 3BH7B 1ULRA 4OI0A 2BYCA 2MB0B 2FHJD 2ZH4A 1U8SA 1QLNA 2E7XA 2HFZA 4EFAC 2CPEA 4B3SF 4BHQA 4CO4A 2RF2A 1SUQB 5F8MA 4MKVA 2DRBA 4X66F 1MMLA 4QWEA 1U02A 4DQIA 5L1KA 3W60A 2DGQA 4E98A 2VONA 1IUJA 3MMAA 2HVEA 2R7UA 2ZJRQ 3QGIA 4TY9A 1T3NA 3I0SA 1S0NA 3OJUA 4URSA 2PEHA 4B17A 1X4DA 1XC9A 2ZE2A 2C1EB 5I3UA 1W25A 2KRBA 1RP5A 5K14A 2CXEA 4HYKA 3LO3A 1BQNB 3OR2B 4ZJOA 1FXLA 4YS2A 3EICA 3VAFA 2JHEA 4QWAA 3GJSB 1OY6A 4ES2A 2DYAA 3TAPA 4F4WA 3D66A 4AUKA 4F26A 4KIAA 4HEA9 1K1QA 2RKIA 2YWKA 5HVGA 4DV1F 3OVBA 4YHHF 1AUDA 5HP1B 1WJ9A 4DR1J 2LU1A 3DKDA 2CVEA 2OELA 1AZSA 3ILLA 3F41A 4ZVGA 1FRKA 1AW0A 4RUHA 1NKEA 1RT1A 5HL7Q 1GTHA 5B0EA 3OTBA 1RCXB 4HVZA 1SV5B 4ECQA 3UD5A 4ED5A 1X5SA 1O51A 4MIAA 3HSDA 1VLOA 1FNXH 1TKTB 4QR1A 3O44A 3OBIA 1X5OA 4LF2A 4WPAA 3BM7A 4DS5A 5KG0A 2CJKA 3GV8B 2CQCA 5BXIA 2XHWA 4M5GA 1RBLA 4KO0A 2C28A 4ZIVA 1CJUB 1A9NB 2VA3A 2P9EA 3TZYA 2NLWA 1IXKA 2XO7A 1HIYA 2VPZB 2OPSA 4GKJF 2ZFHA 1TMMA 3R5DA 4UUWA 1E6VA 2CRLA 1MWYA 3DU6A 2V67A 2A2CA 2JWNA 1L3SA 5G0RB 2IRYA 4J37A 4I67A 3LGNA 2Z2LA 5FJ4A 1NHUA 3DM2B 3JQMA 1CJTB 5C7PA 2XGPA 4USVA 2M52A 3D0IE 3DLGA 2UXCJ 2DNQA 3VV2B 4C98A 3BO3A 2GVZA 4LRAA 3ZTSA 2ZD1B 5CABA 1IN0A 1NK4A 5J2QA 4CO1A 3EE3A 3V81A 5DZ7A 4AD6A 4EMDA 1S76D 4BC7A 3P49B 4A8FA 2DGTA 1S1VB 4OHXA 3QSIA 3DOMA 1VQPS 1SQGA 3KK1A 1ICEB 1EIYB 1AT1B 2JEGA 2AHOB 3POTA 1LWEB 3AOCA 4B3TF 2CQ3A 3AB2B 5U47A 4B9LA 3CB4A 1HW9A 1SJRA 1KQSR 2RS8A 2HIYA 5KT5A 1B0TA 1XIQA 4RZRA 4DXLA 3TUZC 1OY9A 2KJWA 1RU2A 1XNQF 2LQBA 1TTHB 2VH7A 3OR1B 3BYPA 4U7CA 2V68A 3QZ7A 3PG9A 1KR4A 2LXUA 4X84A 4NLPA 5LM7E 3QQCD 5ETNA 3D6MB 2WTFA 3N0VA 1U2CA 3S01A 1NO8A 2Q6CA 4M5LA 3E2EA 3MD1A 1ZM2A 2D41A 2OMLA 2YBVA 2GIRA 4RBVA 2E9ZA 5HK4A 4Q2MA 4MFBA 2E1PA 3J80Y 4ZPDA 3L95X 4B3SJ 3MEGA 3PRDA 3LALA 3CCRS 3QT6A 1J2VA 1Y7PA 4X66J 3FFIA 3KLIB 1Q5YA 3B78A 3NNAA 4ID5B 1H7WA 4C3LA 3M32B 3GWCA 1ZA2B 2QL5B 4IRKA 2D3ZA 2DIUA 1KHWA 2OPRA 5C42B 3R5GA 4R0EA 4F36A 3Q2TC 2J6UA 2DGUA 5D4OA 4DQSA 5DGAA 1CS4B 4DSIA 2N3OA 5KFOA 2RNEA 5E3PA 1TL1A 2HGLA 4PUOB 1H74A 2X3DA 2B8QA 2ZZTA 2J76E 2DPIA 2OTLS 2BMBA 3PRBA 1JKHB 3M8ZA 1U09A 3MM5A 4DV1J 2XMJA 3PYGA 4YHHJ 4WP3A 4TKTA 4I2PB 3UN5A 2GS8A 2KXHA 2L3MA 3PW2A 5HO4A 4ZKAA 4KSEB 1O0PA 4ZPWR 1VI7A 3LAKA 1VRTA 4DPYA 4Y00A 4JV1A 4GC6A 5F0WA 3EYZA 3UDVA 4DFKA 1T94A 3DLKA 1GK8A 2HBRB 3TEHB 2M88A 2Z56B 1ZTWA 4TU7A 1HNZF 2V6AA 5CXTA 3AT1B 2MZRA 3GQCA 1F0XA 5E7OB 3KDOA 4ANEA 1WEXA 2YWWA 3PEJA 3PJ9A 1R6YA 2MZTA 3NAIA 4DPXA 4ZP9A 4GKJJ 2NXUA 3OHBA 3W66A 2DHSA 3N79A 4UTGA 1UAWA 1R6VA 1V5IB 4EBEA 3E8OA 3MMJA 4LRCA 1VQ5S 5F41A 2E5IA 1PBAA 1LWXA 2MKYA 1B3TA 3H59A 2V8HA 1Q8LA 2V2QA 3OUYA 4IOBA 1B70B 3B4DA 1M5SA 2RDDA 2C2MB 3CCTA 5AXKA 2KXFA 3NEKA 5IM0A 4LFCF 2X1BA 1PJ5A 4AL5A 5ETLA 4L6V3 2HQGA 1X8DA 2RILA 5AE1A 2JVOA 3K57A 3UDCA 2FZGB 3SQOP 1YITS 4RUAA 3J81j 1Y10A 3I9ZA 5ETTA 3DRXA 4CM2A 1CPZA 3AD7C 3TA1A 4NXMF 3SFUA 2GQ2A 2XLJA 3R97A 1HFEL 4ZPAA 2ZOMA 4Q5VA 5D6GA 2JLGA 3QWPA 1IKXA 1R3NA 1L3VA 1WC1A 2YKMB 3CDWA 3PVXA 3QLHB 3DC2A 2DCLA 2W2PP 3U1MA 4NI2B 2DIVA 4DU8A 2J0QD 3OSNA 2ZH8A 1HQEA 4UUXA 5CZVA 1S1UA 2DR9A 2G13A 2J6SA 3RBDA 4I7FB 1RI7A 2UVRA 3K8VA 3TA2A 1FXDA 2OPPB 2I38A 3KK3A 1S9EB 1S49A 1SVDA 2VFTA 4F0KA 1XWLA 1XMQF 4ZCIA 2LQ9A 3R5AA 1KLMB 2YQ3A 2CZ4A 2ABYA 3D4JA 2QG9B 3CO0P 1O5JA 3CO9A 3MR2A 3EPGA 3D1HA 1FFWB 1DTTB 1FRLA 4JI4F 3BSNA 4KKOB 1Q95G 1N48A 3EVOA 3R3TA 1APSA 4KGMA 5EWFA 3GYNA 3DRSA 1S57A 3SBMA 3I31A 4U96A 2MKJA 3Q8PB 1S12A 1S59A 1XBWA 4DUYF 5I42A 2R7VA 2RF2B 3EJMA 2JEFA 2VBYA 2CAJA 2ZDPA 4OZNA 1CBKA 2RH3A 4DR7F 2BE9B 3W64A 3GIMA 1RUSA 3AA8A 1RAAB 2M5YA 3BSOA 1S48A 3JQJA 1WF0A 2E7WA 3DMJA 2Y9HA 2CADA 3FZBA 4WCEQ 2HS0A 3W62A 3I0SB 1IBCB 1QJHA 1UMJA 2ZE2B 5CYQA 2VF3A 1KC8T 1JLQA 2CQBA 1YG0A 3M1VB 2VJUA 1UVJA 4DG1A 1FJGJ 4ED6A 3IBCB 4DSKA 1WG1A 3A3NB 5ETOA 4DR3J 4KB7A 3CJ3A 2LEPA 2QMXA 4WYWA 4DPWA 4TVAB 4FF2A 2JZ5A 2ZH3A 2IVMA 4JI0J 5LMNF 1RSCA 1HNZJ 3EZUA 5L1JA 3KFWX 2AWZA 3HZEA 1U26A 2MGZA 3NS5A 3US5A 3GYGA 1RT1B 2F5GA 3JB9k 4ERDA 2KTQA 2CDQA 4I56A 1KVJA 2VKRA 3C14A 3OFHA 5H9FK 2EFPA 4LFAJ 1EHWA 2IRUA 2ROPA 4DV2F 4EGLA 1WKKA 3M30A 4CO0A 3FRZA 2I9SA 1X4GA 2DJWA 1YQHA 2DNOA 1IVZA 3D28A 3J7ZT 4DV5F 3HSGA 3MM6A 4KO0B 2RRNA 2UZAA 5K8NA 3J80U 4RNHA 2IY5B 1WHWA 1QSSA 3G71S 2OPSB 2ZITA 4TNOA 1E6VB 3HT0A 1HHQA 3HSZA 1UKUA 1HBMA 3G82A 1MSWD 4LFCJ 2XTJP 3W9HA 2R8IA 5LJ5Y 3D3BJ 2MQLA 4F0HA 2DNPA 3E01A 2VBZA 3CT9A 1RYRA 2B4OA 1S0MA 3DLGB 1G4CA 2VC0A 3AAWB 1S99A 1TVRA 3H5YA 3BZQA 3SXLA 2GVZB 4ID8A 1K44A 4LT6A 2MJUA 3PX4A 5J2QB 5LXYA 4NXMJ 1K47A 4IFVA 3PW4A 2LEBA 4XAKA 3DOMB 3KK1B 3BJYA 3ISZA 1TV6A 4P7TA 3QGPA 1TKZA 4QIVA 5HLFA 5ETQA 2IPOB 1F5CA 2PI4A 1PIEA 4CLZA 2OPQB 1HHTP 3BO4A 4DSJA 2V0NA 2J9DE 1RLCL 5IT0A 1BE4A 4EUVA 1RWWB 4LR9A 4Y0FA 4F2RA 1SC4B 2WCXA 4ICLA 3HLUA 3H4BA 3DRPA 2VFVA 1WG4A 3HDSA 3GIRA 3PKYA 2XY7A 3G8TA 1MG7A 3D54A 2XMUA 3CD6S 4USTA 3DGVA 1NK5A 4X4NA 4RX6A 3R8YA 3SSSA 3PR5B 1DURA 3H25A 4NZ7A 1FVSA 3PRVA 4FYXB 3PR4A 4LF8F 2KFYA 2ASJA 5EWGA 2VFUA 4MK9A 1T02A 5L1LA 4R8UA 4ECUA 3DCAA 3I6PA 4X4OA 4MFBB 3CDAA 1IWGA 4KGKA 3VAHA 4BS2A 1LWFA 1WC6A 4MYTA 4DUYJ 4JI6F 4F3QA 4CLTA 5D4LA 3QMQA 2DTJA 3MEGB 3DI6A 2IA0A 5CHCB 4DR7J 2QL9B 2H48B 3FFIB 2BW2A 3KG1A 4KH1B 4XK8C 5KFWA 2H5JB 1JWWA 5F9NA 5D0RA 3NGUA 3DDNA 2CPHA 4RW8A 2OPRB 3QGGA 4TYBA 3FBBA 4WK3A 1X5TA 4QYZJ 3BDPA 3MXHP 5KT6A 2F65A 2LVWA 2WB1D 2BM1A 1Y5IB 3VGSA 3GFYA 4OFZA 4RBUA 2NZ4A 3L09A 2V8PA 2ZHBA 1I6JA 1A6LA 3MPYA 4YFUA 1U1MA 3NXZA 4DCPB 3T5HA 1HHSA 2JX2A 3ILJA 4HI1A 4W98A 2EK1A 4ECVA 5CD4H 1NXIA 4RW7A 4CRJA 3JSMA 2IVFB 3DLKB 3CCLS 3CSKA 2QL7B 4FP9A 4NLRA 1N88A 2RDJA 2A3JA 4C6AA 2C22A 4XO0A 2ZVIA 3GR1A 3K17A 1R0AA 4O23A 1EZZB 2BW7A 1SH0A 4DV5J 2YPZA 4E8UA 1SKRA 2KG1A 2VFSA 4J9NA 2HIQA 1D1UA 4XPCA 2B7BB 4RJVA 4EI2A 3GJRB 4RUCA 1YJVA 3H8YA 4DSFA 1WACA 3I5BA 2ZH9A 3VZHA 4PRFA 1WHYA 4ED7A 2FJAB 2MKHA 4DOZA 2DHAA 2BANA 4F4YA 1XR7A 3Q8VA 4WIQA 1FTRA 3M2VA 3T5LA 2EEYA 3A8IA 3OUYB 3TEGA 4C8NA 1R43A 4JUZA 3W3SA 5I4MA 2VQFF 1LW0B 1UL3A 3MHYA 1VBZA 2EKYA 4FS2A 3WX8A 3GTYX 3KYLA 5IM0B 1MW7A 2ZKUA 4DL4A 3W61A 2YQ1A 1N32J 3AD8C 4EO8A 3GV7B 2ERRA 3M2UB 3MM8A 2FUG9 2MMYA 1GXUA 1QDUB 3A1YG 4OI3A 5KG3A 1PBUA 2DHHA 3SZ2A 2WSCC 2J7WA 1OQ6A 1X4BA 3DGPA 5IFMA 2GQCA 2BE2B 1YLXA 1IKXB 5A8RA 1AA1B 2RSQA 4CP5A 4G1QB 1RT7A 4L73A 1F3FA 3C66A 3UNYA 1U1QA 1OIAA 4F4XA 1UVMA 1H0HB 1X4FA 2N7YA 3CXCR 2BZ2A 1S1UB 2HHHJ 1I51B 5E0OA 4LF6F 1ZA1B 1C0TA 5L8RC 5KFLA 1T9WA 4MKBA 2GO9A 1IR0A 4X4TA 2RS2A 1P9QC 1VQ8S 4NCGA 2CYYA 3HP6A 2JRSA 1VFJA 2MKSA 2WBMA
chains in the Genus database with same CATH topology
3PY8A 4MIBA 4XPEA 2Q6BA 4DEZA 1IBMF 3K0JA 4KRWA 5DDQC 3NMRA 2J5AA 2JFKA 4L72B 4J5OA 2HHSA 1B64A 5MAOA 4OMFG 5KFFA 3AQOA 4J9SA 1NAQA 3TR5A 3V6HA 2OMOA 1AFIA 2K1RB 2F8MA 3RYLA 4Q0BA 1HPZA 1EETB 1UA0A 3KLGA 1SB6A 3BQ2A 2YKOA 3T5JA 1RT3B 1J5OA 1U1KA 2B9XA 1S0OA 1Q81T 4FYDA 4PPZA 2DR8A 3MMBA 3KG4A 2HLUA 3K2YA 1W2IA 3D1QA 3BQ1A 1X4CA 1S0VA 4F50A 2GGPB 1U1NA 3P6YC 3PKMA 2KXNB 1UFLA 4DR1F 1SKWA 2YNIB 3RRHA 5C25B 1SJFA 1ZBTA 3SV3A 2FLNA 3JSBA 2K7JA 4Z2XA 4RW9A 5KFJA 2XZWA 2ZBCA 3CF5Q 1TKXA 4CQ1A 3M8QA 3CJKB 4IRCA 2UUAF 2CPJA 1K0TA 2QA4S 1BQMB 2ZNYA 3THPA 3TX8A 3TW0A 3K58A 3MOZA 3RB0A 2WBRA 3QO9B 3SSQA 4DX8H 2FVSA 1MU2B 3U27A 3BO2A 3CJ0A 3PJXA 4X4VA 3H98A 2J7UA 5K5MA 2Y1RI 4MK8A 2ZC4A 3VAKA 2W4PA 2UXBF 2BA9A 3DMJB 3MPWA 3ULHA 2Y1IA 3M2RA 1TK5A 2VPYB 4K5RA 3JTOA 3LAMA 1JLEA 4JI7F 3KLHA 1HBOA 1P1LA 1OS5A 4J9PA 2YNFA 1BGXT 2GA7A 3FRYA 4EEYA 2EW9A 4OHZA 2M2BA 4JI1F 3IA0A 4IG3B 3PIOQ 2WSEC 3MR5A 3ZZOA 3ONQA 2YKNB 3N9UC 4DL5A 2KM8B 3MD3A 4YUDA 2O66A 3OLAA 1SL1A 3AH6A 2PC6A 1JNRB 1Y3KA 5LSRA 1RDRA 3GYXB 5GAHU 4ECYA 1M5HA 2QT7A 1JLQB 4WFAQ 2E9RX 3DYAB 4IG0B 4USIA 1QTMA 3EXYA 1KNZA 3NG8A 4Q45A 3Q24A 5E41A 1Q1KA 3QJJA 1Q53A 1LWCB 3KMSA 5KG1A 4TU9A 4DG1B 3V81B 2J9CA 1XR6A 3IR5B 3QWUA 3CD7A 1C1CA 2AYEA 2JJ4D 3RW7A 4QW9A 2AJQA 1FA0A 3N6LA 1KS2A 5B0AA 1R8CA 3M4XA 5E5NA 4K4WA 4M95A 3DNCA 1S10A 1UVIA 2M70A 3DOKB 2LMIA 3UR3C 3E51A 4O3SA 1N32F 3HFKA 1NH8A 3QPIA 1FKAF 1QAYA 4A8KA 2HRYA 3P96A 2YNHA 4C8MA 5E3AA 4JV5F 3T1YF 4FBUA 1ZZFA 4QYRA 4ZPVR 2B5JA 2DK2A 4PG5A 3C6UB 2Q43A 4NLUA 4IO9Q 2UUBF 3EXCX 3CD0A 4B9MA 3SI8A 1BQXA 3POTB 3MURP 5B08A 1R89A 2DISA 2HAIA 2AD9A 5G4DA 5D3GA 2VL1A 3HVTA 3G9CA 1WF2A 4PXDA 5CZXA 4DL7A 1DHMA 4ALZA 4AXJA 1DBDA 2E5JA 4KV8A 2FJVA 1NJZA 2RU9A 1VQNS 3NAHA 1R8AA 2G1DA 4AL6A 2MGZB 2CJQA 4OLOA 2XMKA 2OFGX 3AQPA 3KK2B 3KLFA 5CYMA 2VBWA 2VD3A 1HNVB 3M6VA 3ZZ0A 4CIOA 4AQYF 1XNRF 3F56A 1O8BA 3HHKA 1HYSA 4RW4A 1MMNA 4QOTA 5B0CA 2UXCF