1IKXB

K103n mutant hiv-1 reverse transcriptase in complex with the inhibitor pnu142721
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
427
structure length
427
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POL POLYPROTEIN
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 110
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikxB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxB03
1KLMB 5K14B 1HQEA 5F8HA 3LP2A 3QO9A 3KHGA 2JEFA 1RAJA 3D5MA 2BQ3A 1LWFA 1JLCA 3VQSA 4DL7A 4RNOA 2BRLA 1S1WB 4ZVHA 2D7SA 2J6SA 2ASLA 2UVUA 5I42B 3IN5A 3DM2A 4U6PA 4DL3A 2C2DA 1UWBB 2B5JB 5HP1A 4KKOA 2C2RA 1JIHA 3DI6A 2YKNA 2GIQA 3HVTB 1T05A 1BQMB 3KLFB 2XI2A 4LSLB 4ZP6A 3FSIA 4U7CA 4PUOA 4XPCA 3QIDA 1BQNB 1QE1A 1RT5B 1N4LA 1C0TA 1C1CA 5I3UB 1QAIA 1S49A 3NBPA 4R5PB 2VA3A 5J2QB 4Y3CA 4KO0B 2YNHB 1IKVB 4RW8B 5KFWA 3GIKA 2ATLA 3I0SA 4ED6A 1S1TB 4FBTA 4IRDA 3UR0A 1GX5A 4LSNA 1RTDA 4Q0BA 3CJ5A 4YQWA 3BSOA 1RTJA 1S6PB 4IRCA 2ZE2A 5C42B 4NLOA 2R2TA 2VG7A 4H4OB 1HNVB 1IKXA 5EWFA 4WXOA 3GQCA 3MFHA 3MF5A 5KFZA 4TQSA 3MEDA 2B6AB 2BQRA 1EP4B 1DLOB 1LW0B 3TQ1A 5KFEA 3KMQA 1HPZA 3GIJA 4YR2A 1FK9A 4G1QB 2GC8A 4ED0A 3PW0A 2VG6B 4RUAA 5CYQB 1RTIA 1D1UA 5FDLB 5J2PB 3Q8RB 1JLAA 3H59A 4DG1B 3DLEA 3DLGB 2IAJB 4ED7A 2IBKA 3TAMB 1RTHB 1S48A 4Q8FA 4K4UA 3V81B 3IRXB 1REVB 3UQSA 4IG0B 2WK4A 1TKXA 3OLBA 2ASJA 3RB0A 2W9CA 2ILZA 4ZPAA 3Q8SB 3CDUA 2RKIA 1JLFB 1C0UB 1RT2B 4PQUA 2V4QA 3T1AA 4YR3A 2IM0A 5DQHA 1J5OB 1RT7A 2I5JA 1QAJA 4NLQA 3G6VA 2WOMA 3BQ2A 5DQGA 1XR6A 2J6TA 4MIAA 2E9RX 1IKYA 1RT3B 2YNFA 5I42A 4IFYA 2FLLA 4WZMA 3CJ0A 1S9GA 2B5JA 3H2LA 4WYWA 4J9LA 1HNIA 3DMJB 5KG6A 3V6KA 3MECA 4MKBA 5DQIA 3H4BA 3H98A 3PW5A 4URGA 3QGIA 3OHBA 3QGHA 1HQEB 3LP2B 3QO9B 3OHAA 5CYMA 4Y34A 1LWFB 1JLCB 1C1BB 4F4YA 2YNHA 4LQ3A 5L1KA 5DGAA 3I5AA 2HNYA 1ZTWA 2AGOA 2EC0A 3DM2B 2AGQA 4MK9A 5HP1B 3C6TA 4KKOB 3OLAA 3DI6B 2YKNB 4H4OA 4YP3A 1HNVA 1T05B 2R8KA 2HAIA 5C25A 4PUOB 4TYAA 1QE1B 5KFSA 1C1CB 2IMWP 3NBPB 4EBEA 3QLHA 2AX0A 3IGNA 4NLUA 3PR4A 3N6MA 3I0SB 4K4VA 3H5UA 1VRTA 2FVPA 3QYYA 4FBUA 1RTDB 4Q0BB 4ZVEA 3PR5B 1WNEA 1RTJB 2WCXA 5KFIA 3DLKA 3G86A 5JUMA 2ZE2B 5KT6A 2WHOA 1C2PA 3EPIA 4ZPBA 2VG7B 3PW4A 3ISNC 1FKPA 4Y2CA 3MEEA 1IKWA 3PJXA 4R0EA 1IKXB 5KFBA 2HWIA 4MIBA 3MEDB 1LWEA 1N6QA 4Y2AA 4MKAA 1NNDA 1HPZB 2IM2A 3T5KA 1FK9B 4G3IA 2DPIA 3CJ2A 2J6UA 3Q8PB 1S97A 1NHVA 1RTIB 4RNHA 3DRSA 4TN2A 3G6YA 3GIMA 5DG9A 3T5HA 1JLAB 1HYSA 1EETA 3DLEB 4WFXA 3GILA 2HNZA 5KFFA 2OPPA 2IM1A 2XCAA 1CSJA 4ECRA 1HQUA 2QE5A 2JC1A 3HVAA 3H5SA 2FVCA 3UDLA 1TKXB 2W9AA 3G6XA 3QZ7A 4EO8A 2R8JA 2W9CB 3N6NA 3QGGA 2W7PA 4RW9A 2WRMA 3V4IA 2RKIB 4PQUB 4KSEB 4NRTA 5DLGA 3M9MB 1RT7B 2I5JB 4B3OA 1C1BA 2JEGA 2WOMB 3M9NB 1TL1A 1S1XA 1XR5A 2BR0A 3KK3A 3EPGA 1IKYB 1MU2A 2YNFB 4IFYB 1LWCA 5KFJA 1S9GB 2ZD1A 2I1RA 1HNIB 1QUVA 4RW4A 3MECB 3DOLA 5EWEA 2BQUA 4RW6A 1W25A 1RYSA 1LW2A 1RT1A 5CYMB 1DTQA 5KFGA 4ECSA 2RF2A 3KHHA 1TKTA 2HNYB 4KB7A 3ICLA 5KG0A 4O3QA 4TQRA 4K4XA 4ECQA 4EEYA 1JLGA 5DG7A 5KFLA 3C6TB 3UPFA 2R2SA 2OPRA 4JV2A 3E01A 1S1UA 1RA6A 4NZ0A 2W9BA 5C25B 4J9OA 2FLPA 5KFCA 3H4DA 2AWZA 4ECXA 3GYNA 3QLHB 4ICLA 4ECVA 1TV6A 4O4RA 3JSMA 1VRTB 4ECZA 4WE1A 4IR9A 4IH6A 4GC6A 4IOBA 2XWYA 2JC0A 3HKWA 4TY8A 4IRKA 3DLKB 5EDWA 3M8QA 4J9MA 4I2QA 1FKPB 3I0RA 1IKWB 3MEEB 3QIPA 4RNFA 5J1EA 4ED1A 1LWEB 2R8IA 2R8HA 1N6QB 1MMLA 3CDWA 2AGPA 2W8KA 5KG7A 2AQ4A 5KFQA 3NAHA 4QWBA 1R0AA 4DL6A 5KFNA 3NL0A 4K4TA 5KG5A 3MR2A 3KK1A 3T5JA 3DRSB 4NLVA 3GIIA 4RNMA 3OSPA 4K4YA 2R2RA 4O44A 4MK7A 2VG5A 1TL3A 3KJVA 1EETB 1HYSB 4IR1A 2HNZB 3PVXA 3LP1A 2OPPB 4I2PA 4DL2A 4RZRA 1HQUB 2UVRA 3M8PB 1S1VA 2RDJA 2V9WA 2R8GA 3JYTA 5J2MA 4RW9B 2RDIA 5KFVA 3V4IB 5C24A 4EBDA 5KFKA 1TKZA 4K4ZA 3BSCA 3OL7A 3BQ1A 1DTTA 3KHLA 4B3OB 4ED2A 2HMIA 5EWGA 3KLHA 1TL1B 1S1XB 1YVFA 3OL6A 2ASDA 1T3NA 3KK3B 1RT6A 4ZP8A 1MU2B 3KLGA 2R2UA 4X2BA 4TYBA 4IG3A 1LWCB 1KHWA 2ZD1B 3N6LA 4IQXA 1S0OA 4RW4B 2C22A 1SV5A 3DOLB 2JEIA 3KLIB 5L9XA 4GC7A 5DG8A 4RW6B 4M95A 3Q8QB 4ED3A 4KBIA 1LW2B 1RT1B 5F8IA 4KHMA 3DOKA 1DTQB 3FRZA 3OSNA 5KFUA 2D3UA 5D3GA 5KFPA 4DL5A 2RF2B 1TKTB 1TQLA 4EBCA 2JLEA 3CDEA 3PJWA 3GV7B 1JLGB 4ZP7A 1Z4UA 3MR3A 1SH3A 4URQU 2D41A 4QWDA 5J2NA 4J9QA 2XI3A 3DYAA 2OPRB 3HVWA 4EO6A 4NLYA 3E01B 1S1UB 1VRUA 2W9BB 2C2EA 1JXLA 5KFAA 2OPSA 3V6HA 3KLEA 4KHRA 5KFDA 4ICLB 4KV8B 2IJFA 1TV6B 4RW7A 2BRKA 3DRRA 3JSMB 2V0NA 2IM3A 3NGDA 1XR7A 4MH8A 4WE1B 3LALA 2FLNA 1JLQA 1TVRA 5KFMA 3BQ0A 4EYHB 4TY8B 1RT4A 5JXSA 1JLEA 4K4WA 3ITHA 1SUQA 1T03A 3M8QB 4WXWA 4Q45A 2BANA 3CJ4A 4I2QB 3I0RB 4ZMMA 3QIPB 5J1EB 3DRPA 4IKAA 3FFIA 1HARA 2DPJA 4F4WA 3GV8B 4TY9A 2E9TA 3M8PA 3CIZA 5KT2A 2WTFA 3I5BA 1R0AB 4R8UA 1OS5A 2CKWA 4FS1A 3KK1B 4ID5A 3IS9B 1N5YA 2IA6A 4O44B 3BREA 5KT5A 2VG5B 1TL3B 3KJVB 5F8JA 4NCGA 4IFVA 4ECUA 5DGBA 3LP1B 5HLFA 4I2PB 2XGPA 4F50A 3LP0A 2BE2A 2D3ZA 5F8GA 3NKYA 5KG2A 1N48A 2OH2A 2FJVA 1S1VB 2UUTA 2UVWA 3JYTB 5J2MB 4JV0A 3KLIA 4MFBA 4MK8A 2WONA 5C24B 1IM4A 4ZPDA 1TKZB 4TLRA 4NLTA 1T94A 2YKMA 5L1IA 3V6JA 1DTTB 2YNIA 2HMIB 4PWDA 3KLHB 5HROA 1S9EA 4ECWA 3MFIA 1RT6B 3BSNA 3KLGB 4HKQA 4IG3B 1JLBA 3KNAA 2AX1A 3PW7A 4I7FA 1SV5B 4NYZA 4M94A 1K1QA 4ZVFA 4O3NA 2E9ZA 5KFOA 4QW8A 3HHKA 5T14A 3M9OB 5KFTA 4QW9A 3KHRA 1FKOA 2O5DA 3DOKB 4KV8A 4KE5A 2YNGA 3C6UA 3V6DA 2FJWA 4JUZA 5KG4A 5D3GB 3CVKA 4LQ9A 5F8LA 4ED8A 5DLFA 1S9FA 4IH7A 4J9NA 5C5JA 1U09A 3H5YA 4EYIB 5KG3A 4ECYA 1SH2A 3SFUA 1JKHA 4ZP9A 4O4GA 5J2NB 3MR6A 4F4XA 3DYAB 3NMAA 1VRUB 4NLXA 3GV5B 3KK2A 2OPSB 4IDKA 2HNDA 4H54A 4WFYA 4J9PA 3KLEB 4XO0A 2IC3A 3E51A 4ZHRA 4RW7B 3DRRB 3RB6A 3EZUA 4QPXA 3RBEA 2FVSA 3OL9A 1RA7A 4Q43A 1JLQB 1TVRB 4QWCA 1RT4B 1S6QA 1JLEB 3IS9A 3ITHB 1SUQB 3BGRA 1T03B 2HWHA 3CO9A 3LANA 2BANB 4ZPCA 1N56A 1S10A 2WB4A 4WZQA 1RYRA 5KT4A 1S0NA 3DRPB 5KT7A 4O3RA 4O3OA 3FFIB 2CJQA 3PW2A 4NLWA 4KFBA 2FVRA 3MR5A 4H4MA 2OPQA 3FDSA 5F8NA 2QV6A 2B43A 4R8UB 4XPEA 1TP7A 3IG1A 2UUWA 4O3PA 3ISND 4ID5B 1RDRA 3MEGA 5HBMA 1N5YB 3LAKA 4ZVGA 2ALZA 4KAIA 3RB3A 4ECTA 4HYKA 4Q44A 1ZETA 4NCGB 4IFVB 1HMVA 2ILYA 5HLFB 3RB4A 2FJXA 4QWEA 1KLMA 5K14A 5KT3A 2XGQA 3LP0B 2BE2B 4NLRA 1S0MA 5F8MA 1S1WA 4F4ZA 3H40A 4IH5A 3T5LA 4MFBB 5KFHA 2WONB 4OL8A 1UWBA 5F9NA 2YKMB 3HVTA 2YNIB 1JX4A 1BQMA 5HROB 3KLFA 4LSLA 4PWDB 4NRUA 1S9EB 1BQNA 1RT5A 5I3UA 3LAMA 4RUCA 1NHUA 4R5PA 1JLBB 2GIRA 5J2QA 3D28A 5KG1A 4KO0A 4YR0A 4RW8A 1IKVA 4RNNA 1D0EA 1S1TA 4I7FB 4URSA 3BR9A 3BJYA 1S6PA 1ZTTA 3PZPA 3RAXA 2JEJA 4JV1A 1FKOB 5C42A 1S4FA 2YNGB 3C6UB 3V6DB 3IGVA 3SI8A 2W8LA 4O3SA 1C0TB 2B6AA 3KMSA 1EP4A 1DLOA 1LW0A 4RU9A 3QZ8A 5KFYA 1JKHB 4O4GB 5KFRA 4K50A 5F9LA 4G1QA 4LSNB 2F8EX 3H5XA 2VG6A 3KK2B 3SFGA 4IDKB 5CYQA 2HNDB 1K1SA 3CJ3A 2V4RA 5FDLA 1KHVA 3FQKA 2IC3B 5J2PA 4ZHRB 4NLGA 4DG1A 5L1JA 3DLGA 4J9KA 2IAJA 3DDKA 4WFZA 5KFXA 3OL8A 3TAMA 1RTHA 4K4SA 2W7OA 2IJNA 3V81A 3IRXA 3T19A 3TVKA 1REVA 3RAQA 4NLSA 1S6QB 2VA2A 4IG0A 3BGRB 3CWJA 3KOAA 4NLDA 4FS2A 3KLVA 4QWAA 3RBDA 3PHEA 4YMEA 2UVVA 3BSAA 4DL4A 1JLFA 1C0UA 1RT2A 4KFBB 2C28A 4WYLA 4J9SA 3FQLA 4H4MB 1J5OA 4J9RA 2OPQB 5EUHA 5L1LA 3IG1B 1RT3A 4NLPA 2AU0A 3MEGB 5HBMB 1I6JA 1GX6A 2ZKUA 3MTKA 2XC9A 3DMJA 1SH0A 3NAIA 3I5CA 2FVQA 4DEZA 4Q8EA 1HMVB 2XCPA 4TXSA
chains in the Genus database with same CATH superfamily
3HK2A 2CPJA 1U45A 5CCLA 3DM2A 2IYIA 2XM3A 2GAHC 2HSEB 1BQMB 1BHNA 3T9NA 3AJ2A 2YNHB 3L95X 4ED6A 3KTQA 4DPYA 3R6LB 3QJJA 1Q8LA 1O51A 3Q89A 2IY5B 1FWLA 1YJRA 5FIIA 5F0UA 4ED0A 4G1QB 1DURA 1OMSA 3M8YA 3MAAA 3SCIE 2RIJA 1X4CA 3N28A 3IO1A 2NS1B 5H9FJ 3UWTA 1YJUA 2V4QA 4QIFA 1RT7A 2QL9B 2E9RX 5D0RA 4WYWA 5AJ3F 3H4BA 2E44A 1HQEB 2F1FA 4YHHJ 2YNHA 3I96A 3ETMA 1ZTWA 4LFAJ 2ADCA 2F4VF 4EBEA 4IO1A 4LF4F 4FBUA 2PDAA 2UXBJ 2ZE2B 2K06A 3EPIA 3FC9A 1ICEB 3MEDB 5B0GA 2AEJA 2R9LA 2A3JA 4RWWA 2ZC3A 1FK9B 3HHLA 4RNHA 1RAGB 3GIMA 1DBDA 1EETA 3SQOP 1FX2A 2VFSA 2XCAA 1FRKA 4ECRA 3G6XA 2PGCA 1X5SA 3QZ7A 1TU0B 2K8GA 5IV3A 1TK0A 2J7WA 2XS5A 4KSEB 4AE5A 1TL1A 3HULA 2NCKL 2ZH3A 2ZD1A 1FRJA 3EICA 4CNYA 5CYMB 4JI4F 2B4OA 1MMNA 4K4XA 2LXFA 2YX7A 1XBWA 4J9OA 5G4DA 1SPBP 1UVNA 3W9JA 3T1HJ 1YRUA 2WW4A 1YHQS 5T7LA 1GH8A 4C3LA 3I0RA 4OLPA 3NNHA 4L6V3 1GAOA 3NL0A 2NZCA 1D09B 1ZOTA 2ZNZA 2CZ9A 4OJHA 2HFOA 2XTJP 4WIQA 2QO3A 4C11A 4PPZA 3NP5A 3JYTA 4RW9B 5KFKA 2OEMA 4CZCA 4DUTA 2CPZA 2YBVA 1YVFA 4X2BA 4IG3A 2QYCA 1SI9A 3W5XA 3DOLB 3FMWA 2VFTA 4DJBA 2RF2B 1WHWA 4DUZF 2PN6A 3GV7B 2EBGA 3MR3A 2E1AA 3MWBA 1JXLA 3Q8YA 3KLEA 1RHQB 1RABB 1WC6A 2DIVA 1XR7A 2MZRA 1RT4A 3FBCA 1IJEB 1YKWA 2XSJB 4ZJQA 1VIXA 3CJ8A 2G2OA 1YBUA 3QJPA 3CGIA 2EFGA 1CVJA 4J7CA 2EFQA 2DNMA 1NJXA 1RU1A 4D3GA 2LP4A 1ZM4A 4NCGA 2UXCJ 2XGPA 2HFUA 1R7IA 2KFYA 1QY7A 5HROA 3WIVA 3HFVA 2LKZA 1RE1B 2XLKA 2M8DB 3HHKA 4J5OA 1H73A 1X8DA 3MMAB 2HVZA 2CQ3A 1I94J 2C3YA 3GV5B 3G2XA 4CO2A 2OUGA 4KPCA 2KVQE 3LANA 1S10A 1RYRA 2DRDA 3PW2A 1XMQJ 2LXUA 2OPQA 3C16B 2ZH6A 3RBXA 3EXCX 1FJGF 5KAKA 1P6TA 2QMWA 3JAMY 5HMYA 1KLMA 2EEYA 3AAWB 1IVZA 5G0RA 2WONB 5LM7E 4JOUA 3BV8A 4ER8A 4LSLA 1NZ8A 5I3UA 4YR0A 1IKVA 4I7FB 3RAXA 3M8RA 4CP5A 3V6DB 3TZYA 3PX0A 2VDHA 1G1XA 5KFYA 2IIHA 2Q6CA 4LSNB 1AROP 3QRPA 1BXNA 1XNQJ 1WC3A 1NK4A 4CH7A 3D1HA 2L08A 4NLDA 4FS2A 3RBDA 1WTBA 3J7YI 1WACA 5JJBA 1UTAA 5HQ8A 1UPPA 5LMNJ 3GFHA 1HWJA 2BQ3A 2DNOA 3G96A 3B4DA 2XULA 2Q1LA 3N0VA 1ZYQA 2DNQA 2DB1A 2LU2A 4B9MA 2X1BA 3D2WA 1R8AA 4QYZK 4DCPB 4N5SA 2VA3A 1Q79A 3OTCA 3NBPA 2M9KA 2BV3A 2DGUA 1SJ3P 4LSNA 2JH3A 1GQEA 1SL1A 5C42B 1I5OB 3F73A 4Y2KA 4UQTA 1HNVB 3CCRS 1YJVA 1NKCA 2BQRA 1U1PA 5J2PB 5CD4H 2KVIA 3FZBA 2MKCA 3OR1B 2Y1RI 1HNZF 3TAMB 1RTHB 4Q8FA 2OI2A 2ASJA 3RB0A 8AT1B 4PQUA 1GFWB 3VWSA 4R0JA 2I5JA 5KTQA 1X4BA 1O5JA 1OY6A 3SSQA 2R7SA 2JHEA 4J91A 3S8SA 1NKEA 2K3KA 5DDOC 2LCWA 1Q0NA 5IFMA 3DI6B 1HNVA 3EM1A 1FDAA 3HDSA 4PR6A 2DIUA 1F2GA 3ISNC 3ISZA 3DC2A 5A0YB 4V19J 5HMXA 3P45B 4YB5A 1NBEB 3C15A 4DFPA 2IHR1 1MSWD 5HANA 4NXNF 4LF1A 2JDJA 5DO2A 3JB9k 1PGZA 4ZLPA 4ZS6A 4IFYB 1VQPS 5HJXA 1LW2A 2XBPA 1TKTA 4OMFG 3SV4A 3U1LA 5DG7A 2AW0A 5KFLA 2V68A 2C3OA 3R5DA 3JQJA 4UT4A 3BYPA 3H25A 3NWGA 5ETTA 4NZ6A 4I2QA 3G8QA 4MKYA 1RHMB 1HW8A 4UZCA 4FKXA 4B3TJ 1R0AA 4JI3F 4KGMA 3M2VA 1LEOA 1V5IB 4NXMJ 1X4DA 2HHPA 1DTTA 2WW8A 3NCPA 4X4QA 5KOXA 1RT6A 1KVJA 3IAM9 1VCTA 1R43A 2LFVA 3RRGA 2X1AA 2JWNA 2A0FB 1NJWA 4URQU 1CJTA 3DOMA 2KJVA 3MMCB 3MUTP 2L41A 4NEYA 5ETSA 3NNAA 1SXLA 4USUA 4DN0A 4ZMMA 3QIPB 1PG5B 1S59A 3G82B 1LK5A 1P1LA 3RR8A 4CO3A 2KM8C 3HSZA 1JJCB 2NPFA 2AEFA 2CKWA 2W4DA 3IS9B 1AZSA 2IA6A 3T1YF 3N01A 2VG5B 3GJTB 4OI6A 1RZMA 2RRNA 3NKYA 1N48A 2FJVA 2W2PP 1FRHA 4C4WA 1Y3JA 4ECWA 1BD6A 3AQOA 2GVZB 3S01A 4PG6A 3DOKB 3WQPA 4IH7A 2E5LF 1FF2A 1U4BA 4NLXA 1F9HA 1SIZA 4B3SJ 1Q8KA 1LXNA 1ACMB 1FNOA 1JLQB 1TVRB 4DF4A 2DGTA 3GYNA 1JLEB 3IS9A 2BANB 4QQBA 3C14B 4DQIA 1NO8A 2B4PA 4S0MA 3A8IA 4H4MA 2HIQA 2RMLA 3S1TA 4HYKA 1B4SA 2OMLA 4DU7A 1YWXA 1S79A 3IM9A 4DPWA 4IH5A 4WP9A 1BQNA 3MM9B 1VQNS 5KG1A 2HWTA 1KDNA 1D0EA 4EI2A 3I9ZA 1JMTA 3J7ZT 2HHSA 1HWIA 3MM5A 5AE3A 5A76A 1JKHB 1AW0A 4FF4A 2FY1A 4CLKA 1MWZA 3KKFA 3V81A 3PHEA 4BDPA 1OQ3A 1JLFA 2HQGA 4WYLA 1S6UA 1RT3A 2FC9A 4P2FA 5CD4A 3MEGB 3OUYB 2DO0A 3LF0A 3CJKA 2XZDB 2EC2A 2H4YB 3A13A 4EWTA 2BJ3A 1LWFA 1S1WB 4ZVHA 4M63A 2J6SA 2GIQA 3NCRA 4C8LA 4OHZA 2UU9J 3GYXB 5IC4B 3SCLE 3I0SA 4H4KA 1VQMS 2OELA 2ZM6J 5H1SV 1LW0B 3FMBA 2HYIB 1NPKA 1JWWA 1R6YA 1T11A 3ZTRA 2XLJA 3N9UC 2HVIA 3LOUA 3DLEA 2IBKA 3CF5Q 2P2CB 4JI2J 4N7TA 3CMQA 2VHGA 3R1HA 4YDDB 1IKYA 3POTB 4UUWA 3MUMP 1WOSA 3UVJB 1KTQA 4MKBA 1JNZB 1OSDA 4OI0A 3DLLQ 4CIOA 5DGAA 1U2RA 1EQ0A 2AGQA 3CD5A 4BC7A 1RTZA 4A47A 2HAIA 4FXVA 1FA0A 1OSCA 2B0GA 1RTJB 1A6LA 1WG5A 4DX6A 1IR0A 3HHLC 4YHHF 1RWXB 3K59A 4MKAA 1NNDA 4LFAF 2ZWPA 4TU8A 3WC2A 4B17A 2W9CB 3QGGA 4FKYA 2W7PA 2UXBF 1AT1B 3M9NB 2J7KA 5LMUJ 3N4WA 2E5JA 2ZH4A 2BQUA 4MYUA 3W1YC 3P8BB 1S5ZA 3CPWR 3K89A 3R1LA 1EZZB 2KH9A 1F5BA 2M8HA 2J0WA 5U47A 2GJFA 3JSMA 3ONQA 4Q5VA 1Q78A 2MSTA 1SKSA 2X3DA 5A6WA 3UDCA 4OZ3A 2W8KA 3GIRA 1MLAA 1B0TA 3V2UC 2JL9A 1BY9A 4MK7A 3OTDA 3PVXA 1Q7YT 3T1HF 1B70B 4HDGA 4C0OC 1TKZA 1VBXA 1MU2B 4IQXA 1HI1A 4RW4B 3D6FB 3RW7A 6FD1A 1UAWA 4QOTA 4GC7A 3W62A 5ETOA 1YIJS 2D3UA 3WBZA 2VONA 4DL5A 2YVSA 4YB6A 3DDIA 5GMKa 3UN5A 2BKOA 3MOZA 5MLCV 4CH1A 2HZCA 2V0NA 3DRRA 3LALA 1HBMB 5JXSA 2VQFF 4IKAA 2WTFA 3M7VA 1TL4A 4USKA 5D8HB 2CIMA 1XERA 3PM9A 4CYUA 5HLFA 4I2PB 2BE2A 5J2MB 3ZZ0A 1WC0A 2KKHA 2YNIA 3FEZA 1L3VA 2UXCF 5KG4A 5F8LA 4C8YA 3QQCD 5C5JA 3H5YA 4EYIB 4HHJA 5KG3A 4PABA 3W7BA 2ZHAA 4F4XA 1FJEB 2KRBA 4H54A 2VPWB 2HWHA 2E5IA 3SCKE 2ZVSA 1U47A 2J0QD 1PBAA 1I94F 1VOMA 4WK3A 1R8BA 5DETA 1GK8A 3DLHA 3BH6B 3MM6A 4ZVTB 1KQGB 1F9EB 3MPDA 2WVFA 2E1PA 1JX4A 4OZJA 1XMQF 3LAMA 1JLBB 4ZVQB 4RW8A 2V9KA 5F0WA 2DCUB 4LF2A 3PZPA 4JI1J 1S4FA 7AT1B 2DEIA 4D3HA 5LSLA 2EI5A 4C98A 4CO1A 2OFHX 2XY5A 3IP0A 5FDLA 1N33J 4ZHRB 4C8ZA 3CD0A 3NNCA 3QFHA 3IBFB 2IJRA 4NLSA 2XMVA 4DL4A 1FT8A 2FQQB 1KP6A 5EUHA 3A1YG 2MB0B 3IG1B 2AU0A 2XC9A 2UV8A 2FVQA 1XNQF 1ULRA 3CCLS 3OFGA 1WG1A 2FC8A 1K47A 2C2RA 2CNNB 5IWAJ 2G1DA 1NM2A 2FUG9 1XIQA 4X64J 1XMBA 3I6PA 5IT0A 4IRCA 2WB1D 2R2TA 5LMNF 2OGUA 4YEAA 4YS2A 1E6YA 4ZCKA 2DNKA 5DDQC 4EFAC 2GC8A 3G87A 2FD2A 4M5LA 1SJRA 1SL0A 3RAMA 3EVMA 2GCFA 4OYZA 4ELUA 4YY3J 2ZUGA 1IQTA 1HW9A 5DQGA 3D7SB 4MIAA 4ILRA 1S9GA 3FCHA 3HSDA 1MG7A 5ETQA 1IQZA 2GQ2A 3ENQA 2DGWA 1CC7A 3OHAA 3CTRA 2D1CA 3TUZC 3GCWP 2IRYA 2BA9A 2OHDA 1HD1A 1C1CB 1OPIA 4LRAA 1EHWA 2EK6A 3DLKA 1G6BA 3UFCX 1WTFA 4ED5A 3PW4A 4Y2CA 3CCQS 3MEEA 3PJXA 1HBOA 2J8AA 3QT8A 2C2ZB 3CB4A 2JX2A 4DSLA 4OZNA 3DFEA 2IM2A 4QJVA 4USTA 2AJ4A 4ZJOA 4LRDA 3AXKA 2RS8A 2MQMA 2E66A 4DR6J 1WKKA 3BO4A 3BN7A 3PEJA 4FVMA 1T0TV 1U1KA 3A4TA 4JI7J 3UNGC 3MMBA 2DNPA 3RZAA 2XYGB 1ZAXA 4KB7A 4L3NA 4TQRA 2ZFHA 1RLCL 4GKKJ 2R2SA 2Q3PA 2HURA 2W9BA 3CC4S 2ZBCA 4IR9A 1FTRA 4ID8A 1FVSA 1QTMA 2R8IA 1T9VA 1NB7A 5SZTA 2HFSA 4C8NA 1UWAA 4HI2A 3TW0A 4ALZA 3GIIA 1X4GA 3R9LA 4IR1A 3HM9A 3LP1A 2OPPB 3M8PB 2DEJA 2RDJA 1D9FA 4KPYA 1Q53A 3TZXA 5GMEA 2MLZA 2FTRA 4OZLA 5HVFA 4NASA 3KHLA 2FZKB 3PACA 2ASDA 4B3TF 2VKZG 1G7CB 1ROFA 1H74A 1S76D 2NXJA 4NXMF 1JLGB 1HR0J 3MAQA 2VICA 5BYQA 1IJFB 1RAAB 2IM3A 4WE1B 3FGVA 3HP6A 3K5OA 2B8QA 4GKJJ 2ZH2A 2CWKA 2XSFA 1VQ7S 2HHTA 3M8PA 4TU9A 1UW9A 2MKJA 2CZ4A 2YH1A 2OH2A 3HSJA 1APSA 2B4VA 2XLIA 1UETA 3MGJA 1M5SA 1Q8IA 2G13A 1A7GE 3KUHA 4JI5J 1K0VA 5KFTA 3CCZA 2AKWB 3SYZA 5JVHQ 3C6UA 1S9FA 4QU7A 1SH2A 1R0BG 5J2NB 3W61A 2VFUA 3MD3A 3RB6A 3EZUA 4QPXA 3RBEA 4Q43A 5L9NA 3R2CJ 5HSPA 3ITHB 1LK7A 7FD1A 4ELTA 5DS7A 1S0NA 1RU2A 5GAHU 5A8RB 1YRXA 8RUCA 1PYSB 3H7HB 4U9RA 3JXOA 5CZVA 2DHGA 2CQHA 3M4XA 4KAIA 4B3SF 4DX8H 4A8XA 4BLGA 2CJYB 3PY8A 2RQKA 4CQ1A 5LJ5Y 4NX9A 3EGVA 5ETVA 2MJNA 3OXFA 3W2WA 4LJMA 4RUCA 2GIRA 5A8KA 1IBKJ 1S1TA 2JVOA 1RHJB 3BPSP 3JQKA 5E7OB 3NXZA 2HFNA 4PEOA 3W8PA 1N5SA 1NSPA 3TA2A 3M30B 2CRLA 5HMWA 1VK3A 1VYAA 3GG1A 4NA2A 3MOJB 3QNWB 2VUGA 4HT5A 5JMNA 4LREA 2DKOB 4KC5A 3NAIA 3GB0A 1NK7A 3LUYA 4J9VA 1JLCA 1J2VA 3M1VB 1YBTA 1TTHB 1JIHA 1F0XA 2E7XA 1N4LA 4H4KC 2HZAA 2J9DA 3BSOA 1GMUA 3AB4B 4NLOA 1RWKB 3EZOA 3MFHA 3MF5A 5HL7Q 4LFBJ 1EP4B 4PXBA 4ZPTR 1RTIA 1AFJA 3IWNC 2UU9F 1REVB 2RHSB 2ZM6F 3CDUA 1UJ6A 3BKUA 3T1AA 1J5OB 2QT7A 3MUVP 1CJUB 2DRBA 3QAEA 5D15A 3MECA 2FHOB 4TLQA 2MY7A 1WF1A 2KRRA 3AHPA 4JI2F 4NYPA 4U7UK 4JB8B 2R8KA 1MN7A 3WIUA 4K4VA 2VH7A 3QYYA 2MYFA 4OX9J 1D8YA 2HQCA 3QSYB 3AD9C 1TFWA 3LTOA 3M6XA 4Y2AA 4LBPA 2CJBA 1KQFB 4G3IA 1UL3A 3LGNA 1HYSA 2LVWA 4X4VA 3PTWA 2EWHA 3SZ2A 1JXVA 2MZ1A 3H20A 2WRMA 1GNKA 2RKIB 5BR8J 3EPGA 4N41A 4OV6A 3EVOA 3ZO7A 1SB6A 3NS6A 2BZ2A 5GAHI 1ITPA 4RW6A 5KFGA 4MMOA 4C6AA 2HNYB 3ICLA 4ECQA 1FE0A 4QZVB 3C6TB 1RWVB 1MROB 3SSSA 2AWZA 4F26A 4OI2A 5LMUF 4LF7J 3HKWA 3M8QA 3Q83A 3NY0A 1N6QB 4PCQA 2DJWA 2P8IA 1T9TA 4FYDA 2MZTA 2DXEA 3CDBA 1X5PA 2DGQA 3TEHB 2G9OA 3M2UA 2DR9A 2DITA 3ZZOA 1UZDA 2XWXA 3OL7A 4B3OB 2H1YA 1T3NA 3BO3A 3B54A 3X3UA 1LWCB 1KFSA 4P10A 2HS3A 4M95A 1CJKA 5F8IA 4XIUA 5KFUA 5KFPA 1SH3A 2ZUAA 1VRUA 1VDHA 1NRKA 2IJFA 1B3TA 4MH8A 2BE7D 4WFBQ 1U0HB 4LBIA 3TX0A 2HBYB 1DQ9A 1X31C 4PQAA 3F41A 4TY9A 2VBZA 3CIZA 2ZVIA 2J76E 1N5YA 2HS4A 2F8HA 4PPDA 5IZHA 4X84A 2CNLB 2UVWA 3JTOA 5BXIA 1FHTA 4DZDA 5C24B 2MKYA 1H7WA 2WSEC 3LWMA 1RISA 4DZ6A 1UVKA 1S9EA 3BSNA 2DBBA 2RNEA 1P27B 1NKBA 3CSKA 4O3NA 4QW8A 1VBZA 1KNZA 1KSPA 2VPXB 4F8RA 3CC7S 3CVKA 5DLFA 1QSSA 4J9NA 4K8RA 3IMQJ 4O4GA 3DYAB 3VR1A 1OPZA 4JI6J 3TUPA 1WHXA 2VZ9A 4AUKA 2Y9HA 2IC3A 2FVSA 1RA7A 4F25A 3AOAA 1SKWA 4WZQA 3DRPB 2ACYA 2X3GA 4EUVA 5F8NA 4R8UB 1ELOA 2ZBPA 4O3PA 4ID5B 5HBMA 4ZKAA 3RB4A 5GMDA 4MFBB 3U27A 3HKZD 2DXDA 3MD1A 4UOFA 4PXCA 1M5PC 2R7UA 3D66A 2P5VA 5I3PA 2AJFE 4LR8A 1NDCA 1K1SA 2D3OR 3BGRB 2HVEA 1U2CA 4YMEA 2DGXA 4OYXA 1M5OC 4JI1F 1C0UA 4ZPWR 3C46A 2CPDA 3FSXA 1IXKA 2BMBA 4USWA 1HBNB 5CHCB 1FDNA 3DMJA 1SH0A 3RW6A 1WOPA 4Q8EA 1N33F 2H4WB 3QO9A 3VQSA 4OLOA 2D7SA 1EX8A 5I42B 1YQHA 2QL7B 3DLJA 2CA9A 2UV8G 3HVTB 1XK8A 3FSIA 2E29A 3EUNA 3CCMS 4KO0B 4M5GA 2NR0A 2Y3YA 2V4JA 2RRAA 1URRA 3W5ZA 5B0AA 1R31A 2HQFA 5A8WA 5DM7Q 1UPMB 4W90B 3RR7A 1VQ4S 2V6AA 2YTCA 1IM6A 2VG6B 3BBFA 2AF6A 2Z2ZA 3Q8RB 4NL5A 1X0PA 1U1MA 2CQ1A 3JS9A 4X64F 2G1HA 4ZK7M 3DRYA 4IG0B 1TKXA 1RCOB 3NOGA 2XB2D 3FBFA 3R97A 4NLQA 2GVDB 2HHUA 4Q7AA 4IOAQ 3C8YA 5I42A 2ZDOA 1GXLA 1T9XA 1VIOA 2RE1A 4X4RA 1NCLA 4LVOP 3BH7B 4X66J 3LP2B 1RAOA 4HACA 2DH9A 2ADBA 4F4YA 1B64A 2PEBA 2MQLA 2K1RB 1X7VA 2W1BA 2CJ9A 4YY3F 2LLZA 1T05B 1RK8A 1SQEA 5D6GA 1X5OA 4B9TA 3ET6B 3ZTSA 1CBKA 2XHCA 1DQAA 2UZAA 4PRFA 3I4PA 4MIWA 6FDRA 3L4BC 4YB1P 1HPZB 1VI7A 4OX8A 4PG8A 5HQMA 2G0CA 5M2UA 5A2QU 2J6UA 2LEPA 4BHQA 3D54A 1JLAB 4NEZA 3GILA 2M4MA 4C0BA 2JC1A 5FLXU 3KDNA 2RU3A 4ANCA 4M5IA 5DLGA 3M9MB 3O2IA 2K7KA 5IXUA 3E3XA 2I1RA 5IT4A 4WFAQ 2IDLA 2QYGA 1B7YB 4AFFA 1DTQA 3AT1B 3TUJC 4DR6F 3HJVA 5ADZA 2FLPA 2C2KB 3SQGA 4IH6A 4JI7F 4IRKA 1FKPB 4L3KA 1NJYA 4C0HA 2RILA 4QWBA 2H5IB 5KG5A 3KK1A 4GKKF 4YUDA 5F41A 3F0NA 2GJIA 3THPA 2UVRA 3OW2R 2DT9A 1YTYA 4ILLA 3MM8B 2LA6A 1RWOB 5K5MA 3PFEA 2JEIA 4USJC 1ZM9A 2DTJA 2LDYA 3GPAA 2OPSA 1LFPA 3EGZA 4X4PA 3GLJA 2ZC4A 3CW2C 2FHMA 3I32A 1RBOB 4G1PA 1HR0F 4DFKA 1TL3B 3MM8A 4ECUA 2JNJA 4OZ1A 4CLSA 1D8ZA 2E1CA 2CJXB 2Z2LA 3QT7A 4GKJF 1BUXA 3EVWA 2YKMA 3V6JA 1WJ9A 3L09A 4I64A 1P8GA 4HKQA 3T6BA 3B8HA 5B7WA 2XHWA 4DV7J 1HBUB 2ZBIA 4KE5A 2FJWA 5D3GB 1FERA 1S12A 1M90T 6AT1B 2MJUA 4F4AA 2K2PA 1LOUA 3KUEA 2N7YA 2FHJA 4JI5F 4K2JA 2E7VA 1BLUA 3P5TL 1UCNA 4B3RF 4NLWA 4KFBA 2AMCB 2L48A 2RHQB 1YRTA 3NGUA 1CJVB 1VQ5S 3DU5A 3M2RA 2PSZA 1ZS6A 4QWEA 3CD7A 3D0GE 1S0MA 5ETRA 5DZ7A 4P74A 3H40A 2W2MP 3T5LA 4USIA 2HK2A 3KYLA 1DJ0A 1N34J 2ZHBA 3HPOA 2ROPA 3BR9A 3PCOB 5B08A 4LRCA 1FKOB 1UVMA 2HGNA 3D68A 2H54B 4NPOA 3BGLA 1Y00A 5IM0A 4QR1A 2GW8A 1BC6A 3CCES 1HNWF 2HNDB 3P4UB 2YX4A 2RRBA 3DLGA 4OZ0A 2HK3A 2E7WA 4O0IA 2W7OA 3T19A 1IBKF 5E33A 1GMWD 3GMGA 3SSRA 4ERDA 4NLPA 2IPOB 1OY9A 1HMVB 4TXSA 5K14B 3KHGA 2JEFA 1F1BB 1LNQA 4LMZA 1C4CA 2BJEA 2EPIA 4F0MA 5H9EJ 1H2UX 4EZ9A 4CLTA 3NEKA 4PUOA 1QE1A 5E5NA 2FY8A 1KD1T 4M5NA 2V2ZA 3WDOA 3TR5A 4YQWA 4C7QA 1WG4A 3PRBA 2IVFB 4QR0A 2B6AB 1DLOB 1U25A 4CLFA 2PE8A 4DG1B 1VQ6S 2HQDA 4K4UA 4WIIA 3UQSA 3P96A 4GVLA 1U7LA 3U02A 4JI0J 2OEKA 4LFBF 2WOMA 1NXIA 4CNZA 4C8KA 3W2VB 2YNFA 4O23A 4DPOA 4GRSA 2Q6BA 2DD8S 2ZNYA 2A2CA 1U1QA 3K58A 3DU6A 1SVDA 4Y34A 1UMJA 1C1BB 4DCJB 3I5AA 2HGMA 2BVZA 1ZM3A 2HHHJ 4WK1A 3QLHA 2DK2A 2AX0A 4CDIA 1VRTA 2FVPA 2MPUA 2MXYA 1VS3A 1GXUA 2WCXA 5JUMA 4R0EA 1IKXB 3ADAC 3CDAA 3ILOA 2ZEJA 3R27A 3OVBA 1WF2A 1TMJA 5A2QY 5E3AA 2O1PA 3T3FA 2HNZA 1H3DA 3UDVA 8ATCB 3RRKA 3MCOA 5FLXY 3CCTA 4OX9F 1DZ5A 3B4MA 5LSRA 3V4IA 2MKIA 1NPRA 2VJUA 1C1BA 1S1XA 4FZVA 5ETMA 4LF6J 3A3PB 2ZH8A 2WVEA 1RQ0A 3BEGB 1LFWA 4IO9Q 2VBXA 3OFEA 4K2XA 1RP5A 2KTQA 2BM0A 3RRHA 2MKSA 3AB2B 1AYEA 1RHKB 2B8PA 3O1LA 2CADA 1TAQA 5AT1B 2AP6A 5D4LA 1K44A 3D1QA 1TV6A 4O4RA 4RBTA 4CO4A 2RAQA 1FRLA 4IOBA 4TY8A 1NAQA 1DHMA 1IKWB 1B7FA 1W2BR 3FCVA 4QCLA 2BW2A 1KS2A 3NRBA 3M32A 1MMLA 5KG7A 3K0JA 4CLPA 4M1KA 1TUWA 3KJVA 3IWLA 1HQUB 4LF7F 2ZBRA 1PYTA 3BS9A 3N6LA 1PJ5A 2G4BA 1Y7PA 4UTGA 1RT1B 4OX6A 1T8EA 5E3RA 4EBCA 1M1HA 5K20B 1Z4UA 2E1MC 1YSJA 1M0SA 4NLYA 1KR4A 1TUVA 5KFMA 3M6VA 4WTOB 2IDEA 5J1EB 3FFIA 3DGVA 5L39A 2YWWA 3TQEA 4FS1A 4FF3A 3BYRA 4O44B 3VGSA 3BREA 4IFVA 2HVDA 4F50A 2HRUA 3UD4P 1VQOS 2C3PA 2UUTA 2OSQA 2V34A 3Q24A 4I4BA 2KI2A 1T94A 2WAQD 4E8UA 2AX1A 3TOQA 4NYZA 5KFOA 1SQFA 1VQLS 2KXFA 2HLTA 3V4MA 2KL8A 3R6GB 3OTEA 1UKUA 3CIMA 1ZZNA 4ED4A 3OL9A 2CZVC 5HQLA 3AA9A 5ETLA 2MTLA 2CJQA 2V67A 3H90A 3MR5A 3G9CA 2J9CA 3EGWB 3QT5A 1G2EA 1R0CB 4JI6F 4Q44A 2EG2A 1KC8T 3GFZA 4CLWA 1SKUB 2F5GA 4ZVRB 4DV4J 4I6YA 4KH1B 5F9NA 1N54B 4FYXB 1BQMA 1EJ7L 4RNNA 2N4DA 3ETOA 1RXOB 1U0SA 4DFJA 3C2PA 4LF9J 2D69A 2KZZA 3Q2TC 3CD6S 2RT3A 4G1QA 3K8WA 3KK2B 1L5UA 1KHVA 5HVGA 3TEGA 3C3LA 4Y0FA 4J90A 2IJNA 3ZZYA 9RUBA 3R2DJ 1PYOB 4ZVOB 3U1NA 3UN2A 1NDPA 1U24A 2JLGA 4F04B 3VTIA 1HQEA 2SXLA 3OXLA 4DR5J 4KY3A 2BXJA 1OYEA 3D0HE 1TL7B 1UWBB 2LA4A 2AYGA 4EMDA 3DGPB 2ZE2A 2HPUA 3JTPA 4WXOA 3MEDA 1QJHA 3KMQA 2AYBA 1FK9A 1UVIA 4RUAA 4DFMA 4LRFA 4A8KA 4M5HA 2B3TB 3OLBA 4ZPAA 4WKYA 1RT2B 4OYBA 4NA1A 4DXLA 4OI3A 3HHEA 3CEDA 1TL5A 3SEOA 3VGTA 4DSJA 3S7RA 5KG6A 1F9FA 4ZITA 1YJWS 5CYMA 1B0VA 4HHUA 3HFZB 3TNVA 1RHRB 3DGPA 2CNKB 3OLAA 2VQFJ 4WJBA 4ZJLA 2XY6A 4C3MA 1RTDB 4Q0BB 3PR5B 3OPKA 1R8PA 4X66F 3MXHP 4DLGA 3Q8UA 4LVNP 3RYLA 3T5KA 4DV3F 1G3OA 3GJQB 2MHNA 4M5DB 1R3NA 2V63A 4RU2A 3VGVA 3QGPA 2F7VA 2FVCA 3TJ9A 4OYAA 1PILA 2GJ2A 4RW9A 3HMJG 1YI2S 2PT0A 5CXTA 1XR5A 1FCAA 1U2FA 3VAJA 2FLOA 4LFCJ 1HNIB 1WEXA 3DOLA 4I6WA 4PAAA 1RACB 4DPUA 3AJ1A 2A6OA 2RF2A 3GZ7A 1PIEA 4CTAB 5IOLA 4P2MA 4OV1A 2HEKA 1EAYC 5C25B 5KFCA 1Q5YA 3H4DA 2BJ1A 1VQKS 2CDRB 4RPFA 2HRTA 1M1KT 2XSJA 2XYPB 4MT1A 1X9WA 5DDPC 1J5EJ 1BWVA 2BKPA 5AXNA 2GX8A 3MCNA 4DL6A 3MPYA 5C2CA 2N7CA 3T5JA 3U1MA 3OSPA 1Y5NB 4RZRA 2OKQA 2LQ5A 2HGLA 2VB6A 1PJ6A 4PXEA 4QIEA 3IBCB 4FP9A 3KK3B 1VFJA 2A2DA 1QLNA 1S0OA 2DISA 4A8WA 5L9XA 1AA1B 1VR6A 2KU7A 3MMAA 1FDBA 3GTYX 2PMWA 2XI3A 2OPRB 2FJAB 3E01B 3BDEA 3R7SB 3NWRA 4ICLB 1NZAA 3CJTA 1T95A 4DS5A 3R5BA 2V2QA 3MHYA 2ZZMA 1XNRJ 2GHPA 3ENAA 2E9TA 1SC4B 4PZVA 3HZEA 3C16A 2P9EA 2QMXA 4A48A 1T9UA 4N77A 5BJRA 1OWXA 1NEEA 2DNGA 1U6FA 2I2YA 4DBQA 4AXJA 4OHWA 1H7XA 2GS8A 2WONA 3ILLA 2XZTB 4ITSA 3KJNB 3KLHB 1AUDA 3H42A 2IMOA 4I7FA 4DR4J 2RU9A 3DLBA 2Z8QA 3IR7B 2DHSA 4HR2A 3V6DA 4JUZA 3OR2B 4ED8A 4DN9A 3UN3A 1Y5LB 1H72C 2DH8A 1V9OA 1Y11A 4OHVA 2KJWA 2RSQA 1S7IA 4JI8J 3O3LA 4RJVA 4OFZA 2FJDB 3OTBA 1SUQB 1T03B 2C2NA 2V5HG 4A8FA 2FPHX 4DV7F 2F4FA 3R3TA 4X65J 2WBMA 4CM0A 2GHVC 1FEEA 4C97A 4P52A 2FJXA 4RBUA 2NXEA 4L74A 2WZ1A 1FTCA 2B56A 3OR2A 4PWDB 3D9BA 5D4OA 3W66A 2EFOA 2QA4G 4G1IA 3FZ2A 2Y0BB 3ZTQA 5C42A 2YNGB 3SI8A 3A8JA 1FRMA 2XO7A 1N34F 5J2PA 4WF9Q 4A8OA 3OR1A 4MKVA 3TAMA 1RTHA 1S6QB 2JLFA 2AT1B 2COLA 2C28A 4DUYF 1NK0A 2DY9A 5L1LA 1H98A 4AT1B 3BPDA 4K0KJ 3ZZZA 4NZ7A 1N36J 1F60B 4DSIA 4DL7A 3QAUA 1DY3A 4U6PA 3DI6A 4P73A 1U48A 2C3MA 3KLFB 1RT5B 3JSYA 4P72A 5J2QB 1CULB 2XMWA 3TP2A 5BYSA 3RG6A 1S6PB 4Z7CA 1WDDA 5A0YA 2MGZB 1P9QC 2YX1A 2F63A 1N88A 1XMOF 2M7SA 5CYQB 2BKNA 4HDHA 3H59A 1RAHB 2IAJB 5L46A 1NDLA 4YB7A 1SJFA 3Q0AA 3A8KA 4IFYA 2V8DA 4KGZB 4J9LA 5DQIA 3H98A 3PW5A 1CS4B 3OHBA 1IWGA 3K5PA 4CT9A 1L3KA 4NYOA 4DR3F 3FVYA 2Z58B 5HP1B 4KKOB 3D67A 4L73A 2YKNB 1XN9A 4JI0F 1KN6A 4TYAA 3LO3A 2IMWP 2MHEA 1T9WA 3IGNA 1FFGB 1RGVA 1B99A 2VG7B 1TK8A 1Q8BA 3EMTA 3DN9A 4KGKA 4U8VA 5HJYA 3Q8PB 4UQGA 3E2EA 2HHHF 5DG9A 2U1AA 4U7UD 3O5TB 4EO8A 3N6NA 3ZZRA 2B9YA 3ZTOA 5C2GA 4XAKA 1Q7LB 2JEGA 4V19X 2BR0A 4USMA 4A8MP 2H65B 1HA1A 4WU3A 4DOZA 1W26A 3NOCA 2HG4A 3KHHA 3SDEB 5KG0A 2HZVA 4O3QA 4CLYA 3DKDA 1UEVA 4UOCA 4HTIA 3H8YA 4LF6F 3MMCA 1RAEB 3VVTA 2H48B 3DHWC 3QIPA 2YQ3A 4KGVB 3G82A 1LWEB 2R8HA 1XTZA 2HKEA 5KFQA 1DAXA 3AY0A 4ZCIA 3HF5A 4DV5J 3DRSB 2ZH7A 3THVA 4NI2B 3RUBL 2VG5A 2WBRA 3GR0A 3OTOF 4CLUA 1FNMA 2BJ9A 2ZH5A 3BSCA 2A18A 3PHTA 4TYBA 2ZOMA 2M2BA 4Y00A 1UFLA 2GVZA 4KHMA 3A8EA 1BWEA 3DOKA 3EJMA 4HLBA 3CDEA 1MWQA 3BGUA 2C2EA 1S1UB 4U67Q 4B9VA 2LECA 2Y1LB 3L3CA 3UNYA 1WELA 2W24A 4ENOA 3J81U 1JLQA 1TVRA 1JLEA 2BANA 3C14A 3MAHA 4GO7X 3UR3C 3DHXA 1PC5A 2DPJA 4F4WA 3AD7C 4OJ3A 1F3VA 3I5BA 1EKRA 1OS5A 4HH1A 5HN0A 2NZ4A 3TA1A 1FWPA 2QFJA 2Y1JA 5KT5A 5CH7B 4CO5A 4OIXA 1OYDA 1U1OA 4N47A 1S1VB 2LYVA 4KT0C 3CT9A 3QJLA 4ZN1A 1IM4A 2AEMA 5DRKA 2HMIB 3MFIA 3A12A 3KLGB 1UJ5A 3MM9A 1HFEL 1SV5B 5CYJA 3MM7B 4QW9A 3AA8A 2IVYA 2M52A 3Q86A 1PKUA 1JKHA 4J37A 3MR6A 3OV7A 4HVZA 3LGHA 4RW7B 3PDNA 3D3CJ 2LEAA 1DFDA 3CO9A 1Q95G 1OJ4A 2GGPB 4DWIA 1E6VB 3CCJS 2VPYB 1F3FA 4I68A 3PJ9A 1G4CA 3GU0A 3IC1A 4G6VB 3R7BB 3ISND 3MEGA 3VCDA 2KM8B 3MMJA 5LJ3Y 3OUYA 1HD0A 3LP0B 4OYOA 2W7AA 1S1WA 3TARA 3ILJA 1VQSA 4DR2J 1SBRA 5GAGU 4ZVSB 1FESA 5DM6Q 3ILIA 4BBYA 4DQSA 3PRDA 2QSWA 1PJ7A 1KVKA 3IGVA 3MI7X 1VLYA 2OAUA 1Q4RA 1LW0A 4RU9A 4IQMA 4DV4F 5KFRA 4UOGA 3AH6A 2FZGB 4IDKB 2KHDA 3UO0A 5B09A 2VF3A 1VLOA 2QLJB 4K5RA 2PI5A 2ATCB 3HO1A 1RB0A 2UVVA 1CC8A 4PWWA 1S72S 4LF9F 1NSAA 3POTA 3N5FA 3PIPQ 3PX6A 2XQCA 1I6JA 2CQ2A 3UVJA 4WU2A 2BDPA 2V2VA 3IN5A 1LWXA 3BN4A 2DCLA 4WWSA 1IBLJ 4OX7A 1H2VZ 3RBZA 3TANA 1XWLA 4R5PB 2YKQA 3FKBA 2ZJPQ 3GIKA 4FBTA 2KB2A 3PFOA 2HS0A 4DR7J 2GIFA 4F67A 4W4MA 2UUBJ 1RTJA 2GA7A 2R42A 5T41A 4DS4A 1YJ9S 5EWFA 2NXUA 4TQSA 1T02A 4DR5F 3VAFA 5KFEA 2YWFA 4ES3A 2M88A 1GEHA 2XMAA 1D9AA 3IRXB 1TUGB 1X0FA 2W9CA 1NSKL 1N52B 3SV3A 3CO0P 2HHXA 2L3MA 4GVBB 3TO8A 4DV1J 5DDRC 3WX8A 4KYZA 3S6EA 3DM2B 2XZWA 1KOHA 1WSRA 3PKMA 2GMHA 2O01C 3CULA 3B6BA 3GJSB 4CO0A 2QTWA 4DSFA 4ZVEA 4WTYA 1OQ6A 1K0TA 4ZPBA 3JSRA 1U02A 4QIVA 2DHAA 4CLZA 5HMZA 1S97A 2CPIA 3T5HA 3MAAB 2VODA 4P9SA 4FYVB 2W9AA 4OZ5A 3KJQB 1RT7B 3KG0A 5K8PA 3Q2SC 1MU2A 4DLEA 1QUVA 1RJJA 4RW4A 1JK9B 1YJNS 3I55S 2DNYA 4LSZB 3PEHA 3VHQA 1IBMJ 3WC0A 3K57A 1X5TA 4JV2A 2UP1A 5M2PA 5IT9U 2RS2A 4LFCF 1TELA 4GC6A 3CUNA 1HBMA 1FKAF 1I1GA 4N8NA 2JRSA 2ZJQQ 2A10A 5GAGI 4WPAA 2FYXA 1PAUB 4NOHA 3QSIA 3NAHA 4EGLA 5KFNA 3HHLB 5J1PA 2OLWA 1EETB 3HT3A 4I2PA 2DRAA 3ENVA 5J2MA 4C9DA 3A3NB 4K4ZA 2CQCA 1RLDA 1SJQA 1TL1B 2Z4PA 2V8VA 3QWUA 1U8SA 4ZP8A 1JB0C 1J5EF 2ZD1B 3QRRA 4KHPJ 3SIPB 4HI1A 3D0IE 4EZ6A 1FI4A 3FUYA 1S4EA 3SMZA 1TQLA 2XMTA 1ZH5A 4QWDA 3HVWA 2NQPA 1WF0A 2GZOA 2VKRA 4CWBA 2BRKA 4YOEA 3J81Y 4JYAJ 5T7LB 2NUHA 3CJ4A 3I0RB 4Y28C 1BMQB 3AXMA 3O44A 4C48A 1PO6A 2CQDA 3GP9A 2N4CA 3H2VE 4ZA1A 5E0OA 3ZZPA 2N82B 2EBEA 3C66A 4F36A 2Y8YA 2R4FA 4CT8A 2I0XA 4C11B 4IUFA 1O6XA 3JYTB 1HWLA 4HHHA 1FJ7A 4ZPDA 2J0SD 1Y4ZB 1YDLA 2VL1A 2G2ZA 4YFUA 2NXCA 3X1LB 1XNRF 1EKSA 1C4AA 4IG3B 1JLBA 2LQ8A 1K1QA 1CLFA 3SBMA 1LV5A 4DL0C 3J7YU 1R8CA 5IV4A 1YZ6A 1R89A 2B4UA 2DR5A 2Q79A 2XMKA 1EQMA 3I87A 4DMZA 4USVA 3KLEB 5IQ6A 3E51A 4ZHRA 1KKHA 2CUYA 4WP8A 4F7VA 1RT4B 4JP8A 4DR4F 1X9MA 2GHWA 1Q86T 3JSBA 3ENWA 4M5KA 4TNOA 1BGXT 3D6HB 4V1Ak 2PFFB 3WZ0A 5BYRA 3I4HX 4XPEA 3IG1A 1HHSA 2IBOA 4ECTA 4JI8F 4NCGB 3HHLD 3Q22A 5CA5A 2XGQA 4IOCQ 4L76A 1CPZA 2KT2A 1QTNB 5D4NA 3DDNA 2AHOB 5HROB 4B08A 3OVAA 3NS7B 3D28A 4X65F 2IFXA 4B9LA 1URNA 2ALYB 2MKHA 1J27A 4ZVPB 4ANDA 5AXLA 2W8LA 4DR1J 4DI6A 4NCAA 1FRIA 2QX0A 5DJBA 1QUPA 4OHXA 2F8EX 3DRXA 4J9MA 1WORA 4RBVA 1UZHA 2FDNA 4FYWB 1X4HA 4CLLA 1Y0HA 2O66A 2DNRA 4GO5X 5THWA 2OPQB 2CQIA 3M05A 3MTKA 1YBAA 3WX4A 4DV2J 1KLMB 1CQMA 1WEZA 1R6VA 2IRXA 1H0HB 4Q2MA 5M2RA 2YWEA 5G0RB 2YY3A 1SL2A 1K9MT 3OD2A 5AE1A 2W25A 4LSLB 2XCPA 2DY1A 2RVJA 5I3UB 1C1CA 2I8EA 1AUSL 3QRQA 1IKVB 3W3SA 4Y2MA 4QIGA 2QA2A 4K0KF 3UR0A 2PA3A 1HQ2A 1N36F 2DYAA 1GMVA 1YGYA 1WEYA 2EK1A 3CMES 2HQIA 2QN6B 2PA8D 4QR2A 1D1UA 4B9NA 3OVSA 5ETPA 1JJ4A 3VAKA 2QFIA 4OYPA 1H38A 3Q8SB 1YG0A 2IM0A 1YZ7A 1RCXB 5HATA 1VGYA 2LDIA 1X9SA 2HLUA 5EX0A 3D1OA 3QGHA 2BE9B 3KG1A 2VFRA 4LQ3A 3G8SA 2D9OA 4WCEQ 2CPEA 4FN5A 3NBPB 2AJ1A 5KFIA 2Q66A 4KH0B 5KFBA 5HK4A 4MIBA 1NJZA 4ETZA 4TVAB 4KTQA 3K2YA 1X4AA 2V8HA 3Q8VA 7FDRA 2CAJA 4LUBA 2QLFB 2JJ4D 1NHVA 2BOPA 4WFXA 2BEFA 2OPPA 2IM1A 2ZOFA 1PCAA 1T3OA 4UY85 3OBIA 5F3ZA 4PQUB 2KO1A 2DGVA 2I5JB 3THTA 4N8OA 3AD8C 2QEXS 1W25A 1QAXA 2DHXA 4AQYJ 1JLGA 3MPVA 1RA6A 4O0NA 3K5NA 2LXIA 2YQ1A 4B3RJ 2V2KA 5IT9Y 4ATNA 4WE1A 3GFXA 3CE8A 4USHA 2XWYA 1RWNB 1KFDA 2W2NP 4C2MA 3TUIC 4AYBD 1JJ2R 4DU8A 2VQEF 2HVHA 3C15B 5DZ6A 5H9EK 3V5RA 4DL2A 4F2RA 5I4MA 1VBKA 1CQNA 2RDIA 2ASYA 1IR1A 3IAS9 3CJQA 2OFGX 3OL6A 1F6TA 2RB7A 1KHWA 4UF4A 4NA3A 1VK8A 2C22A 4DV5F 3LQVA 3Q8QB 1HNWJ 3FSYA 1LW2B 1SC3B 2CDQA 4X4TA 1TKTB 1T9YA 5J2NA 4EO6A 5KFAA 3J80U 4F2SA 4EYHB 3L7UA 3BQ0A 3ITHA 1HNXJ 4I2QB 5A8RA 2PEHA 1CEZA 1R0AB 2MLXA 4AXIA 5CZXA 2M3DA 3M2VB 4BCAA 5HVHA 2ZH1A 4NCBA 5K8MA 2V69A 4KGXB 4JV0A 1P9YA 1Z2ZA 1DTTB 3GR1A 1RT6B 2YXLA 4ZVFA 2QLBB 2VC0A 2APOA 3NGRA 2GMLA 1HHTP 2BW7A 1U09A 1BE4A 1IBCB 4ECYA 1CJTB 1ZPWX 1FD8A 2R3VA 3NMAA 3DOMB 2E5HA 3M30A 4PKDB 2QJ3A 5AE2A 2CPHA 2AD9A 2WSCC 5KT4A 3L9ZA 4PWUA 2XO6A 1AZSB 1ZETA 2ILYA 3M1VA 3TI0A 1RKJA 1RBLA 4OI4A 2MLYA 4A8YA 1S77D 4DCOB 3BJYA 2JEJA 3D6TB 5FJ4A 1EP4A 4ZCMA 4DR2F 1AXQA 2D3O1 5FD1A 2XMUA 1UJ4A 4FVCA 4OZ2A 1REVA 4LR9A 3RTVA 1T7PA 4DV0J 4H4MB 1J5OA 1PSDA 2V50A 2KT3A 1O8BA 1CJUA 2W4PA 2DXFA 1QSLA 2BJ7A 3AODA 4I67A 2PO4A 1EARA 3OJSA 3QMQA 2X51A 3ZNUA 2C2DA 2R7QA 2LQBA 5RUBA 4OYIA 4ZP6A 2CG8A 1BQNB 2ZOGA 4RWXA 2KXNB 3NCQA 1L3UA 1TMMA 4I56A 2WVDA 5KFZA 1ZBTA 3PYDA 2ERRA 3MM5B 1U6BA 3F56A 5D78A 4HL9A 3VAGA 1RWUA 4YR2A 3CJSA 4EU0A 1IBLF 4F02A 3UCZP 3V81B 1ZZFA 3EYZA 2WK4A 4DR7F 2DNNA 2UUBF 2XEXA 1L3TA 4LRBA 2RKIA 1JLFB 1UP1A 5B0FA 5DQHA 3BQ2A 3CCVS 2J6TA 1RT3B 4IYQA 4AD6A 3EWGA 3CJKB 4KR0B 1LWFB 5L1KA 2HNYA 4DPXA 4MK9A 3C6TA 3VAIA 3P6YC 4YP3A 1MROA 2GAGC 2JFKA 5LL6d 3T41A 3ZTPA 3PR4A 3R7NB 3I0SB 2X1GA 4DV1F 3G86A 2GNKA 4P2XA 3QBCA 4B3MJ 1HIYA 3HHDA 3R8YA 1N6QA 1FE4A 1N32J 1FVQA 1VQ8S 3PG9A 4DQPA 4TN2A 3G6YA 2ZDPA 1GTHA 3DLEB 2CQBA 4KJIA 2QE5A 3I82A 4F4KA 3J7A1 2Y1IA 4B3OA 1KQKA 3LPYA 1TK5A 2EFNA 1IKYB 1LWCA 5KFJA 2MQPA 2OD6A 2AZ1A 5B0BA 1KBRA 4Z7YA 4U96A 3R5AA 1ZPVA 3FK4A 5B0EA 2C3UA 2K3IA 4ECXA 3CCUS 2C2OB 4ECVA 2JVRA 3D4JA 1U0HA 3M8SA 1IBMF 1Z2LA 1NUEA 3CDWA 4RL1A 1V5VA 3IRWP 3NMRA 4NLVA 2RUSA 1D3WA 3KJFB 3QFWA 5GADU 2D9PA 4YN3B 5C24A 1B0PA 2EG1A 4DF8A 4ED2A 2FJBB 1V3SA 1U8WA 1V3ZA 1VQ9S 3IR5B 1Y5IB 1XC9A 5DG8A 4ED3A 1HI8A 1S6OA 2JLEA 3UD5A 3DYAA 2FZCB 4NMLA 3V6HA 3J80Y 1WHYA 3JSMB 2B7CB 5B0CA 4ZDNA 3K5MA 4RX6A 4KHPF 2ZZNA 4Y6IA 4ZVUB 2KN4A 3K17A 3DRPA 1HARA 2V8GA 5KT2A 1X60A 2EVZA 2M70A 3HD1A 4R8UA 1UFWA 4ID5A 4CCHA 1L3SA 3ZXWA 5SUHA 2A1BA 4P7VA 1FJCA 2HHWA 1F2HA 4JYAF 5D77A 1UEUA 4MFBA 1TKZB 2W4CA 4TLRA 5L1IA 3UCGA 2R7RA 1DQ8A 2YWKA 1YJ7A 2Y0SD 2C2MB 3KNAA 2VD3A 2ACMA 4M94A 2O3DA 4XK8C 2EXUA 1WKLA 3SFUA 1Y9OA 2D74B 2B9XA 4J9PA 2DHHA 3DRRB 4ANEA 1ZA2B 3NGTA 1EIYB 3BGRA 4BWMA 1SJ1A 3PYFA 4X62J 1SCJB 2QV6A 1HBNA 2QC3A 2YWGA 3RB3A 2OD4A 4CYUB 2MZJA 5HLFB 2JSXA 2BE2B 5F8MA 5KFHA 4MJKA 5E41A 1NHKL 1U1LA 3HVTA 2YNIB 3VALA 3TVZA 3EGNA 4KQZA 3B82A 1VQYA 4CM2A 2XG8A 3ZZTA 4KO0A 3CJRA 3FCWA 2CJKA 2ZWOA 4GMKA 4DV3J 4JV1A 2HBZB 3BDPA 3VAHA 4UUXA 2IA0A 2VG6A 2AV5A 2OO4A 2V4RA 3FQKA 1M5HA 3DDKA 2V94A 3M8ZA 3BO2A 2HHQA 3RAQA 4IG0A 2X1FA 4QWAA 1P1TA 2MQOA 4DR1F 2GVDA 3GE9A 4Z2XA 5CCMA 2ZKUA 3WHIA 2YPZA 3AOBA 3K5LA 3LP2A 3MM6B 3IA0A 2KG1A 2K1RA 2XYHB 2ASLA 2FIUA 1JJHA 1T05A 2ATLA 4XPCA 1S49A 4MTPA 3ET6A 4RW8B 5GADI 1QM9A 1GX5A 3D3BJ 4LIRA 3CMAS 4DV2F 5D0HA 4H4OB 2WVCA 4LF5J 1HPZA 3PW0A 5FDLB 2VDIA 1R8HA 1OO0B 1JLAA 2VPZB 4A46A 2R7VA 2L9DA 2YQ0A 3HZGA 1H2TZ 3QT6A 4UW2A 1VHIA 1XR6A 4DV6J 2LQ9A 3FBEA 3V6KA 3K7RA 1RWWB 3QGIA 2Z2MA 2N3OA 1S7HA 2ZHOA 5MAOA 4H4OA 2GQCA 2RQMA 4R25A 5KFSA 3ULHA 1K8AT 3N6MA 1NJIT 4TU7A 2UUAJ 2LQJA 5KT6A 1FKPA 3OJUA 2PMHA 2H51B 1E6YB 4M5JA 5D4PA 1MMDA 2N3LA 4DX7A 5JVGQ 2HBQB 4RUBA 2UUCJ 1WI8A 5KFFA 1UVJA 2HBRB 2QZ8A 2XS7A 4Y65A 3HVAA 3UDLA 4XDCA 2JOQA 1NU4A 4RKUC 2VBYA 3GWCA 1S9GB 1SIWB 3BZQA 3GSIA 4PG4A 4J9UE 3N79A 3KNGA 4EEYA 2QRRA 2CG4A 3DXBA 3DXSX 3HSGA 4K59A 3TVYA 5CABA 2G0IA 2BJDA 1GMWA 1WDTA 4ES1A 4OJGA 5L38A 3DLKB 1DARA 4A4JA 3MEEB 5K8NA 1HBOB 2VU5A 2J0XA 2AQ4A 4AQYF 4C8OA 4K4YA 2R2RA 2Z0GA 1TL3A 1MWYA 2KYZA 2CQPA 2QIFA 2XMMA 4ZLLA 1RWMB 5LXYA 5EWGA 1SC6A 1SC1B 3Q23A 3MMBB 1NPPA 1KOOA 5EX3A 3KLIB 4X4NA 4F3OA 2R7WA 4KBIA 1HBUA 3FRYA 3FRZA 5D3GA 2XY7A 3TAPA 1LXJA 3PJWA 1FXRA 3OFHA 2D41A 4YDXA 5EHHA 3HJFA 2W9BB 2QA1A 4DSEA 1F5AA 2MEWA 5KFDA 3KWMA 4DUYJ 2HHVA 4QYZJ 1VISA 1S99A 2G2YA 1W7WA 4B9UA 1KONA 1CJVA 4LF8J 3G4SS 5F8JA 3LP1B 2VJVA 1SQGA 2D3ZA 5F8GA 3VV2B 1MNEA 2FB0A 1Q81T 2B51A 3KLIA 2AZ3A 1HNXF 4P71A 1UEKA 1O0PA 4K7QA 1PBUA 2MKKA 4FF1A 3EDRB 3PW7A 4ZPVR 4U8YA 3M9OB 1XMOJ 1FKOA 2KT5A 3GONA 2I38A 2PFDA 3BGOP 1S0VA 1NLKL 2EKNA 2HNDA 3O6QA 4LBHA 2ZJRQ 2UXDJ 3NG8A 1QDUB 4QWCA 3UE2A 4G65A 4XTTA 2DNLA 3IWXA 3VAMA 4DR3J 2UUWA 1SJ4P 5AXMA 1RDRA 2GO8A 4PXDA 5K8OA 4ZVGA 2ALZA 1HMVA 2RDDA 5K14A 4NLRA 2XMJA 4F4ZA 3LA0A 2ZH9A 4TKTA 4AL5A 2GO9A 5HI7A 4NRUA 2X7IA 2VOOA 1K73T 3L7OA 3KXDA 2EFPA 4NMXA 4N56A 1ZTTA 1UW4A 1XJWB 3KUGA 1IUJA 2ZITA 2W2QP 4ZOSA 3C6UB 4FPRA 1C0TB 2B6AA 1DLOA 1FO1A 5F9LA 3H5XA 2QG9B 1TKDA 4DQQA 1OY8A 3W8GA 4DG1A 2KDOA 5L1JA 4I0WA 4J9KA 3G6ES 1D9DA 3BGFA 3TYTA 2AYEA 2BABA 4XDDA 3KLVA 2POKA 2XNQA 3BSAA 1VC5A 1FWKA 5GVQA 4J9RA 3I31A 3W2VA 1GX6A 1U1RA 3R5GA 4F0HA 3PX4A 3HVRA 1RAJA 2B5JB 4KRWA 1HWUA 4MYTA 3PV8A 4P6QA 2XI2A 4DV0F 4U7CA 1VRQC 3W2WB 1C0TA 3U7JA 5A8KB 3LGMA 4LT6A 3M6WA 1TFYA 1S1TB 4ZCLA 2F3JA 3CC2S 3UCUP 4FF2A 2HQ3A 2YKAA 1IKXA 3GQCA 2HFVA 4ILMA 2L9NA 3OTOJ 1TAUA 2OIHA 4WBFA 3AQPA 5A6PA 1NK6A 2CWXA 1Q1KA 2IYGA 2MDAA 4ED7A 1NDKA 1S48A 3QWPA 2H3EB 2MSSA 1QAJA 3R5JB 2B5JA 1Y3KA 2CQGA 1JLCB 2CVIA 4OQJA 4B9SA 3KDOA 2EC0A 4E2FB 2B9EA 4NLUA 2A6MA 1WNEA 1Y10A 2WHOA 1C2PA 2E1RA 3W63A 1IKWA 1N5VA 4A8QA 1U26A 5D0EA 3VZHA 3CJ2A 1RTIB 5HAOA 1S57A 3O8WA 1HQUA 4OJ1A 2CVEA 5LOQA 3LPEA 4NRTA 4B3MF 2CNOB 3GG0A 1VC0A 2IRUA 3UDEA 1N32F 1N5QA 2DR7A 3MPUB 4F0KA 3MECB 2OMOA 1V6HA 1RT1A 5HO4A 2FGCA 2L9WA 4RR5A 2OJ3A 3BR8A 2NUUG 2W01A 1WD6A 5KOWA 3TZWA 4UY8T 4Y2IA 5J1EA 1GTEA 4ED1A 3PXGa 1HI0P 3OQ2A 2E5GA 4O44A 1NK8A 1HYSB 4W98A 1DRZA 1IWAA 1NK5A 1WWHA 2LU1A 2MZQA 1FEHA 3TZZA 4PYAA 4EBDA 3BQ1A 2DGSA 3W65A 2GV1A 1HLWA 2QMUB 4AL6A 3H2UB 1FXLA 3PO5A 3IBWA 4RW6B 4C8MA 1N5TA 5C7PA 1GXTA 4ZP7A 4JV5J 4KHRA 2V8PA 2NYHA 2HFZA 2XNRA 4CI0B 5L8RC 3M8QB 4B02A 4ZLNA 2AIRB 2CJAA 3GV8B 2R7TA 2CQ4A 5ITHA 3DNCA 3EXYA 3RJMB 5LSOA 1I3OB 2K7JA 3M2UB 5LT5A 2BM1A 1RUSA 3LW5C 4DQRA 3IXQA 4MK8A 2BOAA 4NLTA 1LKZA 1WOOA 1M1GA 2IVMA 4DDFA 3MDFA 3KHRA 1CJKB 2O5DA 1IR2A 2H5JB 4LQ9A 2EKYA 9ATCB 1U49A 3CCSS 3FEXB 1VRUB 3A3OB 1YLXA 3KK2A 2HIYA 3GCXP 3NS5A 2CQ0A 1QD1A 4DSKA 2DO4A 1N56A 4F3QA 1I51B 4O3OA 2MMYA 1F5CA 3FDSA 2VBWA 3HI9A 1UA0A 3H0PA 2BUNA 1RBAA 1N5YB 3GYGA 1UVLA 3VF0B 3TJAA 2PIIA 1XQIA 4I6AA 3RGIA 4Q2LA 1TL7A 3GJRB 4OL8A 1UWBA 2VOPA 2LEBA 1S9EB 4X62F 3PO4A 5EN1A 5H9FK 1FXDA 2AJ0A 1VBYA 4QPTA 4O3SA 1RAIB 2VV5A 3W9HA 3L7PA 4O4GB 3EZ5A 4K50A 1PAEX 3CJ3A 2NSBA 5D0GA 2KHCA 2IC3B 4NLGA 2WVBA 3MURP 4K4SA 2AJQA 1UA1A 3CWJA 3KOAA 2QA4S 4I1TA 5LXRA 1YITS 2DGOA 3BBCA 4FPIA 1RT2A 1KEKA 1BQXA 3FQLA 4CRJA 1HL6A 2DVIA 4PG7A 1V3RA 1WUUA 5HBMB 3TJ8A 1R27B 2DNHA 2PC6A 2QLWA 2KYXA 3D5MA 4OI1A 4RNOA 5E3CA 2UVUA 4UOHA 1M5KC 2Z2YB 3BB5A 3QIDA 3NLCA 4Y3CA 2HRYA 1RTDA 4Q0BA 3CJ5A 4HTJA 1QVGR 4U95A 2RQCA 3GSDA 2LMIA 3TQ1A 3D6MB 2EW9A 3GIJA 1RHUB 5AJ3J 2VC1A 4M5DA 1JNRB 1N0VC 2P9CA 2ABYA 1C0UB 2F4VJ 1KRPA 3G6VA 4LF5F 4LF4J 2J8SA 4WZMA 3CJ0A 1HNIA 3DMJB 4A8SA 2RJZA 4URGA 2H9ZA 3QO9B 4FXWA 4FYYB 2AGOA 4CTAA 1Q82T 5C25A 1AFIA 1MW7A 2J5AA 4BWJA 1FFSB 2R7XA 4DV6F 5J1NA 3H5UA 2V4JB 3CNQP 1IN0A 5A8WB 4OHYA 1WSVA 4FNIA 5K9FA 5GAEU 1A9NB 4ZN3A 3QATA 1X4EA 3N5BA 4PG5A 2Y8WA 1RADB 4JI4J 2C42A 3C19A 3OXGA 2MY8A 4X4OA 1TKXB 5I3QA 2UUAF 2NREA 1QVFR 2QLXA 2BX6A 2ROGA 4LR7A 3KK3A 1VJQA 2JFDA 3SXLA 2DNZA 1RYSA 2UUCF 4HACB 2ZKTA 2NYIA 3HCXA 2OPRA 3E01A 4NZ0A 1KQSR 4DX5A 4ICLA 4QU6A 2G0JA 3VVUA 4ELVA 4NE9C 5IWAF 5EDWA 4RNFA 2XS2A 2CXEA 1NH8A 3PNIA 5E2QA 2AGPA 1JQGA 1U6ZA 4K4TA 3MR2A 4X4SA 3ZFVA 3NGKA 4DUZJ 2JZ5A 2OP5A 5E3PA 2R8GA 4HH0A 1WC5A 5CQGA 3KLHA 3BKTA 2R2UA 3I9V9 2MQ8A 2NXNA 3CXCR 3J81j 2P9GA 2HAFA 1NK9A 2ZBQA 2PI4A 3JTNA 1DTQB 1AB8A 4DPTA 3HX9A 4J9QA 4JBCA 3BBBA 2GFFA 1FX4A 4KV8B 3SQGB 4ES2A 2FLNA 4K4WA 1SUQA 1T03A 4WXWA 4Q45A 3HHNB 1NH7A 3ZZUA 1HKAA 3KK1B 5EGYA 3K8VA 3G71S 3FNNA 1KWMA 5DGBA 5KG2A 2MZSA 4RO0A 4Z37A 2PMZD 3E8OA 2Z30B 4PWDA 2OTLS 2VIHA 3FEYB 3MEKA 4L72B 4LF8F 3PRVA 5T14A 2KFNA 4KV8A 2YNGA 2BYCA 2RH3A 4MAKA 1RI7A 2NLWA 1FJGJ 3AOCA 1EB0A 2OPSB 3ELHA 4XO0A 2CPXA 3AJDA 1S6QA 3LH2S 5IC6B 2WB4A 3HFKA 3J7Z5 4O3RA 5KT7A 1TZ0A 2FVRA 1W2IA 2Q43A 2F40A 1TP7A 2KZMA 5AXKA 3VGUA 5GAEI 5KT3A 2UXDF 4ZIVA 2YKMB 4OYMA 4ZIWA 3KLFA 3IM8A 1RT5A 3W5YA 5J2QA 1CULA 2QSFA 4WKRA 1RAFB 4RLEA 1S6PA 1Q5VA 1GT8A 1A0OB 5B0DA 1QAYA 3PIOQ 3KMSA 2RQ4A 3US5A 4RUHA 4M5MA 2MGZA 5CYQA 1HHQA 2IAJA 4WFZA 1YJTA 2NSCA 1YX2A 1Q16B 2OSRA 4KFBB 4LIWA 3UD3P 4ETXA 1X4FA 2KFZA 4P7TA 3M2RB 3TAQA 3I5CA 2QL5B 2B7BB 1CS4A 5F8HA 2BRLA 3DCAA 3KFWX 3RU0A 4DL3A 5HP1A 4KKOA 1WC1A 2YKNA 1QAIA 1HNZJ 1OIAA 5KFWA 4IRDA 2VQEJ 1FNXH 2VG7A 5F3TA 3MTJA 3M6UA 5IM0B 3LWLA 4FXDA 2R7OA 3W9IA 3DLGB 3M8WA 2J7UA 4W92B 4AL7A 3UW1A 2ILZA 1VC6A 2I9SA 5ETNA 4YR3A 2VFVA 4C3KA 2VASA 2FLLA 3H2LA 2F8MA 3G8TA 2DR6A 2BJ8A 1WI6A 3SDEA 2OEJA 3MCSA 1NSQA 3NGSA 4PUOB 1QE1B 3P49B 2YPYA 1PC4A 4NXNJ 2RD5C 1N0UA 2CYYA 3HLUA 2HWIA 3GFYA 1LWEA 1TR0A 3B78A 2Z56B 2DPIA 1M5VC 2AJ2A 3DRSA 3HXMA 4NI2A 1RKIA 3VZIA 4QIWD 2EFVA 2KG0A 1Z1ZA 1CSJA 4QYRA 3H5SA 2R8JA 4HEA9 2U2FA 3UI3A 1ZAVA 2FHJD 2WOMB 1FDDA 2YNFB 3TRGA 1UFKA 5EWEA 1ZA1B 4ECSA 5CAAA 2BBEA 1YK9A 4JI3J 3UPFA 3MZIA 1S1UA 1RWPB 2NPIA 5ETKA 2M0GB 3QLHB 4CH0S 1VRTB 4M8LA 4ECZA 3W64A 2JC0A 3PYGA 3OT9A 2YKOA 2YKPA 1HWKA 4ZLJA 1WKJA 3TX8A 2W2OP 4L75A 4RNMA 1REGX 4P2SA 2HNZB 2WSFC 2DR8A 4OYWA 1S1VA 2V9WA 1VJWA 3KG4A 4HT7A 4WP3A 3QPIA 5KFVA 3V4IB 3FJ2A 2HMIA 1JXEA 1VMBA 3EX7B 1S1XB 2J9DE 3ZNJ1 3KLGA 3IR6B 4BC9A 1H6KX 1SV5A 3P3DA 3TWZA 3MM7A 3J7AN 3OSNA 2ROEA 1CG2A 1XEZA 1U1NA 4X4UA 3PKYA 5E3QA 2FJEB 1NB2A 3MCMA 3T1YJ 2P6TA 1TV6B 4RW7A 3NGDA 1WC4A 2FGOA 4TY8B 2GGPA 1E6VA 4NWBA 2P6SA 4I69A 3M32B 4P75A 3T6JA 2BACA 2KXHA 1SKRA 2AYMA 3KJVB 1NMEB 4JV5F 3LP0A 2GQQA 2E5LJ 3ZC4A 1ZM2A 2Z57B 4FNHA 2QGFB 4UZBA 3AFGA 2MQNA 2E9ZA 2HW3A 3VQTA 4EK2A 2RUGA 2M5YA 3FBBA 5BR8F 2PD1A 4ZP9A 4FDFA 3HD2A 4IDKA 4KIAA 3MR7A 4WFYA 2I6WA 4N76A 4K5SA 5IQQA 3I56S 4ZPCA 3MPWA 3EE3A 1ZAWA 3FFIB 3P5BP 4E98A 2B43A 2CPYA 2GMJA 3LAKA 2C1EB 3BKFA 3T9ZA 4BS2A 2OTJS 4IFVB 3F44A 1KLNA 1RSCA 3JAMU 3HT0A 4F3MA 2YWHA 2DH7A 3BF4A 4QBUA 3W60A 1FRXA 2J9EA 2CFXA 3TA0A 3EDQB 2CPFA 1N8RT 1MN9A 1NHUA 4R5PA 3IFEA 4URSA 2F9DA 4E0DA 2MQQA 3PYEA 1FFWB 1KTVA 3JQMA 1LQ9A 2H5EA 2YH0A 3QZ8A 1FD2A 1KVIA 3SFGA 2FHKA 5KFXA 3OL8A 3IRXA 3TVKA 3R5CA 2VA2A 2F65A 1VHFA 3BM7A 3SCJE 4DHVA 4PYDA 4WFNQ 4J9SA 1WHVA 3OFFA 2ZZTA 4GVBA 3CCWA 2O67A 2B9WA 5IS2A 4DEZA 1QSYA 2F9JA
chains in the Genus database with same CATH topology
3HK2A 3LP2A 2CPJA 1JLCA 1J2VA 4DL7A 3M1VB 3MM6B 3QAUA 3IA0A 1U45A 5CCLA 2KG1A 2K1RA 2ASLA 3DM2A 2IYIA 4U6PA 2FIUA 1JJHA 1JIHA 3DI6A 1F0XA 1T05A 1U48A 1BQMB 3KLFB 2E7XA 2C3MA 3T9NA 2ATLA 4XPCA 1RT5B 1N4LA 1S49A 4H4KC 4MTPA 3JSYA 5J2QB 3AJ2A 2YNHB 4RW8B 2XMWA 5GADI 2J9DA 3L95X 4ED6A 3KTQA 1QM9A 1GX5A 3BSOA 3TP2A 5BYSA 3AB4B 4LIRA 3CMAS 1S6PB 4DV2F 4NLOA 3QJJA 4H4OB 1Q8LA 1O51A 3MF5A 5HL7Q 3MFHA 5A0YA 1EP4B 1YJRA 4PXBA 5FIIA 5F0UA 2MGZB 1HPZA 1P9QC 2YX1A 4ED0A 3PW0A 4G1QB 4ZPTR 1N88A 1XMOF 2M7SA 5CYQB 1RTIA 5FDLB 1DURA 4HDHA 1R8HA 1OO0B 1JLAA 3H59A 2VPZB 3SCIE 2RIJA 4A46A 1X4CA 1AFJA 2R7VA 2IAJB 3N28A 3IO1A 2NS1B 3IWNC 2UU9F 1REVB 2L9DA 5H9FJ 3UWTA 2ZM6F 4YB7A 3HZGA 1H2TZ 1YJUA 3CDUA 1SJFA 1UJ6A 2V4QA 3T1AA 4QIFA 1J5OB 1RT7A 4UW2A 2QT7A 3Q0AA 1XR6A 3MUVP 2LQ9A 2E9RX 4IFYA 2DRBA 2V8DA 4WYWA 4J9LA 3QAEA 3V6KA 3MECA 2FHOB 3K7RA 4TLQA 2MY7A 5AJ3F 5DQIA 3H4BA 3H98A 3PW5A 3QGIA 3OHBA 2E44A 2Z2MA 1HQEB 2F1FA 1WF1A 2N3OA 2YNHA 1S7HA 1L3KA 2KRRA 3AHPA 3I96A 3K5PA 4NYOA 4CT9A 4DR3F 1ZTWA 3FVYA 4JI2F 2ZHOA 4NYPA 5MAOA 5HP1B 4KKOB 2ADCA 4U7UK 2YKNB 4H4OA 2GQCA 2R8KA 1XN9A 2RQMA 4JI0F 4R25A 1KN6A 4TYAA 3LO3A 5KFSA 3ULHA 2F4VF 2IMWP 2MHEA 4EBEA 3IGNA 1K8AT 4IO1A 3N6MA 1RGVA 1NJIT 4K4VA 4LF4F 2VH7A 3QYYA 2MYFA 4FBUA 4TU7A 2LQJA 2PDAA 5KT6A 1D8YA 2ZE2B 3EPIA 2VG7B 1TK8A 1FKPA 3OJUA 1Q8BA 2PMHA 1TFWA 3M6XA 3MEDB 1E6YB 5B0GA 3DN9A 4KGKA 2R9LA 4Y2AA 5D4PA 2A3JA 1MMDA 4RWWA 2ZC3A 2N3LA 2CJBA 1FK9B 1KQFB 3HHLA 4G3IA 3Q8PB 4UQGA 4RNHA 5JVGQ 1UL3A 3E2EA 3LGNA 2HHHF 3GIMA 5DG9A 1DBDA 1HYSA 2LVWA 1EETA 4X4VA 1WI8A 5KFFA 2VFSA 2EWHA 2XCAA 1UVJA 1FRKA 2QZ8A 2U1AA 4ECRA 2XS7A 4Y65A 3HVAA 3SZ2A 3UDLA 3O5TB 3G6XA 2PGCA 1X5SA 4XDCA 4EO8A 2MZ1A 2K8GA 3QZ7A 3H20A 3N6NA 3ZZRA 1TK0A 2WRMA 1GNKA 2RKIB 2J7WA 2B9YA 2JOQA 2XS5A 4KSEB 1NU4A 4XAKA 1Q7LB 2JEGA 4V19X 4AE5A 1TL1A 4RKUC 2VBYA 2BR0A 4A8MP 3EPGA 4N41A 1HA1A 3GWCA 4WU3A 1S9GB 2ZD1A 2ZH3A 1SIWB 4DOZA 1SB6A