1IKXB

K103n mutant hiv-1 reverse transcriptase in complex with the inhibitor pnu142721
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL POLYPROTEIN
total genus 110
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikxB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxB03
5KFPA 5EDWA 3V6DA 4ED2A 3IS9B 4EBDA 3M8PA 5KFWA 1RT6B 2HNDA 5I42B 3KK1A 4RZRA 1SV5B 5K14B 4WZQA 5J1EB 3DLEB 2IJFA 4ECTA 3KOAA 4RW9B 1BQNB 4R5PB 3I0RB 2OPSA 4MK7A 1DTQA 3H4BA 1DTTA 2B5JB 3V81B 5DG9A 3QZ8A 3DLKB 3ISNC 2OPPA 1RTHA 3PHEA 1FKPB 4J9OA 4RW6B 5F9NA 3KLFA 1FKOA 3IGNA 1DTQB 4K4VA 1RTIB 3DYAA 1MU2A 1RT3A 2R2TA 5KFGA 4NCGB 4DL5A 1RT7A 1BQNA 5J2MB 4NLOA 1S10A 3QLHA 1T05A 3DRRA 4IKAA 3MEGB 4QWEA 4Q8FA 1RYSA 4WFYA 3SFUA 3OLBA 3BGRA 2IM1A 4QWBA 5DQIA 4IDKB 1RT4B 4RW9A 4FS2A 3DDKA 4NLGA 4J9MA 3KLEB 3CIZA 2ASDA 5K14A 3PW7A 5DQGA 2W9AA 2HNDB 3OLAA 3NMAA 4DG1A 3UR0A 4IG3B 3E51A 2YNHA 3VQSA 2ASLA 3V6DB 4LSNA 1K1SA 2AGOA 1N4LA 1S0MA 1SUQA 4WFZA 2YKNA 4KO0B 2R2RA 1RA7A 2W7OA 3PZPA 4ICLB 4RUCA 1TV6A 3MFHA 2RF2A 4ZP8A 3G86A 4O3QA 1S6QB 1RYRA 1R0AB 3UPFA 5C25A 4NLPA 3KLIA 1TL3B 1C0UA 5F8HA 3GV8B 1RDRA 5F8GA 2YNIA 3IN5A 2HWHA 4EO8A 2W9CA 2V9WA 4O44B 3IG1B 4M94A 2GIRA 1NNDA 1JLQB 2BRKA 3MR5A 1HQUA 1VRUA 4I7FB 1LW0B 4WYWA 3MEDB 1XR6A 2FJWA 3T5KA 1SH2A 3QIPB 4NLQA 2BE2A 1HYSA 4YR0A 3PJWA 1RTJB 2C28A 4DG1B 5F8JA 2FVPA 1ZETA 5KFAA 5KFYA 5KG4A 3KHHA 1RT2B 2JLEA 1NHVA 3HVTB 1HYSB 3KHGA 1EP4B 1D0EA 4GC6A 2J6UA 3ICLA 4IFVA 3LP1A 4H4OB 4MIBA 2JC1A 3DRSA 3H5SA 4ED6A 5C42B 1FKOB 4RW8A 1C1BA 1REVB 4B3OA 4O4GA 2CKWA 3FFIA 3NBPB 4KKOB 4PWDB 3N6NA 4ECYA 2JEGA 4XPCA 2OPSB 2AGQA 1S9EA 2W7PA 2OPRA 3BQ2A 1S6PA 3DI6A 5F8IA 2C2DA 2VG7B 1R0AA 4ECSA 3CJ3A 2HNYA 5J2NA 3CO9A 1IKXB 3T1AA 4ECWA 2UUTA 3V81A 2HNZA 4ZP7A 1GX6A 4G3IA 1S1TA 1LWFA 3JSMB 5L1LA 2J6TA 3V6JA 5CYMA 3DLEA 4Q44A 1S6QA 1RT5A 1RTDB 1HPZB 3ITHB 1S97A 2BANA 3FQKA 1WNEA 4IG0A 3LAMA 5L9XA 1C0TA 4Q43A 4ED3A 2BRLA 2D41A 1JLGB 2YKMA 1JKHA 1TKTA 3ITHA 4KAIA 3H5YA 3QYYA 1JLFB 4GC7A 3MF5A 2ILYA 4K4XA 1T05B 4MFBA 4J9SA 4RNHA 4ZVHA 3DLGB 4RW7A 4KFBA 1C2PA 3KK3A 4NZ0A 1D1UA 3QIDA 3C6UA 4TXSA 5EWFA 4ZHRA 5F8MA 3NAHA 4EYHB 4ZVEA 1S9FA 3DI6B 1LW2A 4KFBB 1S0OA 1U09A 2UVRA 5J2PA 2W9BA 4F4XA 3KLFB 2E9ZA 5J1EA 4ECXA 3T19A 2WHOA 1JLFA 4YR3A 3DLKA 5KFXA 1KLMA 4ZPAA 3BSNA 1S0NA 5CYQA 1JLGA 5KFTA 2BQ3A 4H4OA 2YNFA 4IH6A 3DLGA 3QIPA 4RW7B 4O3NA 3CDWA 3QGHA 1N6QA 2WCXA 1HPZA 2C22A 4QW9A 2AX1A 4Y34A 5I3UB 2YNGA 4TN2A 1RTJA 2RDJA 3M9OB 2DPIA 1EETA 1JLAA 2IAJB 4RNFA 4Q0BB 2AGPA 3MECA 3I0SA 4WE1A 1HQEA 4LQ3A 1HNVB 4NRTA 4I7FA 3UDLA 4I2PB 2HNYB 3QGIA 4NLUA 4URSA 5KFNA 2XC9A 3GIMA 4K50A 1QAIA 3IGVA 1LWEA 2VG6A 5KFRA 3RAXA 4KBIA 4EYIB 3I5BA 2YKNB 3QO9B 4KO0A 4PQUB 3IRXA 3IRXB 5C24A 3MECB 1IKYA 4ZPCA 4LSNB 5KFOA 5KT4A 3FFIB 3NBPA 4KKOA 2XGPA 1HNIB 1LWEB 2VG6B 3MFIA 2V4QA 4IG3A 1TL1A 3BQ0A 2GC8A 2HWIA 4YR2A 4QWAA 1XR7A 4LQ9A 4KSEB 1DLOB 3BQ1A 1N6QB 3JYTA 3M8QB 1IKWB 1S1WB 2ZE2B 3LAKA 4OL8A 4QPXA 4URGA 3BREA 3KJVB 4H54A 2R8IA 2BQUA 2FLPA 5KFBA 4RU9A 1BQMA 2IA6A 4NLDA 4LSLA 2B6AB 2B6AA 2IM3A 3KK2B 4NYZA 4DL6A 4YMEA 3DOLA 2I5JA 2I5JB 1S9GB 1IKWA 1EP4A 2I1RA 1TQLA 3DYAB 1RT2A 3FRZA 5KG2A 4ID5B 4O3RA 1XR5A 1KLMB 3N6LA 4URQU 3EZUA 1FKPA 2V0NA 1QE1A 3TVKA 2GIQA 4IOBA 3OL7A 1Z4UA 5KFZA 1N5YB 4ECVA 4NLYA 3KLGB 2EC0A 1S1XA 3KMSA 2J6SA 1HMVB 3LP2B 3JYTB 3KK3B 4IH7A 1RT7B 3QO9A 3I0RA 3MEDA 4PQUA 4U6PA 3EPGA 2WTFA 2RKIA 3BSCA 3EPIA 2R8JA 4EBEA 3LP0A 2V4RA 1RTHB 3KK1B 4O44A 5I42A 4J9LA 3FSIA 3C6UB 2B43A 1DTTB 1IKYB 2B5JA 2YKMB 4RW4A 5C24B 4TYBA 5DQHA 5L1IA 3V6KA 1J5OB 3KLIB 2ZD1B 2R8KA 1MMLA 2BANB 4ED0A 2IM2A 3GIJA 2RF2B 4R8UB 3GILA 1IKVA 1T03A 3SFGA 2QV6A 3CDEA 2HMIB 4O3OA 1W25A 2OPQA 1IKVB 1C1CB 1S49A 3GIKA 1K1QA 5J2PB 1S1UB 3DM2B 2R2UA 3DRPA 3V4IA 4IDKA 4G1QA 3HVWA 4TYAA 1RT3B 3PR5B 2ASJA 3LP2A 4IRKA 2D7SA 3PJXA 4ZHRB 4MH8A 4Y2CA 3MR3A 3DMJA 5KT2A 3TAMB 2VG7A 3DOKA 3KLHB 4TY8A 4ZMMA 2R8HA 1S4FA 4MKAA 4JV2A 3CDUA 3DRPB 3LP1B 1IM4A 5KFDA 3CJ2A 3G6VA 4ED7A 4PWDA 3TAMA 4TY8B 3E01A 2JEFA 1QE1B 2FLLA 1N48A 4KV8B 4WFXA 2R8GA 4TQSA 4WZMA 2HMIA 4R5PA 1GX5A 4K4TA 3H40A 1ZTWA 1KHVA 4YP3A 4J9NA 4IG0B 4FS1A 4H4MB 1YVFA 1FK9A 3KK2A 2VG5A 4NLRA 3C6TB 1JKHB 1TKTB 4Q45A 5CYMB 1BQMB 3N6MA 3KHRA 3M9MB 4QWCA 4EBCA 3ISND 5J2QA 3GV5B 3H4DA 2ATLA 1I6JA 4ZP9A 5KFEA 4Y2AA 3RB4A 3OSPA 1TKXA 2FVQA 5D3GA 3OHBA 2C2RA 4MIAA 5L1JA 5DG7A 3I5AA 3NAIA 3H59A 5DLFA 4Q0BA 1N5YA 4IFYA 4O4GB 1CSJA 4WYLA 4RUAA 3OSNA 4DL2A 2AQ4A 2FLNA 3H98A 5DGAA 2JEIA 2HAIA 5KG5A 5C42A 4JV0A 4ED8A 3H5XA 1JX4A 4XO0A 2RKIB 4ZPDA 2XCAA 4J9QA 4ED1A 2XI3A 1HARA 3T5LA 5J2QB 2RDIA 1JLCA 4IR9A 2WB4A 1EETB 1JLAB 2IAJA 2AWZA 2YNHB 3I5CA 5KFFA 2W8LA 1JLBA 3KLVA 4LSLB 2VA2A 3MEEA 4X2BA 5KFMA 2FVCA 5J2MA 3G6YA 1S1VA 1TKZB 3UQSA 4IRDA 5CYQB 5KFKA 4U7CA 1RA6A 3BJYA 2UVUA 1NHUA 4KV8A 2C2EA 3SI8A 3CJ4A 4ECRA 4RNOA 3HVAA 3MR2A 2ZKUA 3RAQA 3KJVA 3DRRB 3RBEA 2R2SA 3PW0A 3HHKA 2QE5A 5F8NA 3D28A 3PW2A 1SH0A 2WOMA 4MFBB 4M95A 4KB7A 5D3GB 1JLQA 5HBMB 3DMJB 2ILZA 1LWCB 4XPEA 3H5UA 4MK9A 4NLTA 1HNIA 3Q8QB 5KFLA 4JV1A 1OS5A 4TY9A 4NLXA 4Q8EA 3OHAA 2D3ZA 4TLRA 2F8EX 5C25B 2BQRA 3C6TA 5KT3A 5T14A 1TVRB 1TV6B 2IJNA 3H2LA 5DLGA 2WK4A 5KT7A 4F4ZA 3OL6A 1RT6A 3GQCA 1SUQB 4IQXA 3LANA 4IRCA 2YNFB 4IR1A 3FQLA 3KMQA 2FVSA 4ECUA 4ZVGA 4MK8A 2VG5B 5J2NB 1LWCA 3T5HA 3Q8SB 4H4MA 3PVXA 2UVVA 3QZ7A 3BSOA 2ZD1A 3QLHB 1JLEA 1S1TB 2OPRB 2JEJA 1LW2B 3BGRB 1RTIA 4RW4B 4WXWA 2HNZB 3DOKB 3KLHA 2UVWA 4RW6A 4Y3CA 1REVA 4B3OB 4F4YA 5HBMA 3MEGA 3LP0B 3TQ1A 4DL4A 3GV7B 4ID5A 3HKWA 5HP1B 5F9LA 5HP1A 1S9EB 5JUMA 3GIIA 4F50A 3DM2A 4ECZA 3MTKA 5DG8A 3OL9A 1S1XB 3KLGA 3DOLB 1S48A 3HVTA 4K4ZA 1ZTTA 4K4WA 4RW8B 1C1CA 5KFCA 3NGDA 3RB3A 3M9NB 1S1VB 1TKZA 1JLEB 5L1KA 1S9GA 1S1UA 2FVRA 4F4WA 3MEEB 2WRMA 2E9RX 5EUHA 4JUZA 5EWGA 1HQUB 1VRUB 2WONA 5HROB 5HLFA 2OPQB 2IM0A 3CJ5A 3V6HA 3IS9A 3BSAA 4KHRA 3LALA 2BE2B 4QWDA 3CVKA 1J5OA 2W8KA 3OL8A 1RT1B 1S1WA 2ZE2A 3M8QA 1QUVA 4EEYA 1T03B 3Q8PB 1C0UB 4J9RA 2IC3A 4K4SA 1IKXA 4FBUA 4ZPBA 4R8UA 1RT5B 1RTDA 3QGGA 3IG1A 5KFHA 1LWFB 3JSMA 4IFYB 1S6PB 2IC3B 3PR4A 4PUOA 2YNIB 1RAJA 1HQEB 3NKYA 1TP7A 4KE5A 2W9CB 1RT1A 1UWBB 4HYKA 2IBKA 4DL3A 2AU0A 3MR6A 5I3UA 4O3PA 4MKBA 4I2QA 5KFSA 3DRSB 4I2PA 2WOMB 1QAJA 3RB0A 2VA3A 3I0SB 5FDLA 3PW4A 1HMVA 4QW8A 4O4RA 5C5JA 5KG1A 5KT6A 3RB6A 1C1BB 4IH5A 4J9PA 1VRTA 1VRTB 5KFUA 2WONB 4KHMA 2CJQA 5KG3A 3KLEA 4K4UA 2E9TA 4IFVB 1T94A 5FDLB 5KG6A 4DL7A 5KFIA 1RT4A 1DLOA 4NCGA 2XI2A 2XWYA 1LW0A 3GYNA 4NRUA 4ZVFA 2DPJA 5KFQA 1TL1B 3D5MA 3BR9A 2ALZA 1JLBB 4DEZA 4HKQA 2OPPB 3T5JA 3E01B 5JXSA 1JLCB 2W9BB 4NLSA 5KFVA 4NLWA 3KNAA 3FDSA 5EWEA 5KG7A 5F8LA 4PUOB 4G1QB 4TQRA 3KHLA 1MU2B 3Q8RB 4RNNA 4I2QB 4K4YA 2OH2A 4FBTA 2O5DA 4NLVA 1SV5A 4RNMA 5KG0A 4ICLA 2XCPA 2IMWP 4ZP6A 1JIHA 2BR0A 1HNVA 1UWBA 2FJVA 1KHWA 2D3UA 4EO6A 3NL0A 4ECQA 1TL3A 3V4IB 3CWJA 1SH3A 1C0TB 2FJXA 5KT5A 2YNGB 4YQWA 2AX0A 1T3NA 5HROA 5HLFB 1TKXB 4WXOA 5DGBA 3CJ0A 1FK9B 4O3SA 5KFJA 4R0EA 2UUWA 3G6XA 1TVRA 4J9KA 3RBDA 2JC0A 3M8PB 3PW5A 1N56A 4WE1B 2XGQA 1JXLA
chains in the Genus database with same CATH superfamily
4GKJF 1UJ5A 3V6DA 3AOBA 4ED2A 4OHXA 2NXNA 3OFFA 2PSZA 1RJJA 1URRA 2AEFA 2L9WA 1MSWD 3KK1A 1SC1B 4RZRA 2B7BB 1KVIA 2IJFA 2CVEA 3PYEA 2QFIA 4DCPB 4UQTA 2MQMA 3F41A 1PJ6A 3BN7A 2OPSA 3FSXA 3W9JA 2KZZA 2DNYA 2WSEC 2P6SA 4H4KC 4TU9A 3DLKB 3ISNC 1JMTA 3EICA 1HBOB 3ENAA 3M7VA 2ZH2A 1NK7A 2JLFA 3OVBA 5F9NA 1Y3KA 3M6UA 2MSSA 4CRJA 2MQ8A 3G2XA 2HEKA 4F0MA 1F5CA 4K4VA 2R2TA 4NCGB 2W4PA 3OFGA 3OTDA 3DRRA 4IKAA 4B3RF 4O23A 3IR6B 5B7WA 5HQLA 4NEYA 1RYSA 3WZ0A 2BEFA 2LEBA 1PO6A 1Y00A 3N5FA 3TX8A 4U67Q 5JVGQ 3BGRA 3M6WA 4OLPA 2XNQA 1RT4B 2AEMA 2HFSA 2DHAA 1SQGA 2OEJA 2EC2A 4NLGA 2KFYA 4ANCA 5E0OA 2ASDA 2PI4A 2EKNA 2HKEA 5DQGA 2HGLA 3NMAA 3UCGA 2BE7D 1HD1A 4IG3B 3E51A 4NX9A 2YNHA 3H0PA 2ASLA 3V6DB 1RKJA 2K7JA 2HLTA 1KEKA 3G82B 3EVWA 1FFGB 5HATA 1S0MA 1R8HA 4USVA 1X5TA 4KO0B 4WFZA 2R2RA 3P3DA 2KT5A 2AP6A 3PFOA 4CLZA 2QA2A 1Q5YA 1S6QB 2AZ1A 2E1AA 2UZAA 1VK8A 5HSPA 4NLPA 2HSEB 2XQCA 1RAIB 3CO0P 3T1YJ 2VONA 1TL3B 1C0UA 2H48B 2H51B 2V9KA 4CNZA 1IBLJ 3NXZA 4LRFA 3BYRA 2KN4A 1X4GA 2X1AA 2V9WA 2PE8A 2YBVA 3ADAC 3TEHB 1V3ZA 3IG1B 4DZ6A 2AYMA 3ILOA 2YQ3A 3JQJA 4DQQA 3C66A 3Q8VA 2B9WA 2R4FA 1HQUA 1QVGR 4WYWA 1LW0B 1RAGB 1VISA 1ZH5A 1XR6A 2FJWA 3T1HJ 1I3OB 2EEYA 2KU7A 1R8PA 5HVHA 1SH2A 1ULRA 3CE8A 3I96A 4L3KA 4YR0A 5D4LA 3FCHA 2FGCA 1OJ4A 4DG1B 4LR8A 2FVPA 1ZETA 3CGIA 1FD8A 3DGPA 3GSDA 2YPZA 2ZH9A 3CJTA 4DR4F 2XMVA 2GJ2A 5D15A 3HVTB 1HYSB 4KHPF 1EP4B 1D0EA 3Q83A 1UL3A 4J9VA 4B3MJ 3HF5A 4IFVA 3LP1A 3M1VB 1DZ5A 3GJQB 3HO1A 4MIBA 2LEPA 1OSDA 3C16A 3BB5A 4PYDA 2E1CA 3ZC4A 1A9NB 4ZLLA 1YJNS 4BLGA 1B64A 3T41A 3A3NB 3NBPB 4KKOB 1OY6A 4PWDB 3GJTB 5L8RC 2DRAA 1R6YA 2OPRA 5F8IA 3DI6A 2C2DA 1PJ7A 2DBBA 1X5PA 3ELHA 4FDFA 2L3MA 1FFSB 3BBFA 1K0VA 3CJ3A 1KFSA 4A48A 4UOGA 2ZWPA 4QR0A 3DU6A 3V81A 3IXQA 1QSSA 2VB6A 2ZFHA 1NSPA 2AV5A 2MJUA 2NXUA 3GIRA 4ZP7A 1CULA 5CH7B 2L9DA 1S1TA 3F56A 2DY1A 4ZVQB 4U7UK 3QPIA 3HX9A 4CLKA 5CYMA 3DLEA 4Q44A 3UD4P 2VBYA 5ITHA 4I68A 1WNEA 3MAAA 3WX8A 4NA2A 1NDPA 3FVYA 2QSFA 4F3MA 4JI2J 3TVYA 3CMES 1IBMF 2EK6A 1JLFB 3IRWP 2CFXA 3OR2A 4U95A 2OSQA 4B3SJ 3MF5A 2ILYA 4K4XA 1CQMA 1U1NA 1T05B 1WKLA 3MMAB 4J9SA 2CAJA 2CPZA 2H5JB 2V5HG 3M32B 3W2WA 1CULB 1DHMA 3KK3A 4Y6IA 4NZ0A 2JVRA 1D1UA 2L41A 4N76A 3TQEA 2GHWA 2P2CB 1RCXB 2UXDJ 4K8RA 1QUPA 1TL4A 2E5JA 3VWSA 3K59A 2H9ZA 4DR5F 3QT8A 3SQGA 1S9FA 1LW2A 1BY9A 2FJAB 2Z57B 4JI1F 3RYLA 4KFBB 4XDCA 1VJWA 1U09A 1GAOA 2CPHA 3AB2B 4ZPTR 5J2PA 3ZTRA 1WWHA 2RDDA 4CT9A 2CNOB 5J1EA 4RPFA 4ECXA 1M5OC 2HHUA 2ZDPA 4X4QA 3MM5B 2WHOA 1JLFA 1HI1A 2JDJA 2HBZB 5KFXA 4JBCA 3THTA 3OVSA 2YH1A 1TK0A 4RWWA 1UMJA 1UKUA 2CNNB 3OPKA 3L09A 2YNFA 1VC5A 1RWKB 3CDWA 2XMWA 1WKJA 1TELA 2LXFA 2W24A 5F0UA 4DU8A 4ENOA 4C8LA 1HPZA 1M5PC 2MPUA 3B6BA 5HQ8A 2C22A 1FDDA 3BDEA 3HJFA 2XY5A 4Y34A 2YNGA 4TN2A 3B82A 4DZDA 2RDJA 1X0FA 1F60B 2A10A 4M5IA 3HKZD 3UN3A 3J7YU 1RHUB 4WWSA 5D8HB 4TU8A 4DSKA 3DLBA 1HNVB 3ILLA 4K0KF 2FIUA 4LBHA 5ETSA 4I2PB 4DX7A 3GIMA 4LF6F 2XC9A 1F5BA 2XY6A 2J9EA 3DRXA 2NUHA 3GR1A 4MIWA 3DDIA 3KG1A 3RAXA 5KFRA 3SCIE 1RUSA 2GNKA 2BXJA 2A18A 3MECB 5IM0A 2PFFB 2M88A 1EQ0A 1GEHA 3M8RA 3NBPA 4KKOA 1RAEB 1HNIB 1S79A 1RTZA 1S77D 4DPOA 4MKVA 2DCUB 2HWIA 3FBCA 3C16B 3BM7A 4CLLA 2PA3A 1N6QB 2GVDB 2X1BA 4QWAA 1DFDA 2R8IA 2EPIA 3KJVB 2ZVSA 3CDBA 3D68A 2CNLB 1BQMA 1FJ7A 1RAHB 4NLDA 5HMZA 3PX6A 2B6AB 2J0XA 1S12A 1EX8A 1XBWA 3AOAA 5DDOC 3VR1A 4F7VA 3NRBA 5HMYA 5IT0A 4DL6A 5B0FA 4YMEA 3DOLA 3B78A 1JNRB 2I5JB 1PYTA 2F8MA 3BN4A 2WB1D 3VAKA 5EX0A 1RT2A 2H5IB 1U02A 1KLMB 1G6BA 3CJ8A 4OJ3A 4D3GA 2HIQA 1NHKL 3EZUA 3OL7A 4JI0F 4WFNQ 1RLDA 1Z4UA 5KOWA 2EC0A 2JWNA 2ZJPQ 3KLGB 4JI5F 2OGUA 1Q95G 2BVZA 2DNKA 3FBEA 3RRGA 2OEMA 4DN9A 3HPOA 2RKIA 1RAAB 1YIJS 2HHHJ 3G6ES 1YI2S 4OI1A 1VMBA 3KK1B 2VFUA 2IRXA 3FSIA 1RZMA 3ZTOA 1DTTB 1F5AA 2C3UA 4AYBD 4ETZA 2NXCA 5IM0B 4DR5J 2NQPA 1PC4A 4QIFA 1MMLA 1TK8A 2VBZA 2HIYA 3FKBA 4UUXA 2MGZB 2HHTA 2GVZA 3BKTA 5GADU 3HZGA 4OYBA 1JJ2R 3IR7B 1N8RT 3QJLA 5GAGU 2N82B 2HFOA 3UN2A 1E6YA 2MSTA 2ZH6A 5F41A 5FIIA 4YY3J 1U1PA 2DH7A 4M5GA 5CA5A 1C1CB 4NCBA 4B3RJ 2QSWA 1HNWF 3LWLA 2HVDA 5J2PB 3CMQA 2JLGA 4FF4A 1Y4ZB 2R2UA 3HSGA 4IDKA 3IMQJ 3HVWA 4TYAA 3A8EA 1KQFB 5AE2A 1IBKJ 3PJXA 1NJZA 3FEZA 4Y2CA 3MR3A 3D0HE 3HHLA 3DMJA 2CJ9A 1MMDA 4FYXB 3AFGA 2VASA 4LBIA 1YZ6A 2PIIA 3VGUA 4DR1J 3CDAA 3H90A 1KVKA 2CADA 1RAOA 2CQ0A 3GFXA 4MKAA 4L3NA 1EB0A 1IM4A 2KO1A 1X5OA 3OBIA 3G8SA 2UUBF 4PWDA 2CG8A 2R7UA 2VV5A 1XMQJ 2AF6A 4WKYA 1K9MT 4C8KA 2ZUGA 4YB1P 1KRPA 4GKJJ 1KOHA 3K5NA 4BHQA 2FJBB 1GX5A 1GT8A 4C3LA 4R25A 4DV0F 3PY8A 4MMOA 5D0RA 3UE2A 2XO6A 2HGMA 1TKDA 1FK9A 3KK2A 2VG5A 3MM6A 2YKOA 2CVIA 5CYMB 2A6MA 5A8RA 4DUYJ 4Q2LA 3KHRA 4HL9A 2Z0GA 2FZCB 2AT1B 3LQVA 4USTA 2X1FA 3BS9A 4CH0S 3U1NA 3I56S 2VPZB 1WORA 2QMWA 1QM9A 3R7SB 2O3DA 1KOOA 3ZZYA 5L1JA 2C2RA 2B8QA 3D2WA 4P74A 2OUGA 3I5AA 2I0XA 2Y1LB 4OJHA 1HW8A 1EKRA 3KUHA 1M1HA 4OMFG 2B9EA 3HFVA 1WF0A 4Q0BA 2CPJA 4O4GB 1WC3A 1W7WA 3GE9A 4DL2A 1VQPS 5H9FJ 3BH7B 3M30B 3QATA 3Q0AA 2FLNA 3K0JA 5KG5A 4JV0A 4ED8A 3H5XA 4WKRA 1QAYA 1U0HA 4XO0A 2COLA 4ED1A 1NSAA 4AE5A 1WHWA 2HS0A 1JLCA 2AWZA 1EETB 2IAJA 3I5CA 2YNHB 1Q53A 5A2QU 2NXJA 3CCUS 1RHQB 4WCEQ 3R6LB 4UW2A 5BYRA 1FDAA 1SKWA 2BJ8A 3CD6S 2VA2A 4X64F 3AQPA 3VVTA 1VK3A 2QN6B 3W65A 1UVIA 2R7QA 3EDRB 5FJ4A 5FLXU 3PO5A 3P8BB 3BGFA 1ZM9A 5I4MA 5KFKA 1DARA 1P9YA 4IOCQ 2FHMA 5CCMA 2UXBJ 5CD4H 3M2UA 5D0HA 2LECA 3C2PA 3LH2S 4LFAF 1CS4A 4RNOA 1NDCA 3S7RA 1Q82T 1SJ1A 4GKKJ 4OZ2A 1LK7A 2Z2YB 3D28A 2UXCF 1U0HB 4KB7A 2J0SD 4WU3A 2DJWA 1FFWB 2MMYA 3H2VE 1WI8A 4LR9A 3ZO7A 1LWCB 3Q8QB 1U24A 3PACA 1BC6A 1YRUA 1KQKA 5KFLA 3T1HF 3E2EA 2Y1RI 4F04B 4Q8EA 2BJ3A 3G82A 2O67A 1RU2A 2D3ZA 1N0VC 1HHTP 5C25B 1N54B 1R8CA 1UFLA 2HQDA 4JI7F 2Y1JA 3C6TA 2MQOA 1SI9A 2HBQB 2QLWA 3CTRA 3H2LA 2WK4A 1NK6A 4N8OA 1RU1A 1SUQB 3Q86A 3KNGA 5BJRA 1XWLA 3OXFA 3VGTA 4WK1A 1N33J 4IR1A 4LF4J 4ELTA 5E2QA 2FPHX 4ECUA 1M1GA 2BBEA 4ZVGA 2GZOA 3I32A 5CQGA 4LRBA 4ZITA 4DV4F 3O44A 2J7WA 3PYGA 3TA2A 4USMA 3F0NA 2IIHA 2BW7A 3TUPA 2MKYA 5LMUJ 3K8VA 3BSOA 2BE9B 3A13A 3MPWA 1A7GE 2B9YA 3W64A 3CC2S 3BGRB 1V5IB 3MMJA 4GVBA 3GFYA 1XNQF 3KLHA 2YTCA 2YKPA 3SEOA 5LMUF 3MXHP 4Y3CA 2RRNA 3PRDA 5HBMA 3MEGA 3D4JA 3HM9A 2DR8A 3TQ1A 2ZOMA 2OKQA 4CO0A 3HKWA 1SJ4P 1ZPVA 5HP1A 2BM1A 1WDDA 1NK5A 3FCVA 3DOMA 1RHMB 4OFZA 3KLGA 1S48A 4DI6A 1SB6A 2KTQA 2CPEA 3ZTPA 4E2FB 1VHIA 4WPAA 1C1CA 5KFCA 3UD5A 1FRMA 1ZM3A 2GS8A 1S1VB 1S7IA 2C2OB 4NE9C 3DDNA 3ZNJ1 4OZ1A 1FA0A 3MPUB 4CO4A 1VRUB 2B7CB 2M3DA 1D9DA 3ULHA 4HACB 4K2JA 5BR8F 3PRBA 1HR0J 3LALA 1R31A 2M52A 3QRQA 3TUZC 2GVDA 1QUVA 4EEYA 5BR8J 4CCHA 3Q8PB 1XMQF 4X62J 3CCQS 3WBZA 3O1LA 4HT7A 3SQOP 2UXDF 4RBUA 2D9PA 1RT5B 1RTDA 2DGTA 2XEXA 3GLJA 2IRUA 4OX6A 1H7WA 2AW0A 3WDOA 1I94F 1LWFB 3S8SA 2CQHA 3J81U 1S6PB 1S6UA 2HHVA 2YNIB 2CPYA 1ROFA 1TP7A 2PO4A 2VD3A 3KTQA 1YRTA 3R5GA 3JTOA 3FBFA 3NGSA 4DL3A 3D1HA 3CJKA 2MQLA 4O3PA 4ZK7M 2Z30B 4MKBA 1VBKA 2VA3A 1DY3A 1UA0A 4EWTA 2ALYB 1HIYA 3MM8A 7AT1B 4LF8J 3TRGA 1AFJA 2R7SA 1U47A 5KT6A 4IH5A 4W90B 4OYXA 2UUCJ 1EQMA 5KFUA 2IFXA 4KPCA 1ZBTA 1UJ4A 4AXJA 4B9LA 2OJ3A 2MY7A 1R27B 4J5OA 2ZBPA 5B0BA 4K4UA 1DAXA 2CZVC 1GK8A 4RUBA 5FDLB 2XZTB 4KYZA 2C2KB 5E3RA 2XWYA 1DLOA 5KG6A 4DL7A 2ZZTA 3POTA 2B51A 5IQQA 4UY85 4UTGA 3RW6A 2JSXA 4M5LA 1BMQB 1Q7LB 1F9HA 2LYVA 2DHHA 3BR9A 1GQEA 4HLBA 4Z2XA 2ALZA 4HR2A 3TVZA 4DPWA 7FD1A 2OLWA 3RZAA 5K8NA 3T5JA 2W9BB 4NLSA 1UVJA 4QU6A 3MUMP 2RUGA 1Q16B 3AAWB 2CQBA 5KG7A 4PUOB 5DO2A 5EWEA 3KHLA 4LF1A 3CCMS 1KWMA 1S6OA 2HRTA 4DV3F 2OH2A 2VICA 2MKIA 4YN3B 1YJ7A 2KKHA 4I67A 4DS4A 4PPDA 4X64J 4ZP6A 3R5DA 3PO4A 1Q1KA 4K7QA 3NL0A 4EO6A 1SC6A 3GR0A 2JVOA 4ECQA 3JS9A 4CYUB 3SYZA 2W1BA 4RJVA 2FJXA 5KT5A 1T3NA 2AX0A 3A12A 3BH6B 4LT6A 4ZVSB 2ACYA 2PMZD 1FJCA 4B9MA 2Y8YA 3J7ZT 4R0EA 3RBDA 4IQXA 1TVRA 4I4BA 5ETKA 2JC0A 3M8PB 4J9KA 1N56A 5CYJA 2ADCA 4GKKF 2NUUG 2NZ4A 3UFCX 3EGVA 1AZSA 1CVJA 2OEKA 5GAHI 3M8PA 2AYGA 2YH0A 2NS1B 1H2VZ 3HCXA 1XNRF 2PC6A 4WZQA 5CCLA 5J1EB 3DLHA 2E5IA 4K2XA 3KOAA 1VBYA 5KTQA 1BQNB 1F9FA 4L74A 5E3QA 1ACMB 4MK7A 4Y0FA 5B09A 4JI7J 1DTQA 4N77A 1X8DA 2B5JB 2VFTA 3TR5A 1VQ9S 3QZ8A 1P1TA 2MHEA 3R6GB 2G0IA 2CNKB 1JB0C 3KLFA 2R7OA 3NWRA 3SMZA 4DBQA 1FJEB 2XWXA 1DTQB 1Q8BA 1RTIB 3CMAS 1MU2A 5KFGA 2XB2D 4NLOA 5J2MB 3N5BA 1H3DA 1P9QC 3TYTA 5JMNA 2Z56B 3RBXA 4Q8FA 1FRJA 3VAMA 2MLZA 3AJ2A 3UN5A 2BUNA 4I0WA 3SCLE 1SJ3P 4WFBQ 4QWBA 2DISA 5DQIA 1H74A 4Y2KA 1HNXF 2PEBA 4DV7F 1T95A 2B56A 3CIZA 3PW7A 3UVJA 1UFWA 1CBKA 4G3IA 4CNYA 1RHJB 1U7LA 3U1MA 2YWEA 3GFZA 3AY0A 8AT1B 3N01A 2MQPA 1REGX 2HYIB 1QSYA 2IVMA 2V2KA 1RWOB 1K1SA 3CSKA 3QFWA 3I4HX 3V4MA 2AGOA 3AH6A 3OR1A 4YDDB 1UW4A 2CWXA 2DR6A 2DRDA 2WVDA 5D77A 5MLCV 1Q0NA 2V2VA 3PZPA 2DIUA 4RUCA 4A8SA 1KD1T 3G86A 3UPFA 4OI4A 3M8ZA 4C6AA 3M6XA 2V8PA 3PTWA 4LR7A 4HI1A 4DCJB 4ZIWA 1J2VA 5F8HA 3GV8B 1N88A 3ET6B 2WSFC 5F8GA 4ZLPA 2XS2A 1YTYA 4NI2A 1WTBA 3B54A 3NNHA 1JLQB 2KT3A 1U25A 1WC0A 5HVFA 1UP1A 3TA1A 4A46A 3NNCA 1VRUA 1SBRA 1HHQA 2DGWA 2DGVA 4LF5J 1NPRA 2VPWB 2KZMA 1SQEA 1BLUA 3J7YI 3WC2A 2G4BA 2OMOA 2Q79A 4NEZA 4NLQA 3CCZA 5LT5A 1HYSA 2B4UA 4LVOP 2DNHA 4EU0A 1RTJB 4DV1J 5F8JA 3OT9A 3VF0B 1UPMB 4LF5F 3JB9k 4F4KA 3MR7A 2IVFB 5KFYA 4KH1B 4DUYF 1NHVA 1U48A 4O0NA 3OFEA 4YB7A 4GC6A 2Y0BB 1LFWA 2GJFA 3EWGA 3MOZA 4C8MA 4U9RA 4PYAA 2JC1A 3DRSA 4DV5J 5A0YA 1BGXT 5C42B 4AL6A 4RW8A 2CQ4A 4B3OA 3NGUA 3AQOA 4CLYA 3THVA 1VQ7S 4RBTA 4ECYA 2JEGA 1GXTA 1RBOB 2HGNA 1GTEA 2AHOB 2QZ8A 5C7PA 1X9SA 2J9DA 1YBUA 3D9BA 1S6PA 3ONQA 6AT1B 2DXFA 2Y8WA 1MNEA 1NK0A 4Y00A 3J81Y 1NAQA 2LVWA 3GG1A 2HNYA 3EGNA 2KM8B 3CO9A 4KHPJ 3T1AA 2UUTA 4NYOA 4PG4A 4RX6A 1PC5A 2YWKA 4PG7A 1FRLA 1SCJB 5AXMA 1X9WA 1LWFA 5L1LA 3KFWX 2AMCB 3V6JA 1NKCA 1S6QA 2PEHA 2XZWA 2ZH5A 1RWXB 3N9UC 2KL8A 3CCLS 2CPDA 1S97A 2BANA 3TI0A 3BO3A 5L9XA 4P10A 1C0TA 2F1FA 4OLOA 4ITSA 1LXNA 1SQFA 2JL9A 1IWAA 2LMIA 3LGMA 2BMBA 4ED3A 4LF9F 4OYOA 4ES3A 5B0DA 1TKTA 1NM2A 2N7YA 1KKHA 2Q6BA 3QYYA 2RHSB 1K8AT 4GC7A 1T3OA 3Q22A 1GFWB 3JSBA 1UVKA 1FNOA 2LDYA 4RBVA 5M2UA 2DNRA 4JP8A 2VPXB 3P6YC 3PNIA 5HL7Q 3VVUA 1EIYB 2DXEA 4MYUA 2MHNA 3OJSA 3QIDA 2DGUA 3AHPA 4P75A 5EWFA 3GTYX 3D66A 3MM5A 4IO9Q 1XQIA 4NXMJ 3W9HA 1U45A 5JVHQ 2BA9A 2E1RA 1NSQA 1VIOA 2UUAF 4OI0A 2QL9B 4KQZA 1XJWB 3I9V9 3NNAA 4Y28C 2N4DA 4ZVOB 2C3MA 2WVBA 1IJFB 1B0TA 4X4PA 2AEJA 3M2UB 4YR3A 4ZPAA 5H9EK 5K5MA 4ATNA 2HW3A 3T3FA 5CYQA 1GMUA 1YBAA 4H4OA 4IH6A 4RW7B 3QIPA 1F3FA 3Q89A 1B0PA 2E7WA 4O3NA 4DQRA 2WCXA 4HDHA 5GAEU 2C1EB 2K8GA 2XBPA 4Z37A 1K0TA 5I3UB 3M30A 1RTJA 1SKRA 3IM9A 2V2ZA 3M9OB 1EETA 2IAJB 2DPIA 2IMOA 4Q0BB 2AGPA 1N36F 4C4WA 1ZZFA 3MECA 2OTJS 3I0SA 4WE1A 2BJDA 2CJAA 3EE3A 4USIA 2U2FA 2QFJA 1TMMA 3NOCA 4RO0A 4DV6F 2DRBA 3ENVA 2D9OA 4NLUA 2CRLA 8RUCA 1QAIA 4DFKA 3CF5Q 1LOUA 3IGVA 2VG6A 2EFOA 4I1TA 4ETXA 4KBIA 2APOA 3UNYA 2POKA 2YKNB 4PQUB 4J91A 4LJMA 3IRXA 5C24A 1IKYA 1GH8A 5KFOA 4DV7J 5KT4A 2HQGA 3L4BC 2VG6B 1CS4B 1MLAA 1IM6A 3VALA 4NCAA 2YWWA 1TL1A 2GC8A 4HHJA 4GO7X 2B9XA 1DQ8A 2MLXA 1WOPA 3BR8A 4LBPA 1GMVA 4OL8A 1NBEB 1IKWB 2ZE2B 3LAKA 1G7CB 3CEDA 4QYRA 4URGA 4H54A 3Q23A 2BQUA 4K0KJ 1DQAA 3MD3A 1Y3JA 1YITS 1N52B 3KK2B 2DGSA 4NYZA 1FX2A 3D54A 3UVJB 2OO4A 2DNMA 4P73A 3IBCB 2GFFA 3IAS9 1S9GB 4W98A 2CPXA 1MW7A 3OD2A 2I1RA 2JH3A 4YY3F 1AXQA 3DYAB 4OJGA 3W8PA 4CO3A 5AE3A 1D8ZA 2LCWA 1GNKA 3N6LA 4WJBA 1I94J 5EX3A 3L95X 4C7QA 1FKPA 1SJQA 1GXLA 2V0NA 2RILA 4IOBA 4OHWA 4YUDA 3BYPA 1N5YB 2VUGA 4ECVA 2DHGA 2ZNZA 1CJTB 5EGYA 2CPFA 1ZAVA 4X4TA 2UU9F 4JI8F 3QT7A 4GRSA 2QX0A 1RT7B 4PQUA 4FNIA 2XM3A 3A3OB 3EPGA 4ERDA 4C8YA 3IWXA 1FJGF 3MM9B 3NCQA 3NGTA 4JI8J 3MCNA 4QR2A 5E5NA 5LM7E 4J9LA 4FF1A 3PW4A 1XNRJ 3V6KA 2X51A 5C24B 4RW4A 3TX0A 4DPUA 2ZH7A 3MPYA 5L1IA 4NXNF 2UUAJ 3S6EA 1MWZA 5IXUA 2R8KA 2D74B 2R7TA 2EFNA 2DEJA 3RR7A 2RF2B 2FB0A 1LEOA 5L38A 1IR1A 2BJEA 1HWLA 3SCKE 3GILA 3QFHA 3I87A 3LTOA 4BC7A 1S4EA 1U1KA 4NA1A 3CDEA 1FDBA 1JXEA 2HMIB 3NCPA 1T9WA 2B8PA 2W2OP 1W25A 4JB8B 5IT4A 2OPQA 1G4CA 2DR7A 4B3SF 4F0HA 2DGOA 3R1LA 2QL7B 4WTOB 2BOAA 3GIKA 1KBRA 3MD1A 2ZEJA 1Q8KA 2AYEA 2V8DA 2NYHA 3DM2B 4N56A 4E8UA 1ITPA 4PWWA 3WIVA 4B3TF 3LP2A 2D7SA 3RRHA 4O3RA 4ZHRB 3QQCD 3LPEA 2OFHX 1T9TA 1YKWA 2ADBA 3CT9A 5BXIA 2K1RB 1BD6A 3DOKA 4PCQA 4ZMMA 2R8HA 1HBMA 4UY8T 2E1MC 1S4FA 4B02A 2X3DA 1M5KC 3C46A 3P45B 3G8TA 4LFCF 5KFDA 3CJ2A 2VKZG 2JX2A 2F9JA 2MDAA 3TAMA 4TY8B 3G6VA 3E01A 1I5OB 4ED7A 2XG8A 1SC4B 1UETA 3C3LA 3JTNA 5ETMA 4WFXA 1PJ5A 1RAFB 1XC9A 4QU7A 2DD8S 3OTBA 1NPKA 4ILRA 4UZCA 1QLNA 4MT1A 4FS1A 2EWHA 1YVFA 4PXBA 2E29A 3M2VA 4NLRA 1NPPA 1TKTB 4Q45A 4BWMA 4YB5A 1BQMB 1FESA 2BKOA 3ISND 2O1PA 2RQKA 3GV5B 1MROA 4OZNA 2DO4A 3EDQB 1I6JA 4X84A 1KC8T 2VH7A 4Y2AA 2LDIA 2KM8C 4YOEA 1HBUA 3WIUA 2R7VA 2B0GA 1TKXA 4QYZK 3OHBA 1MWYA 3JTPA 4QIWD 3A8JA 5D6GA 3A8IA 3H7HB 4TU7A 3NAIA 1TL7B 5AT1B 3ZTQA 4AXIA 4ELVA 3BGOP 3VAGA 2J7UA 2VDIA 5G0RB 5HJXA 4WYLA 4RUAA 3OSNA 2FJDB 3NLCA 2JZ5A 2AJ0A 2N7CA 2JEIA 4MJKA 5C42A 2HVIA 2VFSA 3IO1A 2RKIB 4DPYA 1X31C 3G4SS 2XI3A 4CH7A 4J9QA 3OR1B 3T5LA 2RDIA 2WB4A 1JLAB 1BHNA 1FVQA 2OP5A 4ZVRB 1NKEA 2W4CA 3R2DJ 2VC0A 2VBXA 1NMEB 4GVLA 1ZZNA 2H5EA 3CJRA 4LSLB 5A0YB 1VC0A 2UVRA 4LF8F 5T7LB 2C2MB 2RIJA 5CZVA 5KFMA 4M5NA 1UCNA 3RB6A 1S1VA 4IRDA 3UQSA 3DHXA 2IBOA 1C4CA 3THPA 1SIZA 4WIQA 1RA6A 2K7KA 4U7CA 3OUYB 1Q86T 4KV8A 5A8WB 1TUGB 2C2EA 3CJ4A 3KJNB 5DDRC 4CO2A 2ZKUA 3IAM9 5B0AA 2R2SA 3NGKA 4GVBB 4TVAB 4PRFA 5ADZA 4NMLA 2E5LF 1YGYA 4MFBB 3WC0A 2FZKB 3M6VA 3ZZ0A 1JLQA 5HBMB 2N4CA 2RSQA 2ILZA 4XPEA 3H5UA 3NCRA 4OJ1A 1HNIA 1SVDA 2R7XA 2RJZA 3W8GA 1JNZB 4NLXA 4Y2MA 1RWWB 3DXBA 3RAMA 1XMOF 3OHAA 2AYBA 2Z2LA 3M32A 4DR3F 1HWIA 3BF4A 2NPFA 5LSOA 1NH8A 2VIHA 2BQRA 5KT3A 5T14A 2GCFA 2QMUB 1CC7A 1FE0A 1WTFA 2IJNA 3BKUA 3K5PA 4FNHA 4A47A 4F4ZA 4UOHA 1HNZF 1RT6A 2NREA 4C9DA 1AW0A 1Q7YT 2DB1A 3N0VA 1N0UA 2I38A 4USHA 2QYCA 4IRCA 4DPTA 2JFKA 4DSIA 4LUBA 2EBGA 4MK8A 1AROP 4DCOB 2PN6A 2KJVA 5J2NB 2PI5A 2W7AA 1VQOS 3MM9A 2V63A 3IFEA 4NXNJ 4JI2F 2DITA 1IBKF 2ZD1A 3ZNUA 5BYSA 2HBRB 3CIMA 3OL9A 1LW2B 4JYAJ 4UF4A 4RW4B 2WVEA 4E0DA 3NY0A 2F4VJ 1KTQA 1ZM2A 1RISA 1FX4A 3N28A 4L76A 4BWJA 2I6WA 4F4YA 3MAQA 3BV8A 4WBFA 3BEGB 2E1PA 3ZTSA 3GV7B 4ER8A 1VQ5S 1IUJA 3AT1B 3RR8A 1B99A 3LOUA 4NXMF 1PG5B 2BJ1A 1RK8A 1VHFA 3DM2A 4ECZA 3OVAA 1S1XB 1BWVA 1RWUA 2BJ7A 3KG4A 3KUGA 4PXEA 3TNVA 2HLUA 3W1YC 4K4ZA 1ZTTA 4K4WA 4LIWA 1IR2A 3RB3A 3SDEB 3NGDA 4J9UE 4DV0J 1XMBA 2M8DB 3M9NB 4ED4A 1TAUA 3ZZTA 1TKZA 4LREA 4DDFA 5L1KA 1H0HB 3MEEB 1OY9A 2E9RX 3PXGa 3AB4B 3AD9C 5EWGA 4A8QA 1H72C 2L48A 3JQKA 2OPQB 5SUHA 5AXLA 4X66F 3V6HA 2P9EA 1AZSB 3UWTA 3KJQB 4P2XA 2VC1A 4FVMA 4OZLA 4MTPA 3CVKA 1J5OA 2XZDB 3UI3A 3BGUA 3OL8A 2ZE2A 1JXVA 2W8KA 1YJWS 4LFCJ 1C0UB 2IC3A 2LXUA 3BDPA 1UWAA 3CUNA 2YQ0A 3SBMA 1VBXA 1L5UA 1TAQA 2KYXA 3OW2R 1TUVA 3CCVS 4ZCKA 3IG1A 4HHHA 4NOHA 2EI5A 5C2GA 5KFHA 3M4XA 3PR4A 2IC3B 4PUOA 1YJTA 1VLYA 1HQEB 3NKYA 4PABA 2CZ4A 1FXDA 2ZM6J 1RT1A 4P71A 4Q5VA 4HYKA 4FXWA 1U1MA 3L7UA 5C2CA 5I3UA 3A8KA 4I2QA 2Q66A 3P4UB 1RP5A 3AD7C 2DNQA 3D6FB 3I0SB 5FDLA 3SIPB 4DOZA 2A2CA 4OIXA 4X62F 2W4DA 1ZAWA 5C5JA 2AJ4A 3LUYA 4IO1A 2H3EB 4I6AA 3SDEA 2W2PP 2WONB 3GCXP 2CJQA 2M4MA 3B8HA 4J37A 4KHMA 2ZZNA 4RL1A 3KLEA 4M5DA 3T6JA 4IFVB 5CHCB 2XLIA 1LKZA 4OQJA 5LL6d 2M2BA 1RT4A 4NCGA 3GYNA 3I31A 5D4NA 4QIGA 1Q5VA 3X1LB 3D5MA 1CJKA 1Q8LA 1H98A 1TR0A 2FC9A 3FSYA 3I6PA 4DR2F 3M8WA 2C3YA 3CCES 2KH9A 3TOQA 1V3SA 3KNAA 1LFPA 1VCTA 1RXOB 2DCLA 4DPXA 4G1QB 2RHQB 4LRDA 2LLZA 1NZ8A 1JJHA 4N8NA 2XCPA 3BBBA 4RNMA 1YJ9S 1EKSA 1JIHA 2CYYA 5IV3A 2CQ2A 2FY8A 1J5EJ 1QDUB 1IXKA 1V3RA 2VL1A 1WF2A 1TL3A 4O0IA 1SH3A 1E6YB 4FF3A 3W5YA 1HFEL 1OSCA 1FD2A 5HLFB 4I56A 4WXOA 3RGIA 4OX9J 4OHYA 2HS4A 1TU0B 2VHGA 1WC5A 4L72B 1UAWA 3D1OA 4PQAA 2XGQA 1WC1A 5KFPA 4A4JA 2C3PA 2XMMA 5EDWA 2ZVIA 3SZ2A 4AT1B 2KFZA 3IS9B 2G9OA 4EBDA 1KN6A 5KFWA 3NOGA 1B4SA 1FE4A 5I42B 3M2VB 4D3HA 2CZ9A 4J90A 2WZ1A 5K14B 3PX4A 4FYVB 4ECTA 1XN9A 2EKYA 3AJ1A 2Z58B 1ZOTA 4LRCA 2G2YA 5LXYA 2V4JB 1RADB 2RAQA 1DTTA 3W2VA 5BYQA 5DG9A 5D0GA 3H4BA 5E7OB 4B9VA 2OPPA 1HW9A 1PKUA 1RACB 1RTHA 2NYIA 3PHEA 4B17A 4WFAQ 1F0XA 4LF6J 2P5VA 3OUYA 2V4JA 1M5HA 3W2VB 2QEXS 4DL5A 1S0NA 2G1HA 1S10A 4BDPA 4LMZA 4U8YA 1VR6A 3HSDA 2P8IA 4C8NA 2K06A 3MEGB 1HWJA 5GAHU 5IOLA 3MCSA 5F3TA 3H25A 1HBOA 2E5HA 4WFYA 3SFUA 1VQNS 3JSRA 3OLBA 1NDKA 2D69A 1JJ4A 2HFUA 3EZ5A 2IM1A 2RRAA 4HTIA 4OV6A 2I8EA 4PEOA 1T11A 2OFGX 2AD9A 1UJ6A 3DDKA 3UDCA 5F0WA 3MUVP 3KLEB 4M5DB 5IZHA 5K14A 1RBAA 1CJUB 5AJ3F 2D3OR 1HR0F 2B4PA 2W9AA 4DV2J 3UNGC 1VI7A 2BKPA 3BPDA 3OLAA 3PX0A 1IQTA 3UR0A 4OI6A 1RI7A 5K8OA 3VQSA 2UP1A 2GO9A 2VJVA 4LSNA 4GO5X 2H4WB 3ET6A 1QD1A 3R5JB 1U6FA 1CLFA 1SUQA 1DBDA 4DS5A 1NK9A 1NB7A 4DU7A 2W7OA 3QBCA 3TZYA 4ICLB 3MFHA 2CQDA 1U6BA 2RF2A 4ZP8A 2XSJB 2CWKA 1T9YA 5LSLA 1R0AB 3MGJA 5LSRA 1RYRA 5C25A 1LWXA 3DNCA 3FGVA 3KLIA 4ZKAA 4ZS6A 4DV6J 3MMCA 1UPPA 2KRBA 4I69A 1RDRA 3IN5A 2W9CA 5IFMA 4EO8A 5IT9U 2OMLA 4O44B 2DY9A 4M94A 1HHSA 4ZPWR 1X4HA 2BRKA 1FCAA 1Q81T 4ZCIA 5JJBA 1UW9A 4X65F 2RU3A 3EUNA 3MR5A 2GMJA 4AL5A 1U6ZA 1LK5A 3T5KA 1K73T 2LEAA 3C14A 2LQ5A 2RS2A 1PAEX 2GO8A 1QY7A 2C2ZB 1PBAA 1AB8A 3PJWA 4FZVA 1FNXH 4A8FA 3EGZA 2C28A 1EARA 2VOPA 4M63A 4F02A 5KG4A 4Z7CA 3KHHA 2JLEA 3EZOA 1O51A 1Y5LB 1YLXA 2XYPB 2ATCB 2J6UA 2EFPA 2FGOA 3ICLA 3KKFA 1TFWA 5L9NA 2V69A 4TLQA 4Q7AA 2EW9A 4KGKA 3HLUA 1FKOB 1ICEB 3M05A 2BACA 1REVB 1B70B 1I51B 4YHHF 4O4GA 3M8YA 1XTZA 3N6NA 1SL1A 1WOSA 4XPCA 3JQMA 3FNNA 2ZOFA 3MI7X 1FXLA 1S9EA 1FXRA 3HD1A 2W7PA 3BQ2A 3BBCA 4B9NA 3C15B 3MM7B 2QIFA 3WX4A 4EMDA 1U1RA 4JI6F 1UVNA 1RCOB 4ECSA 1QTNB 3FZBA 2DXDA 5J2NA 1IKXB 4C8ZA 4BBYA 1X5SA 2HNZA 4KGXB 2UXCJ 2DNZA 2ROGA 3CJSA 5EHHA 4ILMA 3TARA 4RUHA 3HT3A 3IM8A 4ALZA 3TAPA 3TZWA 3W66A 1NDLA 4CI0B 3CD0A 4V19J 2UUBJ 2J9DE 2DGQA 2EK1A 2KJWA 3HHDA 1UVLA 4JI4J 1HPZB 1H2TZ 2A1BA 2W2NP 3Q8UA 1RHKB 1T02A 1U8WA 3FQKA 4ANEA 3LAMA 4DR7J 5B0GA 3LPYA 1CJVB 3PEJA 3TJ9A 3NG8A 3W62A 2BRLA 4Q43A 3W61A 2N3OA 2YKMA 1JKHA 3KDNA 1OYDA 3D7SB 2IA0A 3MPVA 3NS6A 3ZZRA 2V6AA 5IWAF 1WOOA 2HS3A 3OTEA 2HVEA 2GX8A 2M0GB 3VGSA 1RSCA 1FI4A 2B4VA 4P2MA 1N34F 1J5EF 4MFBA 4ZVHA 2L9NA 3C15A 4RW7A 1R0CB 4KFBA 3MM7A 1TMJA 2QLJB 1C2PA 2NSCA 3FEXB 4PPZA 2XMJA 3KWMA 2JFDA 4PR6A 4KR0B 3C6UA 4TXSA 4WF9Q 3QT5A 2ZBRA 4NZ7A 4C8OA 2MKJA 2YXLA 1X60A 2RT3A 5F8MA 2HAFA 4P7VA 1WHVA 4ZVEA 4EYHB 1XMOJ 4B9TA 3DI6B 4DR3J 1B7YB 3MDFA 2QTWA 2ZITA 4E98A 1RWPB 3MEKA 5DDQC 5I3QA 1S72S 2W9BA 1S0OA 1KS2A 3KLFB 1T9UA 3PJ9A 2CQIA 2RE1A 2GV1A 3CD7A 3G8QA 4UUWA 3PIPQ 2YY3A 5GADI 2DEIA 1KLMA 2OI2A 3K8WA 2Q6CA 4ES1A 3BSNA 3P49B 4ID8A 2HRUA 2J9CA 5KFTA 4L6V3 2BQ3A 5H9FK 3DLGA 1YWXA 1HWKA 3QGHA 4U96A 1KQGB 5B08A 4N47A 2Q1LA 2FJEB 5ETQA 2F9DA 2LA4A 3DFEA 4TNOA 4DXLA 3TZXA 2X3GA 2HHXA 2AX1A 2YKQA 2MGZA 2F8HA 4P6QA 2YWFA 1Q78A 1VYAA 2DNNA 1JLAA 1EJ7L 2RRBA 3GFHA 3TO8A 5L46A 1X7VA 5E3PA 1VIXA 4LQ3A 2MZSA 3ENWA 1K44A 2ASYA 1IVZA 2P9CA 1A0OB 2DTJA 2FHKA 3UDLA 3FEYB 4WP3A 2MKHA 9ATCB 5KFNA 1W2BR 3PCOB 8ATCB 5DS7A 4K50A 1F2HA 2R3VA 1VQSA 3GG0A 1VFJA 4PZVA 1X9MA 3CULA 2JHEA 1TL5A 4KO0A 3QO9B 4LF7F 3UR3C 4FN5A 2LQBA 4LSNB 4CLSA 4O3SA 2DH8A 4A8OA 2V4QA 2PMWA 2MZTA 4GMKA 4IG3A 4OZ0A 2F5GA 1FHTA 3BQ0A 5DDPC 3H42A 4YR2A 3D6MB 2P6TA 1XR7A 1IN0A 1KP6A 4LQ9A 1ZYQA 4KSEB 1DLOB 4CQ1A 3BQ1A 2J5AA 3O5TB 3M8QB 2Z4PA 3HHEA 1XIQA 5J1NA 4QPXA 3CC4S 1GMWD 3BREA 1FWPA 3M2RB 1VQKS 2QO3A 2IA6A 4LSLA 1FF2A 1VJQA 4ZVUB 3S1TA 2B6AA 1R89A 2IM3A 1CJUA 2MJNA 3LWMA 3U27A 3M2RA 2I5JA 1B0VA 2FUG9 2FDNA 2F40A 1U8SA 5KG2A 3RW7A 4URQU 2IDLA 2Q43A 1ZPWX 3EVMA 1QE1A 1Q8IA 1RWNB 2GIQA 3GWCA 4HTJA 4WU2A 3S01A 5KFZA 3HDSA 1WUUA 2ZM6F 2QLFB 3KJFB 2GGPA 1L3KA 3KMSA 3LP2B 2J6SA 2WBRA 1WDTA 2HWTA 3QO9A 4Q2MA 3MEDA 1TFYA 3J7Z5 3ZZUA 3BSCA 2ZUAA 3IBWA 3EPIA 2DHSA 3LP0A 2LFVA 4A8MP 2HG4A 2K1RA 3DHWC 3PKYA 4EBEA 1XNQJ 1RTHB 1HBUB 4NI2B 5I42A 3OJUA 4OHZA 1O5JA 1VS3A 3C6UB 2B43A 5G0RA 4A8YA 1FRKA 4TYBA 1FEHA 2QLXA 3G87A 1R7IA 4S0MA 4OI3A 2Y0SD 4QOTA 2BANB 1U2FA 2IM2A 2O01C 4ZVPB 3VZIA 3GIJA 4R8UB 1MN7A 3O3LA 4LFAJ 2QA4S 4LF4F 4USUA 3DCAA 1N33F 1J27A 1T03A 1Q4RA 4OX9F 3SFGA 3D3BJ 2HHSA 2QV6A 5H9EJ 3GYXB 1X4BA 3ZFVA 1HNWJ 2AKWB 1IKVB 2CDQA 2JJ4D 3AJDA 2X1GA 1OIAA 2OSRA 1K1QA 2QGFB 3D0IE 3PYFA 1U1LA 4C2MA 3D67A 5GMKa 2LQ9A 4KIAA 3V4IA 3PR5B 4G1QA 2ASJA 4IRKA 1BUXA 1HBMB 1GTHA 3CNQP 4PWUA 4C0OC 1NK8A 1X4CA 3VV2B 2HHPA 2XYGB 3D0GE 2GMLA 2RD5C 1NJIT 3TAMB 4TY8A 3KLHB 2FC8A 3U1LA 3B4DA 4RLEA 3R8YA 1U1QA 4JYAF 3L7OA 4JV2A 4X4NA 4AL7A 3DRPB 3SQGB 2BKNA 2KFNA 1G3OA 4DSEA 4PG8A 3UDVA 2JEFA 3W3SA 4OZ5A 2RH3A 2FLLA 2DNPA 1CJKB 3ISZA 4L75A 1VOMA 2CJYB 1S5ZA 2R8GA 3CXCR 4U8VA 4NZ6A 5GAGI 4TQSA 2HMIA 4WZMA 1OQ6A 4R5PA 5A8KA 3I4PA 4PG5A 1ZTWA 4YP3A 2MKKA 1WG1A 1NXIA 2Q3PA 2ABYA 5LXRA 2RVJA 2SXLA 4ZN1A 3VTIA 3V2UC 2E66A 1HLWA 3C6TB 1JKHB 3WHIA 1NJXA 1N36J 1Z2LA 3N6MA 2G0JA 4ZJQA 1OYEA 1V5VA 4XAKA 5J2QA 3PKMA 3H4DA 5LJ5Y 4DJBA 3D1QA 3W5XA 4FF2A 1RBLA 2M8HA 4ZP9A 2ATLA 5THWA 5KFEA 5KOXA 2Z2ZA 1VQYA 3A1YG 3ZZZA 3WQPA 3UD3P 3HP6A 3RB4A 3J7A1 1X4EA 2B4OA 1R6VA 5DG7A 2J76E 5CABA 4KY3A 3J80Y 4B3MF 5DLFA 2C2NA 4MYTA 4OYPA 1N5YA 4IFYA 2AQ4A 4A8KA 3D3CJ 5DGAA 2YWHA 3ZXWA 3LGHA 3OQ2A 2LKZA 4QYZJ 4ZPDA 1HD0A 2XCAA 4JI0J 2AJ2A 2UV8G 1KSPA 1HARA 1R43A 5J2QB 3GZ7A 4DF8A 4IR9A 5A8KB 2VOOA 1TZ0A 2W8LA 1D9AA 1OPZA 2EBEA 3AODA 2H4YB 5CAAA 2HBYB 5K20B 1YG0A 2V50A 2GW8A 3MMBB 4DSFA 1RLCL 3MEEA 4DUTA 4X2BA 2ZH1A 2FVCA 2F7VA 1K47A 2XHCA 5J2MA 1S99A 1TKZB 2MKCA 3G6YA 5CYQB 3A4TA 1LNQA 3MMBA 3R7BB 3BJYA 5ETNA 1U1OA 2UVUA 4F25A 4AFFA 3BO2A 3SSRA 3SI8A 1BE4A 2DVIA 3DRRB 4CLPA 2DHXA 3C14B 4DQSA 3RBEA 3RTVA 3PW0A 3GPAA 3HHKA 1NK4A 4DX8H 1SH0A 2WOMA 2BABA 5FLXY 1NO8A 2XSJA 3DMJB 4X65J 1VDHA 4F8RA 3TZZA 4JI6J 4WP9A 1T7PA 5M2PA 1OS5A 4TY9A 2GMHA 2LU2A 4YFUA 4FYDA 2A3JA 3MHYA 1YRXA 1OPIA 2F63A 4XDDA 5IC6B 2OHDA 4TLRA 1H73A 2KXFA 4OYMA 3K7RA 1TVRB 4FYYB 1HBNB 4KGMA 3GQCA 2W2QP 3CCWA 2OIHA 3PDNA 3RUBL 1NCLA 2ZHBA 3OTCA 4K5SA 3FQLA 2VQEF 3IR5B 2ZOGA 3CD5A 3KMQA 2FVSA 2YQ1A 1WSVA 1VRQC 3SSSA 2VG5B 2QT7A 2ZJRQ 4C3MA 2ZZMA 3MWBA 2ACMA 4FXVA 2WVFA 2J0QD 3HHNB 1YSJA 3PVXA 3MOJB 1Y9OA 4CLUA 2MKSA 2R42A 2KG0A 4HDGA 2VU5A 2J7KA 2UVWA 2P9GA 1WHXA 1LXJA 2KRRA 4KH0B 4B3OB 5K8PA 3KG0A 3LP0B 4QZVB 4DL4A 3AD8C 3O2IA 2PFDA 3ETOA 5F9LA 5HP1B 3GIIA 3HVRA 1MWQA 1BWEA 3MTKA 5DG8A 3G71S 3DOLB 3AXMA 1HA1A 4P2SA 4PG6A 1IWGA 3BZQA 4RW8B 2VJUA 4KPYA 4ES2A 1Z1ZA 4WIIA 4CLTA 4C11A 2ZH3A 2MQNA 1CQNA 1VQ4S 1QSLA 3NEKA 4XIUA 2A2DA 1OWXA 4P9SA 4CM2A 2KVIA 4F4WA 3VAIA 3HSZA 1UZDA 3K5MA 5EUHA 4JUZA 4P7TA 2WONA 4F2SA 1MMNA 5HLFA 3PRVA 5ETTA 3TW0A 3IS9A 4QIVA 2HZAA 2IHR1 4KHRA 2R9LA 2BE2B 5CZXA 5G4DA 4QWDA 3EGWB 5M2RA 3M8QA 1T03B 2VKRA 2J0WA 4NA3A 4J9RA 4DR6F 4ZPBA 2GVZB 4DR1F 2FHJA 1FO1A 4X4OA 1PILA 4NWBA 4OYIA 3T9ZA 2XS5A 3JSMA 5T41A 1UZHA 1A6LA 3RG6A 1RAJA 2HURA 2K3IA 1YHQS 1UWBB 1PAUB 3HZEA 1S0VA 2VQFJ 3CCRS 2IBKA 2RUSA 3FUYA 3K89A 4P52A 4USJC 3DRSB 4I2PA 2WOMB 4ANDA 1VQ6S 3U02A 3FK4A 3RB0A 1E6VA 2Z8QA 2ZHOA 1NU4A 2ZC3A 2GGPB 3E8OA 1U4BA 4O4RA 4N5SA 4DF4A 5T7LA 1DQ9A 1C1BB 3R7NB 4KGZB 3QRPA 2I9SA 1VRTA 2AJ1A 4OZJA 7FDRA 2ZJQQ 1SJFA 1HL6A 1PYOB 4ZJOA 3CCJS 2VODA 5FD1A 1R8BA 4ZDNA 1XK8A 1WF1A 3QT6A 1QAXA 3W5ZA 4AUKA 4F4AA 4YS2A 2PDAA 5D4OA 2XHWA 4NRUA 5KFIA 2DPJA 4LF9J 4ZVFA 2AZ3A 3BKFA 2VFVA 3V5RA 1S59A 5H1SV 5B0EA 3DKDA 4DEZA 1X4DA 4HKQA 1RQ0A 2VPYB 3E01B 2FD2A 3JAMU 1JLCB 1NLKL 3QAEA 5KFVA 4DFPA 2ZWOA 1RGVA 1ZA2B 1SL0A 4LF7J 5F8LA 3G9CA 3CW2C 1MU2B 3W63A 2XO7A 2A6OA 4ELUA 3OFHA 4RNNA 4I2QB 3Q8RB 4K4YA 4WP8A 1T0TV 5ETVA 1YQHA 1SV5A 1FERA 5KG0A 4CTAA 3HJVA 4J7CA 1HNVA 2GQCA 2D3UA 2CG4A 4USWA 3K5LA 1R8AA 2QA4G 2HVHA 3SSQA 3R9LA 2MZRA 2MZ1A 4YQWA 4IQMA 2YNGB 2QC3A 4R0JA 2WVCA 2W01A 5HROA 2FYXA 4I6YA 2ERRA 2GAGC 5KFJA 3G6XA 3CJQA 5DJBA 1U0SA 5CD4A 4DQPA 4F0KA 1JXLA 4DN0A 2G2ZA 1XEZA 3QWUA 3TUIC 2D3O1 2NR0A 4EFAC 4JI4F 3FRYA 4DSJA 1V9OA 3FBBA 3MAAB 4HT5A 3SV3A 2IYIA 4RKUC 1RT6B 2HNDA 1CG2A 2AJFE 2CQ1A 4IOAQ 2UXBF 2ROEA 1SV5B 1IR0A 1Z2ZA 2IY5B 5KAKA 3DLEB 3LW5C 3CC7S 1HI8A 4RW9B 4R5PB 3I0RB 4DV4J 2GJIA 2XMKA 3RJMB 4FVCA 3V81B 5GAEI 5B0CA 3PV8A 4J9OA 2E44A 1FKPB 2EVZA 2O66A 4RW6B 4X4VA 3G96A 1FKOA 3IGNA 2QLBB 3BPSP 5D0EA 1VQLS 2VZ9A 2DKOB 3DYAA 1RHRB 3QWPA 1RT3A 3CB4A 2DR9A 2HPUA 4QCLA 1RT7A 1BQNA 2LU1A 4IYQA 3QLHA 1NUEA 2J8SA 5HQMA 4V1Ak 4DFMA 1T05A 2GHVC 3A3PB 4K5RA 3NMRA 1RE1B 4QWEA 3HHLB 3HXMA 1CC8A 3IP0A 2HHHF 1OO0B 1PBUA 4LIRA 1HNXJ 2KVQE 1RWVB 3SXLA 4IDKB 2DIVA 4RW9A 4FS2A 1RWMB 5E3CA 2V68A 4F67A 4J9MA 4M8LA 2LXIA 1E6VB 4X66J 1NEEA 2C42A 3VCDA 3KYLA 3QAUA 2HNDB 2U1AA 3CCSS 4DG1A 4ZCLA 2WAQD 3IBFB 3DLJA 1IBCB 1WSRA 1N4LA 3P5TL 4QJVA 2QYGA 2YKNA 3R97A 1RA7A 2CDRB 2YKAA 5HJYA 3DRYA 1TV6A 1WEYA 2NPIA 4O3QA 1NRKA 4NASA 4LRAA 1P27B 4A8XA 1H38A 5DRKA 4V19X 3HK2A 2EFQA 3MAHA 2QRRA 5HAOA 2YNIA 2HWHA 2NLWA 2CQPA 3RU0A 2GIRA 2XNRA 3C8YA 1CPZA 1NNDA 1FNMA 4OX8A 1V6HA 5A8WA 4I7FB 3L9ZA 3MEDB 2DNOA 2IPOB 1JQGA 4DV1F 3EXCX 3QIPB 1KLNA 2GAHC 2GIFA 2BE2A 2MTLA 2XULA 2LP4A 4OI2A 5HN0A 2R7RA 3DGPB 4JOUA 4UOFA 5KFAA 5K8MA 1RT2B 4OZ3A 2VDHA 3ETMA 3TP2A 5HVGA 4CT8A 3KHGA 3K2YA 1WD6A 3FC9A 1NB2A 2KDOA 4H4OB 4G65A 4EK2A 4X4UA 1PYSB 1VC6A 1UFKA 3H5SA 2UU9J 1VLOA 2CQGA 4ED6A 1T9XA 4JI5J 1AYEA 5IQ6A 1C1BA 3T1YF 2XS7A 4BS2A 1KNZA 1G1XA 2CKWA 3PEHA 3FFIA 1FWKA 2XMTA 2MXYA 1IBLF 5A6PA 3SV4A 1FWLA 2OPSB 2AGQA 1N34J 2V8GA 3RBZA 3TJ8A 4NMXA 4CM0A 4G6VB 4M1KA 2VG7B 1R0AA 4N7TA 1PIEA 1IBMJ 2WSCC 4KGVB 5U47A 4ECWA 3EJMA 2RU9A 1GX6A 4G1IA 1KFDA 2Y3YA 4M5HA 3JSMB 3H8YA 2I2YA 2J6TA 2AJQA 3K57A 4IUFA 4XK8C 1RT5A 1RTDB 2EFGA 1HKAA 2IDEA 3K17A 1UVMA 1JJCB 1H6KX 3ITHB 4RWXA 3HFKA 1D09B 1YX2A 4IG0A 1UA1A 1M90T 3QJJA 2IJRA 3GSIA 3DXSX 2D41A 1JLGB 2WW8A 2QMXA 4LVNP 1AUSL 2GA7A 4CO5A 3T9NA 3ITHA 3H5YA 1P6TA 4KAIA 4HVZA 2DR5A 1YK9A 4OYAA 1C4AA 3PG9A 5HMWA 2G1DA 2V34A 2ZH8A 3Q24A 2DYAA 3H20A 2DGXA 3IA0A 3DOMB 4RNHA 1YJUA 3DLGB 2G13A 2VFRA 4DX5A 3OXLA 1VGYA 3J80U 2RQ4A 4LSZB 4DUZF 4P72A 2MYFA 1D9FA 2GQQA 5DETA 1QJHA 1Y5IB 2BV3A 4ZHRA 3DN9A 3EXYA 3I82A 3NAHA 2YPYA 4HH0A 3T6BA 3AA8A 4PAAA 3GU0A 4NPOA 3I55S 3PHTA 4F4XA 1Y5NB 2HFNA 3B4MA 4ZA1A 4CLWA 1ZM4A 2E9ZA 3T19A 2K2PA 3QGPA 4W92B 3DLKA 3UO0A 2HHQA 2M70A 1JWWA 1JLGA 4PKDB 3GB0A 1VQMS 1T9VA 1F6TA 3W9IA 4C0BA 2X7IA 3FMWA 5ETOA 4ZJLA 1XERA 1F9EB 1N5SA 1N6QA 3GONA 5AJ3J 4JI3F 1SKUB 4QW9A 2QL5B 5EN1A 1UEUA 1T8EA 3HHLD 1WEZA 2ZKTA 5D78A 4RNFA 3VAJA 2ZBCA 2LA6A 1UTAA 1WEXA 1HQEA 3LA0A 3HFZB 2ZDOA 4NRTA 4LFBF 2RQCA 3VAFA 4I7FA 1N5VA 3KDOA 3D6TB 2OTLS 2HNYB 3QGIA 1MN9A 4URSA 4EI2A 3OV7A 5CXTA 3DLLQ 2KHCA 4PXCA 1LWEA 1KQSR 4EYIB 3I5BA 3ILJA 1KTVA 1HWUA 3NP5A 4DLEA 2BM0A 3IRXB 3VAHA 4BCAA 3UCZP 4ZPCA 3OTOJ 2XGPA 4ZLNA 3FFIB 3MFIA 1HI0P 4DFJA 1LWEB 4UOCA 2MLYA 1WELA 2IYGA 3CCTA 2F3JA 1NJYA 4RU2A 5ETLA 3OTOF 1FT8A 2V67A 2KXNB 5GMEA 3JYTA 1S1WB 2F65A 2DK2A 1S57A 5E3AA 3R1HA 2FLPA 5KFBA 4RU9A 2K3KA 5A8RB 3TANA 2HZVA 4KTQA 1YJVA 3EM1A 3TEGA 1WG4A 2M5YA 4B9UA 2NXEA 2EG1A 2JOQA 5E33A 1I1GA 4FYWB 5D4PA 3UDEA 2HRYA 4HEA9 1W2IA 3GMGA 3R27A 2XLJA 4DHVA 4JV5F 2GHPA 2HHWA 1IKWA 1EP4A 4F36A 1ELOA 1Y7PA 2MZJA 2H65B 1TQLA 3M8SA 5DM7Q 1TTHB 3FRZA 4ID5B 1OMSA 2RB7A 1XR5A 1WHYA 2CQ3A 2OAUA 4OYZA 1SKSA 1M1KT 3TVKA 4DV3J 1UEKA 2XMUA 5F8NA 2RQMA 4PXDA 2QG9B 3HHLC 1PSDA 2FLOA 2UV8A 1S1XA 2MY8A 4L73A 1HMVB 1DURA 4NLYA 4Y65A 3JYTB 3KK3B 4IH7A 5K9FA 4C3KA 3I0RA 3NS5A 5MAOA 4I64A 1ZA1B 4U6PA 2WTFA 1MG7A 1BQXA 2V8VA 4CP5A 5LOQA 2R8JA 1AFIA 1FTCA 2V4RA 2KB2A 3HMJG 4O44A 4C98A 2CQCA 4ZPVR 3FCWA 2B5JA 1IKYB 2YKMB 2B3TB 1FRXA 4H4KA 3JAMY 5DQHA 4U7UD 1J5OB 2BW2A 3KLIB 2ZD1B 5SZTA 3Q2SC 3TA0A 1O6XA 2FHOB 4CIOA 2HZCA 4ED0A 4OV1A 5IS2A 4DV5F 2Z2MA 1U26A 5I3PA 1VQ8S 3GYGA 1IKVA 2G0CA 4ED5A 5IWAJ 3HD2A 1SC3B 2NCKL 4O3OA 5AE1A 4NL5A 3CPWR 2PA8D 1P8GA 2IRYA 5L39A 3R2CJ 1S49A 5HMXA 2MQQA 2XY7A 1M0SA 4C97A 1EZZB 3AA9A 3MZIA 1FTRA 2EXUA 2FHJD 1S1UB 4UT4A 2F4VF 1Y10A 2YX1A 3DRPA 4QPTA 3VGVA 4CYUA 1APSA 1RT3B 2XLKA 1NSKL 3GJSB 4FPIA 4F3QA 4MH8A 3MUTP 4M5MA 3W60A 4CTAB 3IC1A 5KT2A 5DZ6A 2VG7A 2J8AA 5RUBA 2XMAA 1SJRA 3F73A 3CDUA 3QSYB 3LP1B 2KYZA 4G1PA 3EVOA 4ZVTB 3K58A 1L3TA 2PT0A 3F44A 3NWGA 4P2FA 1QE1B 2V94A 1N48A 3DU5A 2Y1IA 2KT2A 4KV8B 4DLGA 1FVSA 4LF2A 4DL0C 3TJAA 3POTB 3MTJA 4K4TA 3J81j 3H40A 2PGCA 1WG5A 1KHVA 1X4AA 3N4WA 4J9NA 3NS7B 4IG0B 4H4MB 3QRRA 4W4MA 4A8WA 1OQ3A 4I6WA 2ZH4A 3DC2A 4UZBA 5LMNF 2JNJA 3OXGA 4B9SA 2E5GA 4R8UA 4DR4J 1YDLA 2CA9A 4QWCA 5AXKA 4ZOSA 3M9MB 4EBCA 4TKTA 2FY1A 5IT9Y 2CIMA 4K59A 2ZC4A 2YWGA 3HSJA 6FDRA 4EUVA 2HK2A 3OSPA 4HI2A 1ZS6A 1F2GA 2FVQA 1WACA 5D3GA 2DH9A 6FD1A 3GJRB 3QMQA 3IWLA 4MIAA 4DR2J 1R3NA 1AUDA 5HI7A 2XSFA 3R5CA 4NYPA 4XTTA 3ENQA 4QQBA 1AA1B 1TL7A 3H59A 1B7FA 2OD6A 5HANA 1CSJA 1W26A 1YBTA 1D8YA 4RR5A 1WI6A 3H98A 1SL2A 2HAIA 3GCWP 3MPDA 2H1YA 3SCJE 2EG2A 2KHDA 2G2OA 2BJ9A 4AQYF 1JX4A 3FZ2A 3LO3A 2CJKA 2BYCA 1SIWB 2HK3A 2L08A 4LFBJ 2UUCF 4OYWA 2XYHB 3N79A 5KFFA 4AQYJ 5ETPA 1JLBA 4C11B 3KLVA 3C19A 2QJ3A 5HK4A 1DJ0A 1JK9B 3K5OA 5DM6Q 5A76A 4DMZA 1N5TA 4KJIA 1F3VA 3FMBA 2ZBQA 3DGVA 3O8WA 3O6QA 2HQFA 1RB0A 3AXKA 3VHQA 2V8HA 4CO1A 4CWBA 3HT0A 4CZCA 3BO4A 1NHUA 2CXEA 3KUEA 3W7BA 4EGLA 1O0PA 1CEZA 4C48A 5LJ3Y 1NZAA 4ECRA 1TK5A 3PFEA 1L3VA 1B3TA 3HVAA 3MR2A 3RAQA 3KJVA 4CLFA 2E5LJ 2EFVA 3R5BA 2HVZA 4F26A 9RUBA 2QE5A 3PW2A 5IC4B 2ZBIA 2IVYA 4FP9A 1QTMA 4M95A 3MMAA 3QSIA 5D3GB 2HQIA 1IJEB 3MCMA 4YEAA 1U2CA 4MK9A 3X3UA 4EZ9A 4MKYA 3IWNC 4NLTA 2HQ3A 2D1CA 1Y0HA 5GMDA 4JV1A 3E3XA 1L3SA 1WKKA 2BX6A 2QA1A 4C0HA 1AT1B 1CJVA 3H2UB 2F8EX 1WC6A 4Z7YA 1HNZJ 1KVJA 4M5KA 5DZ7A 1TV6B 5DLGA 4ZN3A 5KT7A 4DUZJ 1D3WA 2GQ2A 3OL6A 3TWZA 1EHWA 2LQJA 4ILLA 3LANA 1H2UX 1MROB 3LF0A 4EZ6A 1BXNA 4YDXA 4ZLJA 1R0BG 2YNFB 1ZAXA 2OD4A 5HO4A 3Q8YA 5ETRA 3D6HB 2W25A 4DR7F 1Y11A 2DT9A 1URNA 1LWCA 2M7SA 4DV2F 3Q8SB 4H4MA 3T5HA 4UQGA 1TUWA 2UVVA 4DQIA 1FEEA 3QZ7A 3ILIA 3QLHB 1JLEA 3P5BP 1S1TB 4OX7A 2OPRB 2RS8A 1YZ7A 2ZNYA 3BGLA 2JEJA 1RTIA 4WXWA 3UW1A 2DNGA 4BC9A 2HNZB 3DOKB 1FJGJ 2DNLA 2NSBA 4RW6A 3US5A 1REVA 4FXDA 2W2MP 4B3TJ 4DWIA 2YX4A 3VZHA 4ID5A 2HQCA 4OHVA 2CPIA 1QVFR 5IV4A 2DO0A 1FRIA 2A0FB 1S9EB 1WC4A 1P1LA 5JUMA 2VQEJ 3R3TA 4F50A 1X4FA 5J1PA 1NJWA 1CJTA 2C3OA 4HHUA 2N3LA 4ZIVA 2BDPA 3PYDA 3VQTA 3HVTA 3OR2B 3LGNA 2VQFF 5A2QY 3U7JA 5DGBA 2HFZA 2AIRB 4QIEA 4X4RA 4DSLA 3W2WB 1OY8A 1GXUA 1JLEB 1S9GA 1EAYC 1S1UA 2FVRA 5AXNA 3HULA 2OELA 2HFVA 2WRMA 3ZZPA 1NKBA 2CUYA 1DRZA 1HBNA 4AD6A 1HQUB 1RABB 4ZCMA 2E7VA 4FKYA 2LQ8A 5HROB 2IM0A 4USKA 3CJ5A 1KONA 1SPBP 3JSYA 4Y2IA 3BSAA 3UCUP 1UEVA 1WJ9A 4YB6A 4JI1J 3JXOA 2CJXB 1RT1B 1S1WA 4CH1A 1FRHA 4N41A 2NZCA 4X4SA 4K4SA 1IKXA 1FKAF 4FBUA 3QJPA 1G2EA 3MCOA 3RRKA 4WTYA 2R7WA 3QNWB 4FPRA 2KXHA 2YVSA 3QGGA 1HQ2A 1VBZA 2KG1A 3EYZA 4IFYB 3AOCA 4WK3A 3ZZOA 2W9CB 4KE5A 4KC5A 4F3OA 2FQQB 1N5QA 5LMNJ 2AU0A 3MR6A 1L3UA 2VBWA 1Q79A 2WBMA 4MAKA 5KFSA 2ZHAA 1FDNA 1X0PA 2ROPA 1QAJA 3PM9A 3M1VA 1S7HA 1YJRA 2E7XA 1U49A 1HMVA 4QW8A 1KDNA 3EMTA 1M5VC 2Y9HA 4DR6J 1PGZA 4JI3J 5KG1A 2WW4A 3I9ZA 3NGRA 3MURP 1RKIA 2KI2A 2H54B 3GP9A 2FZGB 5A6WA 2JRSA 1VRTB 2M9KA 4J9PA 4QBUA 4B08A 5KG3A 4KRWA 1H7XA 3L3CA 2E9TA 2BOPA 3L7PA 1T94A 3MM8B 1O8BA 1SXLA 2XI2A 1LW0A 2F4FA 3FJ2A 3HI9A 2PMHA 5KFQA 2VF3A 1TL1B 3KXDA 5GVQA 3CJKB 1JLBB 4M5JA 2MZQA 2PD1A 4F2RA 2OPPB 5JXSA 4NLWA 3FDSA 2MEWA 3P96A 3MMCB 4TQRA 2MB0B 4CDIA 3PIOQ 4DX6A 3Q2TC 1N32F 4FBTA 2O5DA 1LQ9A 4NLVA 2V2QA 4KT0C 4ICLA 2IMWP 1S76D 5F3ZA 1KR4A 3EX7B 1PCAA 2BR0A 1UWBA 2FJVA 1KHWA 2RMLA 2YX7A 4FKXA 4HH1A 3TAQA 1N32J 2RNEA 3J7AN 3V4IB 3CWJA 3R5AA 1GMWA 1C0TB 1M5SA 2CJBA 3TUJC 1IQZA 1F1BB 1TKXB 1U2RA 2FTRA 3CJ0A 1FK9B 3MM6B 1NH7A 4HACA 5E41A 2UUWA 4YHHJ 4JV5J 1LV5A 3PW5A 4QR1A 4WE1B 2BZ2A 2XTJP
chains in the Genus database with same CATH topology
4GKJF 1UJ5A 3V6DA 4ED2A 4OHXA 3OFFA 2PSZA 1RJJA 1URRA 2L9WA 1MSWD 3KK1A 4RZRA 2B7BB 2IJFA 2CVEA 4UQTA 2MQMA 3F41A 3FSXA 3BN7A 2OPSA 2KZZA 2DNYA 2WSEC 2P6SA 4H4KC 4TU9A 3DLKB 3ISNC 1JMTA 2ZH2A 1HBOB 1NK7A 3OVBA 2JLFA 5F9NA 1Y3KA 3M6UA 2MSSA 4K4VA 1F5CA 2R2TA 4NCGB 2W4PA 3OFGA 3OTDA 3DRRA 4IKAA 4B3RF 4O23A 3IR6B 5B7WA 1RYSA 3WZ0A 2LEBA 1PO6A 1Y00A 3N5FA 3TX8A 4U67Q 5JVGQ 3BGRA 3M6WA 4OLPA 2XNQA 1RT4B 2DHAA 4NLGA 2KFYA 5E0OA 2ASDA 5DQGA 2HGLA 3NMAA 3UCGA 1HD1A 4IG3B 3E51A 4NX9A 2YNHA 2ASLA 3V6DB 1RKJA 2K7JA 2HLTA 1KEKA 1S0MA 1R8HA 1X5TA 4KO0B 4WFZA 2R2RA 3P3DA 2KT5A 2AP6A 3PFOA 2QA2A 2UZAA 1S6QB 2E1AA 1VK8A 4NLPA 2VONA 1TL3B 1C0UA 2V9KA 4CNZA 2KN4A 1X4GA 2X1AA 2V9WA 2PE8A 1V3ZA 3IG1B 2AYMA 2YQ3A 4DQQA 3C66A 2B9WA 2R4FA 1HQUA 1ZH5A 4WYWA 1LW0B 1XR6A 2FJWA 2KU7A 1R8PA 1SH2A 1ULRA 3CE8A 3I96A 4YR0A 5D4LA 3FCHA 2FGCA 4DG1B 2FVPA 1ZETA 3CGIA 1FD8A 3DGPA 3GSDA 2ZH9A 4DR4F 2XMVA 2GJ2A 4KHPF 3HVTB 1HYSB 1EP4B 1D0EA 1UL3A 3HF5A 4IFVA 3LP1A 3M1VB 1DZ5A 3HO1A 4MIBA 2LEPA 1OSDA 2E1CA 3BB5A 1A9NB 3ZC4A 1YJNS 3NBPB 4KKOB 2DRAA 4PWDB 5L8RC 1R6YA 2OPRA 5F8IA 3DI6A 2C2DA 2DBBA 1X5PA 1K0VA 2L3MA 3CJ3A 1KFSA 4A48A 4QR0A 3DU6A 3V81A 3IXQA 1QSSA 2VB6A 2ZFHA 2AV5A 2MJUA 2NXUA 4ZP7A 5CH7B 2L9DA 1S1TA 3F56A 4U7UK 3QPIA 3HX9A 5CYMA 3DLEA 4Q44A 3UD4P 2VBYA 5ITHA 4I68A 1WNEA 4NA2A 3FVYA 2QSFA 4F3MA 3TVYA 3CMES 1IBMF 2EK6A 1JLFB 3IRWP 2CFXA 3OR2A 2OSQA 3MF5A 2ILYA 4K4XA 1CQMA 1U1NA 1T05B 3MMAB 4J9SA 2CPZA 2V5HG 3M32B 3W2WA 1DHMA 4Y6IA 3KK3A 4NZ0A 2JVRA 1D1UA 2L41A 4N76A 2GHWA 3VWSA 1QUPA 1TL4A 2E5JA 3K59A 4DR5F 2H9ZA 1S9FA 3SQGA 1LW2A 1BY9A 2FJAB 4JI1F 3RYLA 4KFBB 4XDCA 1VJWA 1U09A 1GAOA 2CPHA 3AB2B 4ZPTR 5J2PA 4CT9A 1WWHA 2UVRA 5FJ4A 5J1EA 4ECXA 2HHUA 1M5OC 2ZDPA 4X4QA 3MM5B 2WHOA 1JLFA 1HI1A 2JDJA 5KFXA 3OVSA 4JBCA 3THTA 2YH1A 1TK0A 4RWWA 1UMJA 1UKUA 3OPKA 3L09A 2YNFA 1VC5A 3CDWA 2XMWA 2W24A 2LXFA 5F0UA 4C8LA 1HPZA 1M5PC 2MPUA 5HQ8A 3HJFA 2C22A 1FDDA 3BDE