1IL0A

X-ray crystal structure of the e170q mutant of human l-3-hydroxyacyl-coa dehydrogenase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
291
structure length
291
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVQVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glutamate 170 of human l-3-hydroxyacyl-CoA dehydrogenase is required for proper orientation of the catalytic histidine and structural integrity of the enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 3-hydroxyacyl-CoA dehydrogenase
total genus 118
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1il0A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1il0A01
3HSKA 3FBGA 4YR9A 2HCTA 2EGHA 2NUAA 1GQYA 4YT5A 1NWCA 1MG5A 3LSYA 1PJ4A 1SNYA 1O8CA 1VL8A 1YOVB 3P7MA 5KVVA 1E3LA 1P1FA 2PGJA 2WDZA 5JW6A 1YBAA 3BTUA 1Z6ZA 5TT0A 3C7CB 2FMUA 1PZFA 4UUOA 1W4ZA 3H9UA 1IB6A 5CDTA 3A28A 1UDAA 3BHIA 2RCYA 3C1TA 1X13A 2W8ZA 3U4IA 1UP7A 5C5IA 4DYDA 3R1IA 4YTEA 5DBFA 3WIEA 4CMIB 4TKLA 5TQVA 3GNTA 1ZNQO 1ZUD1 4W82A 3Q9UA 4B8ZA 2FZEA 4PLWA 3TQHA 2CF5A 2Y0DA 3FTPA 4R69A 3JV7A 1PQPA 3GT0A 2Q50A 1KVTA 2O48X 1F17A 1ZO8A 2VCYA 3ABIA 3DZBA 4CR8A 5F3RA 3Q9NA 1PIWA 1LRLA 1YDWA 1E5QA 3DAPA 4E4YA 3I52A 2P9GA 3Q6IA 3ZI0A 4L76A 4NU5A 4KWIA 3TZQA 3NDRA 3RC1A 4Q9NA 3QP9A 1LBEA 1RM5A 2AEMA 1E1NA 5K6AC 3PEFA 3TZCA 5I7SA 4EEZA 2JCVA 3D3EA 2HJRA 3RWBA 3AFMA 4JK3A 2A35A 1Y8QB 1O89A 3BTVA 1D1SA 3JD4A 4NG5A 2J5RA 3JQGB 3GZNA 4BKPA 1GY8A 4QXMA 3TWOA 4NBVA 2YUTA 4FC7A 1DIBA 1F8GA 5JLAA 1HSZA 2GR9A 2ZB4A 4IZIA 3UH1A 4XQGA 4LRTB 3HDJA 2ZYAA 4AJHA 2IYPA 2VZ8A 3NEPX 5B4TA 2IEDA 3PQEA 1Y6JA 2JFFA 4G5HA 4BQRA 1ORRA 1ULUA 4CPDA 4EUFA 2E48A 3UOGA 4YAGA 3U5TA 5I9NA 4AFNA 4AJ1A 3DBLB 3CE6A 4HFRA 3I9NA 1A72A 2X5OA 3CH6A 2EKPA 1B8PA 2J5QA 4MP6A 3R0IA 4ZVVA 3RD5A 3I9MA 2X0RA 1SOVA 1Y9AA 2UAGA 2YYYA 3TL2A 1LLCA 3AOEA 4ND5A 5I8WA 1B14A 2FRDA 3D1LA 1XIVA 6ADHA 1T25A 3WGZA 3GDOA 3LC7O 5TS3A 2FPIA 2HDHA 2FHSA 2Y1EA 2BGKA 4NI5A 5F21A 2X4GA 4BNJA 1XA0A 1C1XB 1AXEA 3ZNOA 2NNLD 2GGSA 1AN9A 2RIRA 1U7TA 4K6CA 3ZGYA 2X6TA 4TWRA 1U8XX 2VUUA 4IINA 4E2YA 4BMSA 1ZKMA 1A5ZA 2FSVA 2BF7A 1IPEA 3DO5A 1PS9A 1B8VA 2EXXA 3WTCA 4RPKA 2C2XA 5BSGA 1X0XA 4D42A 1H9AA 4JNKA 4QFCA 1BTOA 2HAEA 4BL5A 3E9NA 1KVRA 1HDOA 1I01A 3AUUA 3IS3A 3GAFA 5C37A 3BMOB 1EBFA 4UULA 4XZ3A 3GHHA 2DQ4A 1RWBA 2QIOA 5DT9A 4P8RA 4BUCA 5JBIA 1YVEI 3D4NA 2JFHA 5CPFA 1GPDG 2JL1A 3M1LA 2X9VA 4HFNA 5AXAA 1N9GB 3GFBA 4R9RA 2W2LA 4D7AA 4KQWA 3L0DA 4BVAA 1ZSVA 1HZZA 2YQ4A 3HDQA 3GUCA 5U1PA 2HMSA 1DB3A 3MJ4A 3U4DA 4DBVO 2B4TO 3HN7A 3MJSA 1X7GA 3JQAB 2PZLA 3OICA 4NBTA 4UVDA 5TX7A 3E8XA 4BGIA 2CVQA 2ZK7A 1T2CA 4WGGA 5G0UA 5G4KA 3PJDA 2Q1WA 3I1JA 1OOEA 2PA3A 5A03A 3OQ6A 1ADBA 3GF4A 2J3JA 4BKQA 1DSSG 2NU8A 2Q1UA 1ZK4A 3CEAA 3JQ8A 1U2DA 3WGTA 1ZH8A 3MJVA 3WNQA 4J2OA 3D4OA 3Q2IA 4CM9A 4M54A 1ENZA 2PZJA 4RVDA 1ARZA 3DHYA 4DL9A 4J4BA 1ISIA 2XOXA 4OXNA 3V1YA 2NVUA 1YDEA 1XWFA 3ITKA 1PJCA 1XELA 4C4OA 1BHSA 2C59A 3S2EA 3E03A 4D41A 1BGVA 3SXPA 3VPSA 4AJKA 5GZ3A 2X23A 4M1QA 2OHXA 3OEYA 1GTMA 3ZWWA 1Z74A 3AK4A 4IDBA 5B4UA 2EGGA 1RYEA 1OC2A 4MVJI 1C1DA 4UVEA 1QP8A 2BGLA 1J5PA 3PYMA 4PG6A 4CMIA 5JXWA 3UFXA 2HMWA 1G0OA 4B3IA 3JQ7B 3K92A 1IUKA 4I1IA 4KWHA 3SC4A 2VNAA 1H94A 1H0KA 3C7DB 4JXKA 1BWSA 2EERA 1QYVA 1C0LA 9LDBA 4E32A 1GUYA 1VKNA 1P9LA 2ZQZA 3MEQA 4GX0A 1EFKA 4JBHA 3HN2A 3DZJA 4F3YA 5TF4A 4J9UE 4LMRA 2VYVA 1YKFA 3RC2A 3BMCB 1N8KA 2Y1FA 3IP3A 1QYWA 2R2GA 1GEGA 2NTJA 3EC7A 4D3FA 4Z6KA 1YB5A 2P4HX 4GGPA 1O0SA 1E7RA 1YL5A 3W4IA 2OP0A 2QRJA 5G4LA 4N54A 4YQZA 3WJ7A 1ZBQA 3DBHB 3KEOA 1F06A 3K9QO 2ET6A 3UUWA 2V6FA 2BLLA 1T24A 5G0TA 3OMLA 4FR5A 3N58A 2Q2QA 4IQGA 4R1SA 1KEWA 5JCJD 4EJMA 1DFGA 2Q3EA 2AQKA 1NASA 1YH3A 3L9WA 1P31A 2EP7A 3VH3A 2JFGA 4DUPA 1A9ZA 3KLPX 1I33A 4UVIA 1T4BA 4HNHA 4FB5A 4AJ2A 4DPLA 1ONOA 1JAXA 4I5DA 4UVHA 3V2HA 4F6CA 1FF9A 3M1AA 3E48A 4WCFA 1P45A 2W4QA 1TXGA 4X54A 3FNHA 1A4IA 2B36A 3WSVA 4K1LA 3BMQB 3JTMA 2Z1MA 2GN4A 3DB2A 2QYTA 4G65A 4O5OA 3M2TA 4M86A 4CLOB 3RJ5A 4WKGA 1WXDA 1NVMB 4IBOA 3TZKA 1L7DA 4NMHA 4OH1A 3T7EA 5KVSA 3WLEA 2LDXA 3JQ8B 1XR3A 3NGXA 4ID9A 4RZHA 1SCUA 3PHJA 5THQA 1MV8A 4DMLA 2IEBA 3IOYA 3GC6A 3VZPA 4J9VA 2NSDA 3O38A 3TZHA 4FFOA 3AUSA 4MVJF 4H16A 3AOGA 2D5AA 2OFPA 2O7QA 1UXIA 1HXHA 3PIDA 1CETA 2VUTA 5A06A 2NU6A 4BS9A 5KCZA 4P38A 4E5MA 3KV3O 1R4NA 4F45A 1AHHA 4I5EA 5I7VA 1PS0A 4MKRA 3SJ7A 1NQTA 3E9MA 4A2CA 4XGNA 9LDTA 1PX0A 4UEKA 3RASA 2OXIA 1LC3A 4FW8A 4Q39A 3PZBA 4J16A 2Y66A 2QZZA 3MWEB 1ZK3A 3QWAA 4KDFA 4XKJA 5F1KA 1UAGA 4DTIA 2NWQA 3C1AA 4JIGA 3C7AA 4NNJA 4XB2A 3RC7A 3S55A 3BAZA 4CLDA 5LCXA 4OGWA 1DAPA 4PVDA 1IPFA 3EUWA 3L6DA 1XYGA 4LN1A 3VVBA 2DAPA 3KVOA 5CHEA 1XKQA 4YAIA 3UCXA 2W90A 3IMFA 4YJHB 3NGLA 1E3JA 4OJNA 3EY4A 3RBZA 4CM5A 3D0OA 3VDQA 3HQ4O 3QRWA 4NHEA 3DBVO 5K6AA 3F3SA 1SB9A 2RBEA 3GZNB 4WOKA 1ZZEA 3WJAA 2BHLA 5JY1A 1I36A 2DM6A 1DRWA 2VRCD 1Y8QA 3LT2A 3CINA 2AW5A 3ANLA 3GNSA 3WGQA 4DYVA 2EIHA 1UR5A 1A4UA 4GPD1 3WICA 3MWDB 1IYZA 2LDBA 4GMFA 4KQXA 2Q1TA 3JYLA 1G1AA 1E6EA 1P3DA 2HK7A 3COSA 1NPDA 3CIFA 4XJTA 5G0WA 2WTBA 3GGPA 1HEUA 3ZV6A 4TZKA 5JC1A 1HYGA 1I2BA 3SVTA 1R66A 2I66A 4ZJUA 1RKXA 4E6PA 3GVHA 5GZ6A 3OJOA 5IZCC 3GVPA 4BO6A 2BELA 3LT4A 1EE2A 4BO2A 1Y7TA 4A27A 1YBVA 1YJ8A 5TSDA 1V6AA 1Y9EA 4C7KA 1CQIA 2G1UA 5IAAA 4D79A 5EERA 5KTKA 1YBMA 4GL4A 2P91A 3FRJA 5DCYA 2NU7A 3OA2A 4WK6A 3CPSA 3ZHYA 2BFOA 5JDCA 4HADA 3OIGA 1HDYA 2E82A 3JQGA 3TSCA 4CMEC 2R00C 3BMNA 4AJJA 3L4BC 2QQ5A 2E4AA 1PJ2A 2JHFA 1A7AA 5DN9A 2G5CA 1GU7A 4O63O 5G2OA 4XGKA 3QY9A 2Q2WA 1DC3A 4RCVA 3GHYA 5JC8A 4BNIA 1VL6A 4UUPA 1HE2A 2AQIA 4BO0A 4PCVA 1KETA 2Y0CA 4TRNA 4A10A 1DIAA 1SPXA 3DTTA 2XPCA 3X2EA 1N1EA 5F5NA 3D64A 1WMBA 2YV3A 4RLSA 1NAHA 3C3XA 3LT1A 4KDEA 1HDZA 2UV8A 2PD4A 2QHXA 3VPHA 2I3AA 1GUFA 3D4PA 4AL4A 2OMEA 3SLGA 3PDJA 4PZEA 1Y8RB 2PK3A 4QO8A 5AYVA 4ILKA 2JKVA 3UCFA 3VHRA 1DIHA 1N5DA 3H5NA 3H9GA 4PRLA 1KC1A 3RUHA 4P22A 1X15A 1PJBA 2O3UA 4L74A 1ISHA 1FDTA 4LMPA 2YQ5A 3PFWO 3D3WA 3O8QB 4PRKA 2Q45A 2GO1A 3NDJA 3VAZA 4GAEA 4WLFA 2DT5A 4PIVA 1K89A 3AI2A 4BNFA 2PR2A 3DZKA 1YO6A 3L4SO 4ZD6A 4GWKA 4CLEA 3L07A 3ORFA 2DPHA 1C3VA 4CMHA 3UVEA 1X0VA 2ILTA 1NM5A 1LX6A 4WLEA 3RC9A 4A26A 5I7EA 2PKRA 4E5NA 1E77A 4W7IA 1MC5A 5A5FA 1VSUA 4NBRA 4DQUA 1UP6A 1U3WA 4GWGA 3F46A 2H6EA 3L4BA 3O4RA 3QSGA 1B2LA 1QXSA 4Z0PA 1ADFA 3LDHA 4YT4A 1QORA 4Y6RA 1HSOA 1PEDA 4YPOA 4OM8A 3GGOA 2VNSA 3GVCA 3ROKA 4N5NA 2O4UX 3DQPA 4U8GA 3S2IA 4Y9DA 2Q4EA 4B4VA 1M2WA 1R4MA 3AWDA 3BTOA 3C1OA 2XAAA 3JQFC 5JO0A 5JFOA 3ONEA 4MVJP 1ML3A 1UAYA 4PG7A 3K8ZA 3GRPA 4TRJA 3WGGA 4BV8A 2FPPA 1KEUA 1EDZA 1N92A 4RVUA 1DPGA 1HLDA 3VOSA 3PLNA 3WTBA 4E13A 4DQVA 2YHUA 5L4SA 3JCZA 3VZSA 1BXGA 4U6SA 4GGOA 2FSSA 2VZ0A 2VTDA 4RF5A 3L6OO 3OM9A 4BKRA 3OA0A 5L45A 1Y8RA 2IZZA 4L8VA 5FF9A 3WFJA 4MINA 4CR6A 4MIOA 3LLSA 4XRRA 4CMCA 2QRKA 4FJ2A 4IPTA 5IF3A 3PDUA 2I6TA 4J0FA 3RBVA 2C0CA 4RVGA 5L95A 2PY6A 5BR7A 3WG9A 3UF0A 1ZJYA 1LSJA 2IRWA 4BNGA 5BSFA 4WCDA 5ICMA 5HA5A 2DKNA 3GA0A 5JCXA 3L9XA 1H2HA 2WEKA 1YE3A 1YWGO 4NDNE 3WLFA 1FDSA 2D1YA 1SZJG 1Q1NA 3H9JA 4ZU3A 3BMNB 3JQBA 1XG5A 3F4BA 1HRDA 4R16A 4PG8A 2HK8A 5JSFA 3WYCA 4RQUA 3WWZA 3JD3A 3G17A 3RUCA 5MDHA 3VH2A 5JAMA 2J3IA 4IQ0A 4BB6A 4FJ0A 1GQQA 2NTNA 1GAEO 1GEEA 1HTBA 3GH3A 1PGNA 2VRCA 5ENVA 5ITWA 1R0KA 5I8ZA 3BHMA 3ONDA 4Q3DA 1RM3A 3HZZA 4XQEA 1HE3A 2GLXA 3QQPA 4BO5A 3G1TA 4GQAA 4P4LA 3TOXA 4RJTA 5COQA 1BXKA 4AJIA 5EPOA 3K30A 4J43A 3PHHA 3AM4A 2IYOA 4RF4A 3KYBA 1HT0A 2DBQA 2FOIA 4GKBA 3OBBA 4KMSA 4IM7A 4TQGA 5TT1A 4B3JA 4CQLB 1OC4A 5HWSA 3CZRA 3S8MA 4DC0A 4I5GA 2FZWA 4LRSB 3V2GA 2BGMA 1I32A 5A5EA 3A06A 4N5MA 5AXCA 4Y67A 1GD1O 2EP5A 4OXYA 1GCOA 3IKVA 1UZNA 4BIIA 3LYLA 1GZ4A 4PLGA 1GZ6A 4CUJA 1U1IA 4DA9A 3RIHA 1R37A 1M66A 3RQSA 1TVEA 3PPIA 1IE3A 2O4CA 3NTQA 3VH4A 3NTOA 5JE8A 1PL8A 3JQ6A 1ZXLA 4BMVA 1I10A 2FWMX 4O6VA 5FI5A 2WD7B 3ZNPA 3T7CA 3WGOA 1K6IA 4JBIA 4II3A 5HTOA 4P4NA 1SEVA 3FTNA 1C0PA 1KC3A 3FF4A 2VYNA 4KOAA 1U8FO 5BNFA 3KSUA 2DBZA 1KVQA 4Y8VA 5CG1A 2Z5LA 3OJ0A 4MKZA 5JDIA 3LK7A 3CTMA 4J3FA 5CG2A 1YXMA 2C82A 1U4OA 1B0AA 3B20A 1MFZA 2GF2A 4R01A 2EG9A 1VI2A 3VTFA 4DXHA 1P77A 5EQFA 3I9LA 4CMKA 1E3EA 2BMAA 2EV9A 4RGBA 4OXKA 4U5QA 2IE0A 4J7XA 2DPGA 4XQ9A 5L7TA 2YW9A 2F1KA 1LLQA 1NFRA 3IIEA 1AUPA 4FD3A 1DEHA 3G49A 4S1VA 3AM5A 4FFMA 3GEMA 1TT5B 3KLMX 5THKA 3V8BA 1AE1A 4ZGWA 1LLUA 2IZ1A 2G17A 3OETA 3UGKA 4RPHA 4UUNA 1PL6A 3DOCA 4B4UA 3WQQA 1NR7A 3INTA 8ADHA 4J1SA 1LSOA 1WNTA 2DU8A 4QT0A 3KOUA 2QX7A 3MJEA 1PU2A 3DZGA 3FNGA 1VKOA 4R68A 1JTVA 4KTVE 4LSMA 2B5WA 2DTEA 4XB1A 4FGSA 4IGEA 4GX2A 3HJAA 3V1TC 4YT8A 5COAA 1FXSA 5DOVA 1EUCA 4WEOA 2VHVA 4XA8A 2YDXA 4E2WA 1R4NB 3VDRA 5F1PA 2HRZA 3HFSA 4Z9YA 5BNTA 4E12A 1DIRA 5ICSA 2EHDA 1VPDA 1B16A 2BFMA 3GG2A 3KRTA 2CF6A 4OOEA 3F5SA 4ZQFA 1J6UA 1LSSA 1SO8A 4Z0TA 2PGDA 4PGFA 4ZQEA 1LDGA 5A3VA 4CM4B 3UICA 4CLRB 2Y0EA 3RUDA 1B15A 5T8KA 1KYQA 2FR0A 2VQ3A 3JD1A 4PLTA 3ASVA 3G1UA 1SBYA 4HX5A 5AVOA 1E6UA 3I6IA 4MO2A 4BV9A 1LC0A 1V3UA 2XXBA 4BNHA 3ZZNA 1ONPA 3U49A 1PJQA 3AW9A 3GUYA 3VPGA 2HMUA 1C0KA 1NWHA 2GNAA 1HDXA 2QG4A 4YAJA 5DZSA 4A5OA 3OHSX 3MJCA 4RZIA 2D8AA 4KUGA 4TZTA 4AJLA 5A02A 4CUZA 2I67A 5H81A 3OECA 4RQTA 1CJCA 1DJQA 1LQUA 1N2SA 3CSDA 3H9EO 4BO8A 1E6WA 4F46A 1WAMA 3W8EA 1WZEA 2EW2A 3GRKA 3FPCA 1MG0A 2HMVA 1JDJA 3C85A 2AG5A 3Q2KA 4R4JA 3V1UA 1U7HA 3UAGA 4B8WA 3ZWMA 1T4DA 3QJ5A 4YRDA 3QWBA 1LXCA 1GFSA 2C5AA 2B37A 3WBFA 4IJWA 1CRWG 3PVZA 3EDMA 1C14A 4MVJG 3AUTA 2ZB8A 2WYVA 5C7LO 1NHWA 3DL2A 1OFGA 4CQMB 2P5UA 5CDYA 3WQSB 1KERA 3ZN2A 1ZCJA 3KHUA 4BO7A 4II2A 4PLYA 2AQ8A 4GI2A 4ESOA 1ENPA 4ALNA 4E5PA 2GASA 1ZW1A 5JCJA 2NM0A 4BNMA 3NT4A 1SMKA 3QHAA 2DBRA 4BO9A 5ER6A 3E9QA 3PGJA 2WD8A 3ZU5A 4B4WA 3IC5A 1Q7BA 4IDEA 3KYDB 4L73A 4M49A 1ZEJA 4OIMA 1P0FA 1Y1PA 1YQGA 4R5MA 4J91A 1IZ9A 2AQHA 2B0JA 4CM8A 2ZJ0A 1P1KA 5FYDA 1UDBA 3KBOA 1F12A 2NADA 1Z82A 2VYVD 3EGOA 1UXJA 4JX8A 1ADCA 1B26A 1EQ2A 3OH8A 4TSKA 1KS9A 3KYCA 4NPCA 5I7FA 4GSLA 3ANMA 2EKLA 2OUIA 2V7PA 3I9JA 2WE7A 4U0JA 4J7UA 3Q11A 4D46A 4OSPA 1I2ZA 1K6JA 1EVJA 3ZDFA 3ETDA 4G81A 2G82A 2PKQO 4C7JA 5GZ1A 5B1YA 1R16A 5U9CA 2DUWA 4ZA2A 2ZKLA 4JP2A 4GSKA 3MOGA 3VKUA 4BNXA 1NFQA 1XLTA 2CSUA 2PD6A 1E1KA 1ZVMA 3GN1A 3ZWBA 4CLXA 2ZCVA 2NQTA 4ZICA 5CEFA 1P44A 4BNWA 3DMTC 3WB9A 4PLVA 2O3TA 4PLCA 1H2BA 2PNFA 4DWVA 5F5LA 3TF5A 2UVDA 3AY7A 2O2YA 5KVQA 2AEJA 3ETGA 3LC1O 3QV1A 4YEDA 5JNLA 4CLOA 4I9UA 3CTVA 2VYND 4A7PA 2CUKA 4CM9D 4YRBA 4UREA 3X2FA 3B70A 3MCVA 5JYDA 4WCFB 3RJ9A 1R6DA 2AE2A 3ADOA 1N9GA 1VJTA 5G0SA 3NJ8A 4YACA 4PLZA 4BKOA 5L7WA 1YQXA 1ZXBA 3WBBA 1U3UA 2VWHA 5HM8A 3B1KA 2EF1A 4QUKA 3F9IA 3GN2A 1N7GA 3OF2A 1PJ3A 1SB8A 3BMOA 4PVCA 4CV3A 3UHAA 1T26A 3ZWNA 2YV1A 4M8SA 3L6EA 1NYTA 3WX0A 4A0SA 4E31A 1PJSA 3G3EA 4DIBA 4FIZA 5IJZA 2GPTA 4AJPA 2O3JA 4MIYA 4JJGA 4BNVA 5IZ4A 4B4OA 3RU7A 2Q99A 2VHYA 1E0DA 3ZU3A 1TT7A 3PGXA 3O26A 3Q1LA 4YJFB 4BO1A 4LVCA 4YXFA 3EW7A 2Y1OA 1LUAA 1YS4A 5T6BA 2ZJ1A 3INGA 1Y5MA 2GRAA 1CERA 3NJ4A 1Z73A 3WIDA 3IP1A 3PHGA 2D2IA 1GYRA 3KM0A 3IKTA 1TEHA 2W98A 1DBVO 5L51A 4DPKA 1P1IA 4FFPA 1DOHA 1U5CA 1I3NA 1PQWA 4WEQA 5KJ1A 1MB4A 4Y6PA 1I30A 2H9IA 1V35A 4ZN6A 3VPFA 5A9TA 2P9EA 2J8ZA 4CL3A 3FNFA 2GN8A 3GEDA 4BO3A 4XR9A 4IXWA 4Q3EA 5FWNA 2H1SA 5BT9A 1QMGA 4NJOA 2VWPA 3DDNA 4IQ8A 2ZB3A 2Q49A 2B35A 2B5VA 1ZFNA 3ZWYA 4NK5A 1C0IA 1GR0A 2X86A 4UEJA 3NUGA 3ANNA 2JCYA 1YB1A 4ND1A 4BGVA 3ROPA 4YAEA 4CODB 4YB8A 1MX3A 4GH5A 4KTTE 4UEOA 1T1RA 3OFSA 3WOHA 3A9WA 4TKMA 1E5LA 2HSDA 1CYDA 1TA4A 4XD2A 5AXDA 4PLHA 4TRMA 2IXBA 2YDYA 3UKOA 3RUAA 4QTZA 2D0IA 2OL4A 1LRKA 4I9NA 4DC1A 4NH4A 4XIJA 4XDYA 4D3DA 3PLRA 3BZUA 4IGFA 3JD0A 4GLLA 3FHLA 3O8QA 1I3MA 1NBOA 3NYWA 4IMRA 4DLAA 2GN6A 2QZ9A 4NK4A 4R5HA 3UXYA 5C7IO 5CAEA 4DRYA 2O2SA 4EUEA 4FCCA 4RPLA 1DHTA 4WPGA 5CDUA 2C5EA 5DP2A 2PD3A 2V6MA 1LSUA 3D7LA 4L9RA 4CMEA 4BNUA 4E5YA 2JCXA 4J1NA 1U3TA 4RF3A 2VOJA 5ILOA 3IL2A 3FBTA 4ZRNA 4U7WA 3E5RA 4FJ1A 1YB4A 4RLHA 4ALLA 4F6LA 1DC6A 1PWZA 3HE3A 2Y1DA 4R3NA 1HETA 3W8FA 3PYLA 4W4TA 2WE8A 3JQFA 3IUSA 1KBZA 2HK9A 1PR3A 4BKUA 1UDCA 3OP4A 4EUHA 4W6ZA 1F14A 4IDAA 5GMOA 3DWFA 3DXFA 4FOSA 1A27A 5JMWA 2AE1A 2X5KO 1BW9A 1Y81A 2B83A 3ZW8A 1E3WB 4BNYA 4YQYA 5IG2A 1PWXA 1UXHA 3M2PA 3F1KA 4OSOA 3LF2A 1LRJA 2PGLA 2AXQA 3I83A 3FN4A 4Q3AA 3WYEA 2VHWA 4PFJA 3K31A 4CMJA 4ZQHA 4BQPA 3WGIA 4HUJA 5KKAA 1FDWA 1FJHA 3DZHA 3WMWA 1BW9B 1HF3A 4FDAA 3WDSA 1NVGA 2WMDA 3IDSA 3RFXA 4FQ8A 5AOVA 4N7RA 3JQ7A 2G0TA 1DFIA 1S6YA 4GX1A 1KEPA 1ZJZA 4QSMA 3TDKA 1IHYA 2Y93A 1UXKA 5LDGA 5T57A 5IN5A 4EYEA 5BSHA 2NACA 4JROA 1PR9A 4U6QA 4WLNA 4YJGB 1QV6A 2XF8A 1ID1A 4IIVA 5U4QA 4EGFA 4MVJE 4WJZA 3Q3CA 1E1MA 2C2YA 5K9ZA 4FC6A 3S2GA 1GV1A 1PGQA 5KKCA 1AHIA 2JHGA 3H3JA 1QYCA 4K9DA 1T2AA 4CL8A 3W6ZA 3QW2A 3HB4X 4AG3A 4R1UA 2WWRA 2RAFA 1NR1A 4ZRMA 4HWKA 1ZK1A 2OP1A 1D4FA 1MXHA 3DBLA 3QVXA 2CDCA 2F00A 3VC7A 3WYBA 5B4VA 5HRUA 2E6UX 2A94A 1ENYA 5AXBA 3QWFA 2CDBA 4J1TA 3AU8A 2GDZA 3ZV4A 2YHIA 4OOFA 2YZ7A 3DEYX 3U0BA 2ZTMA 3WQRA 4CLRA 1WP4A 3B6ZA 5A04A 4YBZA 5ITVA 3JQ9C 4YJFA 2PFGA 4L0QA 2ZQYA 3KSZO 1BDMA 4ITUA 4GMGA 3EZYA 3H7AA 5DCWA 1EVYA 1UUFA 4CMAA 1ZMTA 4DIOA 4NU6A 3I23A 5A9SB 4EZBA 2JJYA 3JYQA 3VZQA 1TI7A 2B4RO 3PJEA 5KOIA 2X1HA 2P5YA 2IXAA 5EL0A 5I9LA 1EK5A 4J0EA 1P0CA 2DTXA 1L1FA 3OQ1A 2I3GA 1G0NA 1JVSA 3F6YA 3H65A 5K0ZA 1WLYA 1XU9A 4R54A 4XYEA 3KETA 5BNIA 3JYOA 3E18A 1BMDA 3N74A 3CXRA 2CMDA 4TVOA 5A05A 3P5SA 3K2EA 1QR6A 1U4SA 4W7HA 4HFMA 5EINA 4OO3A 1JN0A 1VL0A 3AM3A 4O1MA 4BNKA 4DGSA 3KSDO 3TJRA 2X8LA 1HKUA 1YRLA 2VZ9A 2VT3A 4GKVA 4BNZA 1PGOA 2Q46A 1TT5A 2DTDA 3ZWPA 4H15A 3ZW9A 4DPMA 2DFVA 4ZHSA 4R3WA 4LCEA 2GZ1A 4ALMA 4WLVA 4PG5A 1NXQA 4IDDA 3GVXA 1YOVA 1VLLA 3F47A 1O94A 1GZ3A 2X58A 3JYPA 3MJTA 4J4HA 5B37A 2PH3A 1HLPA 1NTOA 3OEWA 1H9BA 1C1XA 1Z45A 2O3RA 2UUPA 3ZHXA 2CNBA 2JD1A 1YL7A 4JN6B 3DAFA 5JAZA 4D0RA 2A9FA 4MJLA 4CUKA 1WDLA 4EEXA 1QLJA 3BMQA 3QLJA 4WOJA 4XIYA 1M76A 3V2UA 4NFYA 3JQ9A 3DFUA 5T8KC 4HFJA 2UDPA 4MP8A 5L7YA 5EMHA 3EYWA 4E33A 4LSWA 5ER9A 4IDGA 3T4XA 2YV2A 3U9LA 4NBUA 5BQFA 3H8VA 3ZWCA 1U3VA 1V3VA 4K6FA 3I9OA 1DAOA 5TC4A 3RFVA 5CDGA 3E82A 1CIVA 2VUSA 2BKAA 4MVJH 5A9SA 2CDAA 3IJRA 4QO7A 5A9RA 4Z0HO 4G2NA 1RJWA 1O95A 3CKYA 3NX4A 4EJ0A 4WUVA 4YA6A 5IFLA 1PGJA 2CVOA 1HDGO 2W2LD 5JAIA 2ZTLA 3I6QA 3RVDA 1MGOA 1PSDA 1E3SA 2VRBA 3MZ0A 4A03A 3DMYA 5FFFA 4CQMD 3EVNA 4HNGA 4LCJA 1JU9A 1Q2XA 3I3OA 1D3AA 3A14A 2AA3A 3AFNA 4DBZA 3K6JA 3FWZA 1BVRA 1QRRA 4FFNA 1PJLA 1E3WA 4MVJA 4PLPA 4YWJA 1GPJA 1LJ8A 1X1TA 1EVZA 1T1SA 3NDIA 3LC2O 1YJQA 2OBYA 2PZMA 2QRLA 4GLOA 4RDHA 4ND3A 3ROQA 1ZSYA 3AU9A 3I4FA 3ROMA 2FPGA 3PWKA 1QG6A 2FY8A 2I76A 3AUAA 3KYCB 1LDNA 3BIOA 3UW3A 3W4JA 1SC6A 3K73O 3QWIA 5EN4A 3W4KA 4QQRA 2R6JA 2DBVO 4D44A 5JYEA 1M6HA 2AG8A 1HDRA 3VVCA 5ADHA 2Y1CA 1EUDA 3H2SA 4HXYA 3O9ZA 1PS8A 2GZ3A 3KYDA 3CZMA 1EE9A 1GL3A 1QYXA 4O59O 4OKIA 4RDIA 5CP8A 4LVUA 5DBGA 3HHPA 1J4AA 5CFZA 5A4DA 2X7HA 5EESA 2WM3A 3LT0A 5DOZA 3ZNNA 3ST7A 3FPLA 3PI7A 2YY7A 5MGBA 1OBFO 2C29D 3BYZA 1NQAO 3KTDA 1E7QA 2X0NA 3EZLA 1DRUA 5H83A 3NT2A 3A4VA 1W73A 2O23A 2PV7A 2CVZA 4WLUA 3QE3A 4IJKA 2H63A 4UVGA 3UCEA 3U09A 3PFFA 4DVJA 3WMXA 4CMBA 4DLBA 1GADO 3QA9A 2VN8A 3DOJA 3B1FA 2YJZA 4NJMB 4D45A 2DVMA 4B79A 3IQDB 1GV0A 1V9LA 4CV1A 2X9GA 3DR3A 3V5NA 3FSRA 1F8FA 3R6DA 4TROA 3G0OA 4IMPA 1JVBA 1WWKA 4WECA 4OQZA 3JQAA 3U62A 3STHA 3OIDA 4BO4A 1IOLA 1PZEA 1QSGA 3PZRA 4MIEA 4PN3A 2I9PA 3RKRA 1BG6A 2VWGA 1HZJA 3GVIA 4CM3A 4YDRA 5C3MA 3T4EA 3ZV3A 3C24A 5IXYA 2X0IA 4CV0A 2RHCA 4B7XA 2DUUA 4LISA 3DTYA 3I4CA 2GSDA 4Q3NA 1E92A 3CMCO 3QVTA 2B69A 2FP4A 2ZYGA 4BGEA 1VRWA 3AI3A 1LEHA 3JQCA 3H6KA 4A73A 2J3HA 4XJSA 2BFPA 5JMPA 1ISGA 1GYQA 4JGBA 3FR7A 1SEPA 3AJRA 1S7CA 3QIVA 2V65A 1JKIA 1YQDA 3HNPA 1N1GA 1B7GO 4RVSA 3VH1A 4DREA 2Q2VA 3ZCXA 4J6FA 3PQFA 3QVSA 5G4KB 1K3TA 3DAGA 2HO5A 3FCOA 1PJTA 3WXBA 4JQCA 5JO9A 4CM1A 5CEEA 4HKTA 4J2HA 1BRMA 4TRRA 1T2FA 1WDKA 3QVOA 4LK3A 3SX2A 5L40A 3RI3A 1WPQA 1TB4A 3ENNA 3OIFA 2UUOA 3AY6A 4BOYA 2IZ0A 2BH9A 4GX5A 1H5QA 1UP4A 2Q4BA 5HS6A 5IN4A 5TIIA 1UZMA 1YL6A 4Z9FA 1NAIA 3EAGA 1KY5A 1Z75A 4L4RA 1DXYA 1T2DA 4XEHA 1RPNA 4O0LA 4EW6A 4UAGA 5ENDA 1ISJA 2Y05A 4K28A 2EJWA 1VC2A 4Z3KA 1J49A 3VPXA 3F5QA 3PJFA 1B3BA 5EIOA 5JPIA 4IJUA 2DFDA 1EQUA 3EHEA 4MKXA 5HBRA 4BNTA 1QKIA 3E5MA 5DCUA 4L4XA 2Y99A 4NFHA 2QW8A 4P4GA 3RUFA 4M89A 1J0XO 2DC1A 1H6DA 1GDHA 4K26A 5DF1A 3LLVA 1WDMA 3NTRA 3KEQA 4NBWA 4UUMA 3ZWVA 1D7OA 3I5MA 4EITA 5JDIC 3A1NA 1EZ4A 1OI7A 1ZK2A 2WYUA 3ETEA 3GMSA 4JBGA 1E7YA 2RH4A 2CD9A 1JKJA 5G0VA 3DBRA 3U3XA 3WR5A 4MDHA 4E5KA 3HWRA 1NFFA 3NRCA 2PWZA 7MDHA 5IDWA 1E7WA 1P33A 3RU9A 2NTVA 5KJFA 4BNNA 1WZIA 1JKFA 4J49A 1HE5A 1DHRA 5B12A 3GMDA 4D0SA 3EMKA 1WW8A 1O9BA 1QLHA 2IDZA 1I3KA 4IZHA 4Z9XA 4XQCA 4BB5A 1H6CA 1O6ZA 3JYNA 3GPDG 3RUIA 3GLQA 4ALKA 3FD8A 3ZU2A 3TL3A 1N7HA 1FDVA 4HBGA 1KOLA 1Q0LA 1SAYA 1CEQA 1ISFA 3ULKA 4WCFC 2X22A 3GG9A 4FSHA 2BFAA 3RBXA 3H2ZA 4IJVA 4R41A 1OZAA 2YHIB 3TFQA 2J3KA 4E30A 3RSHA 1XSEA 3R3JA 3ZV5A 5KJCA 1L7EA 2EEZA 2OOSA 2Y67A 5KWEA 1K2WA 3MTGA 3PQDA 3SEFA 3DMTA 3P2YA 1UZLA 2G76A 4KP7A 1XCBA 1D1TA 2QYSA 1P1JA 4RL6A 3RCBA 1NPTO 4XYMA 4R9SA 4AVYA 1JA9A 4R1NA 3RAJA 3ZWXA 2PTGA 3DFZA 2CFCA 1JWAB 1JLLA 2PZKA 3DC2A 4CM7A 1DDOA 3ZNQA 5EJ2A 7ADHA 4E3ZA 1G6KA 1X1EA 1Q0QA 4LW8A 1HYEA 4CM8B 4AJOA 3LVFO 3SC6A 2TMGA 3IUPA 1P74A 1PGPA 1ZK0A 2GERA 3DHNA 4INAA 5TGDA 5IZCA 5T5QA 4W99A 5HS4A 1MUUA 2D4AA 3E1KA 3U4HA 3G79A 2JD0A 3H5RA 2OORA 1LLDA 4BHTA 2AHRA 4OL9A 1LDEA 1KVUA 1FMCA 2A92A 5ILGA 2HU2A 1BVUA 3EVTA 4H7PA 2HKIA 1NQ5A 3GY0A 3BXXA 3OJEA 5JDCC 1YONA 3HUDA 4QFDA 3WWYA 1X7HA 4QX6A 2J6IA 1JWBB 1BDBA 4OYRA 3GAZA 1DLIA 4TMFA 4CM4A 4CQLA 4IS3A 3SJUA 5KJ6A 4WNIA 1CF2O 1LNQA 2D3TA 4L4SA 1NVTA 1VE9A 4NR0A 4IS2A 1FDUA 3DHEA 4E0BA 5FEUA 4AJNA 2O50A 5L3ZA 1KEVA 1NQOA 2EKQA 2JAHA 2VOEA 3LZ6A 3K96A 4LGVA 1OAAA 1BSVA 1Q7CA 3ITDA 2X5JO 3OQBA 4RF2A 1EMDA 1IZ0A 1DJNA 4MOWA 3U4CA 4BGUA 3H3FA 5TNXA 4DLLA 2AEFA 1W6UA 2HRBA 4J90A 5CEJA 2OO5A 1RM4A 2O3QA 3K5PA 4ONEA 3W6UA 4Q3CA 4Y6SA 1BXGB 3H9QA 4Q3BA 4CV2A 3ZH2A 3RKUA 4Z3DA 4CMGA 2GD1O 3O03A 1VJ1A 5KJEA 1LQTA 3LF1A 2NV6A 1RM0A 3K2BA 5DULA 3S1LA 1V8BA 3TOZA 2E49A 2Y1GA 2SCUA 1D8AA 3MOIA 3KXDA 2BI8A 3D3WB 4I08A 2EWMA 2VWQA 5IDYA 4YRAA 4J1QA 1V0JA 4XX0A 1PQUA 4CQMA 3JD2A 4JCOA 5IXSA 4I5FA 4JJFA 2HLPA 2GZ2A 3N7UA 1LU9A 5T64A 4WLOA 3TRIA 4TVBA 5A1TA 4BMNA 3B1JA 3VTZA 4KUHA 4J4TA 3BHJA 4IY1A 4ALJA 2P9CA 4BNLA 5TJHA 2X9NA 3JSAA 4RVFA 2W2KA 5JAQA 3ASUA 3WGYA 1KIFA 4IIUA 3PP8A 4FFLA 1QV7A 4PG4A 4RV9A 2YFHA 5A3JA 1DO8A 1E7SA 4DIFA 4IUYA 3ONFA 3CUKA 5KNLA 4W9NA 1PZGA 1W8DA 1JAYA 2RHRA 2DLDA 5FI3A 1K0UA 3L77A 1QYDA 1EVIA 4XWYA 3PYXA 1IULA 5F1OA 4FBGA 3JQDA 1U2GA 2D59A 4H3VA 3NKLA 4EJ6A 1IY8A 3DOOA 3W1VA 1WVGA 3GZ4A 4ND2A 4YJDA 3HB5X 2EJVA 3EK2A 4CLHA 2POQX 3DONA 3GK3A 4GVLA 3HFGA 1Q7GA 2Q1SA 1LDBA 5JS6A 1ISMA 3AY3A 2GUGA 4NQZA 2ZTUA 1OMOA 5TRTA 4XYLA 2XXJA 2ZATA 3HDYA 1NPYA 1ADGA 1XEAA 4XYBA 4DQXA 5CDSA 1P1RA 2I99A 3OJLA 1LDMA 4YYZA 4J7CA 1SOWA 5JY6A 4JJIA 2NVUB 3ZWOA 4YVFA 3KZVA 3P19A 4ROSA 2PH5A 1TLTA 1V3TA 5J23A 1B3RA 1LA2A 1HYHA 5AQ1A 1ONNA 4U0KA 1X7DA 2HJSA 5ES3A 3PK0A 3S2FA 1MP0A 4N18A 1P1HA 2NLOA 2WD7A 3Q0EA 4FPXA 1CWUA 3BA1A 1HDCA 3TNLA 4WNCA 5H82A 4KZPA 2PKQP 1H6BA 5I9MA 2WSBA 3VKVA 3TFOA 3JQAD 2NU9A 1XQ1A 3WSWA 4GBJA 1I2CA 2CZCA 5KVCA 3NAQA 1KVSA 4MP3A 1ZSNA 4OHUA 1HE4A 2RH8A 1PZHA 1VM6A 4ALIA 4NFSA 4ZQGA 1CDOA 1ZIDA 4URFA 3GEGA 1ULSA 1FK8A 1Z7BA 1MFPA 3H4VA 2C54A 1EFLA 2C20A 3D5QA 4RPGA 2OGUA 5IDQA 3C8MA 1AXGA 4YCAA 5IDXA 2PLAA 3WS7A 3RFTA 3BTSA 3QVWA 1PTJA 5C7OO 4D43A 4EDFA 4PZDA 1MA0A 3ZHZA 2TMDA 2GN9A 1T2EA 1Z7EA 5L9AA 2Y68A 3TZ6A 3MTJA 4B7UA 1XGKA 3DZIA 3M6IA 3VZRA 4CR7A 4MVJM 4DMMA 3KUXA 3DBRB 5DNAA 4KUEA 5COBA 1R0LA 4NIMA 1UJMA 3FI9A 2C07A 2FR1A 3KB6A 3ADPA 4L75A 3WGHA 3I9KA 4YAKA 1M75A 1VSVA 3P2OA 4WASA 4ND4A 1I3LA 4HV4A 5LDHA 2BI7A 1E3IA 3PHIA 1M67A 2CY0A 5TLSA 4I9HA 1O5IA 2NVBA 4N5LA 3ZU4A 3GNQA 5L4LA 1A71A 3F1LA 4AICA 4EI2A 2ZIZA 2EW8A 1YGYA 4QECA 4XDZA 3DZFA 5L53A 4D3SA 4S3MA 4IDFA 5CPBA 1I8TA 5BSEA 1U5AA 4FS3A 1MC4A 2BD0A 3GOHA 4FFRA 1JQBA 1MLDA 2Z1NA 3GR6A 2A4KA 3ZHBA 3GQVA 3ICPA 4E2ZA 1IL0A 1GCUA 1Q0HA 3LQFA 1M6WA 3ICCA 1DFHA 5L4NA 1F0YA 1ENOA 3HDHA 2IODA 4QEDA 3W8DA 2GYYA 2W2KB 3GDGA 4AJ4A 4E2XA 2WYWA 3FR8A 1MXFA 1E1LA 3FNEA 4XR4A 4RPJA 4MPDA 1KY4A 1IHXA 3QWHA 5GY7A 2B4QA 3TN7A 5LC1A 1NHGA 3PWSA 3FWNA 2I5PO 3UN1A 1R12A 3D5TA 3AOEC 2JAPA 4CM6A 1RYDA 2I65A 1I5RA 1DC4A 1W0CA 2HMTA 3GDFA 2D5CA 3JQEA 3SBOA 1EDOA 1NX6A 1I0ZA 3SLKA 4XGIA 1DC5A 1JW9B 1GQ2A 1CQJA 1K5HA 4M87A 1R0SA 3GGGA 5EQDA 2OZPA 4HP8A 4YJHA 3HADA 4RO0A 1A7KA 5KIAA 2FR8A 4RORA 1U28A 4RVHA 2O3SA 1ZEMA 4R51A 1ZMOA 2VT2A 3WNVA 4E21A 1R15A 3E6AA 3GPIA 1HWYA 4MVJD 2X0JA 3IAHA 3RROA 1NP3A 1A9YA 3NV9A 3OSUA 1UH5A 1GUZA 1XHLA 4GVXA 2HUNA 4IXTA 1H6AA 3JQBC 1EBUA 4YJGA 2VHZA 4OMUA 4W9NC 4CJXA 1LI4A 1PL7A 2V6BA 1I24A 2HQ1A 3RUEA 8LDHA 3AI1A 2UYYA 2Z95A 4M55A 5DP1A 1NNUA 3PTZA 2ZB7A 2ZCUA 1EUZA 4PZCA 4B3HA 1DIGA 1HL3A 2GCGA 1BXZA 1WMAA 4I8XA 4XCVA 4R1TA 3F4LA 4ZQBA 3PIIA 5T67A 2VTEA 2VHXA 1LTHR 3WFIA 4NJMA 2AMFA 1U9JA 3INRA 4EBFA 2FN7A 3BMCA 2NQ8A 2P2SA 1LDYA 1XDWA 3PHLA 4FGWA 3H5AA 4NZ9A 3LU1A 5TJ9A 1VJ0A 4XRGA 1E7MA 3PRJA 4HY3A 4OAQA 2YFQA 1EK6A 1X14A 2ZTVA 6LDHA 1DLJA 3OJFA 3NT5A 1Y5RA 2C7GA 2V6GA 3KO8A 1R4MB 2OBNA 3GFGA 3HG7A 1K6XA 4FOOA 3ZWAA 1GYPA 2JD2A 5DBIA 1C1DB 2O7SA 3TPCA 3PJGA 3IJPA 4YT2A 3ON5A 2BRUA 2H5LA 1B8UA 2C7VA 2WJPA 3ENKA 4FN4A 4OKNA 2ZYDA 2R00A 2NVWA 4OQYA 4WE3A 4IDCA 1UXGA 4AJEA 4Y98A 4JLWA 3R3SA 4JP3A 2P4QA 3CMMA 3PWZA 3PXXA 4B7CA 1XQ6A 1DRVA 2P68A 1EEHA 1AGNA 1H93A 2E37A 4XYGA 5DDIP 1XU7A 2J5KA 4PLFA 3DBHA
chains in the Genus database with same CATH superfamily
3K9HA 3RYFA 5AKJA 4LJ8A 3F73A 3KR1A 3K70C 2YRXA 3KPVA 5K6TA 2CC2A 2I71A 4X7MA 4I55A 4ZZ2A 4F5WA 2GVDC 1JFVA 4RM2A 2G5GX 3HJCA 3OTGA 1PD0A 3HU3A 3LSYA 4NH0A 3TG8A 5KEIA 3D6JA 1FP4B 1VL8A 1YJ5A 3NBXX 2ON6A 3HU1A 2RAUA 3VKFA 2C42A 4F2HA 3EXFB 4K0KB 4B3TB 2J9YB 4NABA 1VP9A 4NYJQ 3PNOA 4FYYA 1GPLA 3H97A 3C7CB 3TZLA 2EW1A 3V4SA 1W4ZA 4ENWA 2MSEB 4OBWA 2XYPA 3TLJA 3W8NA 5CDTA 3U6KA 2J5XA 3L6CA 3C1TA 1X13A 4ZANA 1UP7A 5FWAA 1FBNA 2D1QA 3A1WA 3WIEA 4CMIB 1ZBDA 1GPYA 1NF2A 4JVSB 1FFXB 2AOUA 2Q9BA 1BCRB 1ZUD1 2RGCA 3GWZA 1ND6A 4MKFA 4W82A 5DM0A 3W2FA 3Q9UA 4ZOLA 1NZDA 2ID9A 4QOJA 1BGXT 5JS7A 5LSAA 4DT1A 5CA0F 4R69A 2WF6A 1TVMA 1BH2A 1DBQA 1ZO8A 3B3QA 2JASA 3ESQA 3ABQB 4KQCA 4P83A 4ZV7A 2OGSA 3X1JA 3ZHVA 4CEJB 2O8FB 2C2HA 1PIWA 3DFIA 3TLXA 3UJ6A 3DAPA 1XEXA 3I52A 1R6XA 2FSVC 5FOQA 1L1RA 2NU6B 4P81A 4NU5A 2OECA 2VH2A 3O4GA 2WA1A 3MLAA 2AEMA 1E1NA 3IBTA 5IMBA 3PEFA 1XD2A 2C61A 4M1SA 5K6AC 2DLNA 3TLKA 2JCVA 2QY9A 3D3EA 1ABBA 2C9DA 4QDTA 3G5LA 3D4LA 3SYMA 4Q0MA 1O89A 3KKLA 3L7JA 1CQJB 1WU8A 2PVCA 3JD4A 3CWZA 2QVZX 1R6BX 3LOUA 3DOEA 2Z9CA 3GZNA 3JQGB 1TVCA 2PT5A 3TWOA 1WVMA 2FN3A 4FC7A 2XF2A 2ZZKA 4V24A 5EVJA 2PWBA 5JLAA 1J0EA 2A9RA 2ACEA 3G85A 4WXRA 4LJAA 2W2VA 3TNYA 1S2OA 2BKXA 3IHKA 3ZXSA 1A1VA 3KWLA 3KOYA 4OK6A 2VZ8A 1JHZA 3NEPX 4K3VA 4QPZA 4WAUA 3PU6A 3VFDA 2VUHB 2XCRB 3PQEA 1UBHS 3OLYA 4PWZA 4EUFA 3TXXA 3GH1A 3S7TA 1NBAA 1JMVA 1N8NA 1SZPA 1KXZA 3DV9A 1OY1A 4M9CA 1DBRA 4GEGA 5FB3A 4AFNA 5HRAA 2PX0A 5JYCA 3BQ9A 3CH6A 3MUFA 2YINC 3B6KA 2WHEA 2W8BB 3JAWB 5ICCA 1XZAA 3FOFC 4YNBA 3TXAA 1ODKA 1ODFA 4ARCA 1D4AA 4MVCA 2WWIA 3FYTA 4I9FA 4D6PA 4ENTA 1CUEA 1SWWA 5BW6B 4ISCA 4LTDA 3VR5H 2BUAA 2ZFUA 1OYVA 4ZOQI 5CU7A 3D1LA 1W4BA 1W1IA 2IWRA 4YCDA 1P9WA 3GDOA 3PHCA 4AZ3A 2H3HA 2HDHA 5HUQA 1JFTA 3TIGA 3KHSA 1SUPA 4NRDA 4EPXA 1ECCA 1P73A 1IOVA 1Q0ZA 3L7CA 4J75A 5F21A 2X4GA 4NSNA 2XSZD 1DT3A 1FPMA 5E1BA 1C1XB 2ODPA 2JIMA 2FZCA 2NNLD 2JLQA 3SKVA 1SOUA 1JPVA 4UBMA 2AIRA 2RIRA 1ZM7A 3ZGYA 3BD6A 3ORYA 2X6TA 3IHLA 5M29A 2VC2B 1I6LA 2B8JA 2QPTA 1XCMA 3OLCX 1S1MA 1O03A 1PFUA 1QRAA 2FSVA 4DSOA 2NZVG 2BF7A 2QRGA 3HLYA 3OCUA 3BSSA 4LQCA 3H1PA 4BRZA 1H9AA 4QFCA 1F9AA 4M9QA 2NZ2A 2SECE 3I5XA 1YRHA 2Y2UA 1I4LD 2GRUA 4J3JA 4ER5A 4BL5A 1M7BA 1I01A 3AUUA 5E7IA 1EM8A 1EBFA 2O0HA 2QRQA 4XZ3A 2R79A 5AM3A 2IPLA 2PZAA 3IQWA 5JUWA 1UPFA 3PFHA 3W9YA 2QMEA 4P8RA 2XUKA 4Y2XA 5CPFA 4CIXA 3NHLA 3M1LA 4KR6A 3GJ3A 3GFBA 5FI0B 4OU5A 4D7AA 3L0DA 2AMLA 1HZZA 1JV2B 1WX1A 1VLZA 3D7RA 3HLKA 5U1PA 1E20A 4DBVO 1KF0A 3SK0A 1NI5A 1TKCA 2B4TO 3MJSA 4N8EA 1X7GA 5EMNA 2LVBA 3R7WB 2HTFA 4DR3B 2G28A 1FNMA 2VYFA 2V74B 2XKKA 1N3YA 4WGGA 2ZK7A 5G0UA 1QP4A 1E2IA 2IU4A 4P93A 5G4KA 5T41A 5JRZA 4K8OA 4ETIA 5TMEA 3H86A 2Q1WA 2PA3A 3EG5A 1EE1A 4YXWA 2GBCA 2VHJA 4DB4A 1KH2A 1ADBA 3OQ6A 3T3PB 1W9HA 4G0XA 4EABA 1DSSG 2VJBA 5D3ZA 2NU8A 1ZK4A 4A8HA 4A8TA 3AC0A 1XTRA 3MPUA 3THWA 3A70A 2VA8A 1J9EA 4ABYA 2UYCA 4KGDA 1NM5C 3MUEA 2OZKA 3PS9A 3WNQA 3NWJA 3KXLA 3J81k 1GRNA 3Q2IA 4B40A 1BE1A 3BSFA 4M54A 4L8GA 3U31A 1AA6A 3TUZC 2PZJA 1WCXA 2X5NA 4NDZA 2JJ1A 1QPZA 1XD9A 5AVRA 4DL9A 5C52B 3BXPA 1YDEA 1R8XA 4D8YA 1JQKA 4C01A 3R24A 1GPWB 4C4OA 1BHSA 3S2EA 3RU2A 5IH7A 1BGVA 4MQUA 5HMMA 2F90A 4AJKA 1WUJS 1I4DD 2AWNA 4ZJYA 2FLWA 2O8BA 2I1VB 5T3YA 3ZWWA 1GTMA 1Z74A 4M2LA 5B4UA 2EGGA 2JGKA 1PT6A 5D5QA 2DKOA 2W6PA 3OE5A 4MVJI 3H2IA 2IX3A 2CFIA 4N0MA 3I28A 4HJXA 1J5PA 1TNDA 3H99A 4PG6A 4RJ2A 4E11A 3W5VA 4I9GA 1G0OA 3BEDA 5KNCD 4BMYA 5BR8B 3BDAA 3EOBI 3GJRA 3DSRA 1IUKA 3U1VA 1YKSA 2J46A 4FCVA 3SC4A 5B58C 1H94A 5L6MB 2PZ8A 1HC7A 1U04A 1W0KD 2B3TA 3DCIA 3WIBA 3WIVA 2QX8A 2EKZA 1GUYA 1VKNA 1P9LA 1Y33E 3D8SA 3JSXA 4AP5A 3SSNA 4AYXA 4C6RA 3HN2A 2ID8A 4J9UE 4KAXA 1CY2A 3CF2A 4LMRA 1GQSA 2XZPA 1N8KA 3P9RA 1GL7A 4ZDKA 1QYWA 5K45A 3EZ6A 1JLSA 1Q74A 4D3FA 3WWCA 5ITZB 4GGPA 2ZJ3A 1V11A 1O0SA 1CUVA 2A0FA 2JIQA 3QNUA 4F3NA 1A77A 2QYHA 4GUDA 5G4LA 3WJ7A 4YQZA 3DBHB 1F06A 3K9QO 2ET6A 2GCNA 3AEKB 4J29A 1YA8A 3UUWA 5F2KA 4C0AC 2Q9AA 2BLLA 2F64A 1G6HA 1T24A 3OMLA 3W9SA 1RE1A 5FEMA 4EJMA 1DFGA 2Q3EA 1IXYA 4YO7A 1NASA 1ZRSA 3DLIA 1KSGA 2Z3WA 2ZPTX 2WQZA 3PITA 4RFLA 3B36A 4Z9AA 4JDUA 5DTJA 3WISA 2IK8A 4BE9A 4RS3A 1F2UA 1I33A 1FMFA 1ES9A 2P79A 3N39C 1SKYB 3SKYA 1A9SA 3H04A 1ZINA 3HGTA 5HKBA 4O4LF 4FB5A 4I81A 2V1UA 2WNSA 1SUDA 1ONOA 2VEOA 1JAXA 1YJCA 4I5DA 3ONWA 5DMHA 4DPLA 4XLLA 3V2HA 1BDHA 1FF9A 4KAJA 2Y9PB 1KI1A 3L7AA 5JXGA 3M7IA 4I3GA 4NZPA 4WCFA 5FFNA 1P45A 2W4QA 4X54A 3FNHA 1GU0A 1A8HA 1NMEA 3FGNA 3M33A 4FIDA 3BMQB 3WSVA 5LOVB 1JLMA 1OROA 3BN3A 3DB2A 4G65A 4X60A 3VISA 4CLOB 4CU5A 1H5UA 3RJ5A 3F4KA 1WXDA 3PUHA 4WKGA 1NVMB 4MS1A 4MIKA 3TZKA 1L7DA 4OH1A 7AT1A 2LV8A 1WPRA 4S0XA 1KI7A 1TOAA 2GMWA 4PPNA 2OYSA 5A4IS 1QFXA 2BHNA 1HORA 2GVZC 5REQA 1T29A 1XJQA 5A5VA 4ID9A 5BQPA 1YRYE 3R40A 1SCUA 3PGVA 1BFDA 3QLVA 3O8OA 4RVNA 2G1PA 4GKJB 3QMMA 1J0CA 4BJ5A 3IOYA 1V4NA 4Q9JA 4WOBA 3CVXA 2AN4A 1PJAA 1H22A 4UHJA 1UKVY 3TZHA 3AUSA 2HRQA 2YNMC 4H16A 5HF8A 1B42A 3AOGA 1KEEA 4RV4A 3SHTA 4F3RA 4K8RB 2O7QA 4Q1EA 1VIMA 4B4DA 2EVWX 16PKA 3KOWA 4GDMA 4JL6A 4DXDA 3OHPA 5BPHA 5KCZA 1NKTA 5LL6P 1M33A 4P38A 2QM3A 1R4NA 4MW5A 4I5EA 5I7VA 2Y0PA 4MKRA 3UWKA 3W3ZB 1NQTA 2X40A 2ONYA 2UYHA 3UHOA 3QOFA 1HURA 1KSFX 1IRXA 1PG0A 1WEHA 4MHOA 5FDFA 3PE3A 1P61B 1U2DC 2FZLA 1II9A 3HSSA 3Q7PA 1Y6ZA 4FW8A 5EVCA 3ACCA 4KPFC 2GYWA 4B75A 5EIXA 1Y4SA 4QYTA 1IQ0A 2QZZA 3EVEA 4RK5A 2Q3FA 3AF6A 1XDZA 4Z49A 1ZK3A 3QWAA 2G36A 4KDFA 2WD9A 2QKYA 4M9XA 3S55A 4GICA 3LPDA 1W5SA 4NYMQ 1ISSA 5LCXA 1N2CB 1DAPA 4GZMA 1WD7A 1DQPA 1TJYA 4TYPA 4B4KA 4U2EA 5LBIA 4GMKA 2DAPA 3UJ8A 3G89A 5CHEA 1XKQA 2A33A 4ITRC 3I37X 5EHZA 5BR1A 3K71B 3NGLA 3Q9LA 4IRMA 3B1ZA 3SF8A 2GB4A 1KFKB 3VDQA 2BEVA 2QRPA 4NULA 4NL4H 3DV0A 4IIBA 5D5PA 3E4DA 3D7MA 3WJAA 1E0KA 4OP2A 1L5NA 3Q3JB 5HYVA 3N8IA 3K05A 3WLJA 4M1OA 4AS1A 1Y63A 4HAWA 4BX2A 5KYXB 2ZXUA 4S2UA 3CINA 3GNSA 3WGQA 2GCEA 2EIHA 2PIDA 1G2OA 2PQMA 1A4UA 1DT5A 2IXDA 2RHOA 5FHQA 2F4NA 3T3IA 2O59A 4Y9UA 1M2KA 2WB2A 2PLFA 3RO7A 3JALA 4DRXB 3JYLA 1O0CA 5AUNB 5BV0A 5CX4A 2IKQA 1L4KA 1B4DA 2PH1A 5G0WA 1HEUA 3K70D 4TZKA 1QP7A 1HYGA 1SRQA 3ASZA 5JD3A 3SVTA 3RADC 3R8FA 2P2CA 4LOHA 3OU7A 4OJQA 4QD3A 3CM0A 3GPBA 3UC9A 1DWPA 1K88A 5GZ6A 4ZJUA 2BKVA 5M04A 1K7SN 3E22B 4O4IB 4EKYA 1X94A 2YFYA 2BELA 3LT4A 1DMSA 3B82A 4Y2JA 5ALJA 4BO6A 1U0LA 1NVVQ 2B2XA 3M34A 3PE4A 1WCIB 1RJEA 2OHIA 4D79A 4JYAB 1YJAA 1JG7A 4FMDB 3MGBA 5EERA 4D8WA 1NJSA 1S0UA 1GL9B 3P97A 3Q8LA 1QUEA 4YCMA 4C0JA 1OI2A 5HXAA 4KR0A 1YZ3A 3DMNA 4PYJA 3SQDA 5CCEA 5EKTA 3E5NA 3F8SA 3FNBA 4HADA 4KNVA 4PIPA 3TLZA 2B2CA 5BORA 4LXTA 2KBEA 3FSJX 3L8GA 3S5JA 2H48A 3HGQA 3JQGA 2NYAA 2R00C 4OHYA 1YHYA 3ESRA 1FP4A 3QBJA 4OG2A 1NVEA 4AS3A 2Q4RA 2QQ5A 2XTJA 1PJ2A 2JHFA 2RHTA 4IDNA 5ARCA 2ZRGA 5IAGA 1GU7A 4DBLE 2E4VA 2E18A 4XGKA 1DZIA 3QY9A 4B6PA 3GHYA 4BNIA 1DX9A 1SXJB 3I76A 3O4VA 4RTQA 4R1LA 1D6MA 2N46A 2SNIE 3QFHA 4PCVA 4YXWD 4R7GA 1YRWA 5AO9A 2QPLA 2VSYA 5J63A 5D84A 1Z68A 2XPCA 3WK7A 4G25A 1CF9A 1TJPB 3UHFA 4WZBA 4WKNA 1S2NA 2QDKA 4DNXA 4K46A 4MQEA 4KDEA 4MRPA 4O1HA 4YRGA 2PD4A 3AP2A 2EZ4A 3R9XB 3PC3A 1GUFA 1B6GA 2CHEA 3D4PA 2OMEA 4F9TA 4PZEA 1FXWF 1RS0A 4P84A 1PN3A 1SQ0A 1U5BA 5CR9A 3WQBA 4QQFA 1SVMA 4RJLA 1P9RA 4Y3UA 1ZA2A 2CEAA 4KDRA 5LNK6 4RKRA 3Q7IA 1N5DA 3H5NA 1VBFA 4ZMBA 2JIZD 4XDHA 4XIIA 2JI4A 3IXQA 1OXVA 3BBLA 1COZA 4WFJA 2PMBA 2D3WA 4EVQA 3ENVA 5FBZA 4ZPXA 1VBNA 3OZVA 4ZI5A 1I80A 4FONA 2NG1A 3U7HB 2XXAB 2AG6A 2FZKA 2NSYA 4PRKA 3SOPA 4LHXA 4GAEA 2DT5A 1K7FB 2N0SA 4PQEA 3L79A 4G23A 2PZGA 1GRVA 2WSMA 1HQDA 3AI2A 1A8SA 1OXMA 2Q3HA 3D31A 3R3VA 4EY5A 2VSNA 4N49A 1BOFA 4U2CA 1X1AA 3Q9SA 4EHKA 1ZLYA 3E1SA 3LA6A 1JFRA 1ZR2A 2ZI3A 3AKCA 3NLLA 2DY1A 2A1IA 1CZNA 2DPHA 3IE1A 4F4CA 4FR2A 4H1HA 4L3VA 4EYGA 2ILTA 4A26A 1LX6A 2F4VB 5I7EA 1TLFA 2DHQA 2PKRA 3FFAA 5D5HA 1U2ZA 4QT4A 2REQB 3PCTA 1XTKA 3B53X 2OFXA 1BU5A 4XFKA 2WWXA 4YRTA 2W93A 3RSCA 1UP6A 2JNWA 5EOVA 4B8YA 2QN6A 3CF6R 1QXSA 3WGNA 2BYTA 2VAWA 3BRWD 4IDQA 1E79A 3IAFA 3STYA 1ZOPA 5A3VA 1K63A 2V3WA 1BD3A 4Z0PA 1ADFA 3SMQA 2CW5A 2HCJB 2C8JA 2WHRA 2OFWA 5D6OA 4O4JF 2A9OA 1Y9DA 3O1LA 3T99A 3ZDXB 3ROKA 4N5NA 4QXAA 3UT5A 2O4UX 2Z8YM 4RZQA 1Y7IA 3AL0C 4P7KA 1GKYA 2BM1A 2NYUA 1M2WA 2HA5A 4LJSA 2I3DA 2XAAA 3C97A 1CRLA 3CZCA 4QASA 3NHRA 5C35A 4PG7A 5BQXA 3GRPA 2BFEA 4UZSA 1RHJA 2QROA 4U3JA 3BXGA 4EPYA 2EBFX 2QQ0A 3QKRB 5F7ZA 5LZ5A 3BK7A 3A3PA 3GP8A 1AQLA 5KWVA 4KNYA 1RQ2A 3KQHA 2NO5A 4G36A 1P4HA 5K8TA 5CFNA 3G5TA 4F11A 1BU8A 3F90A 4GXTA 3VZSA 5ARBA 1BXGA 4J6EA 1D1QA 4WNAB 4GGOA 4RY2A 3VGJA 1M6NA 1VI6A 1J1IA 2VZ0A 1RKQA 2VTDA 2X3YA 2PS0A 4BKRA 4H7EA 4PYLA 2Q4OA 3COYA 4WERA 3MCUA 4I1VA 4K87A 5FNVB 2C9BA 3ZWQA 5L45A 1E9SA 3FOEC 5AM0A 1G5PA 1JR2A 3EC2A 2HZBA 2A3RA 3S40A 5CVDA 5SZHB 2PKXA 4FYVA 1Z6YA 3LLSA 4RKEA 1NN5A 2CLLB 2AUMA 2EQ5A 3LP5A 3T7IA 2R87A 2GXUA 3P0FA 3TD6A 2ZWOA 5FQNA 3KQQA 2O0LA 3DD5A 4H3KB 4UNNA 4EA7A 4J0FA 8ATCA 2VTBB 4JBNA 3M6UA 3JRXA 4RVGA 2ZIXB 5L95A 4IXNA 3IKJA 1GKIA 3UF0A 3TEMA 1EHCA 1ZJYA 3E2IA 3F5DA 1Z4IA 3HWWA 4BDTA 1OWNA 2Q9UA 4DNQA 2O8EA 4GI7A 5E7JA 2HYDA 3VAYA 4AY3A 1QTIA 4WFKA 2KM1A 1YE3A 2YJNA 1M8KA 5IWCA 2C88A 4V0MA 2AXEA 1R4ZA 1RQPA 1Z3IX 3H9JA 4OFXA 5ALPA 3KOZA 3SJBA 4D26A 1YZVA 2N9UA 3OEHA 3W5HA 1KYTA 3W79A 3F4BA 1G7SA 1QVWA 3H7IA 4RTSA 421PA 5IJXA 1X1DA 2ZETA 1UCFA 3LS2A 3Q87B 4IX9A 1JEYB 1PK8A 4X8HA 3WYCA 4US2R 5AW2A 3KKKA 1NC1A 4PXSA 3G9ZA 3JD3A 2B94A 3G17A 2VQSA 4AWXA 1U7DA 3IELA 1XEWX 5MDHA 5JAMA 1QK4A 2ETXA 2VG8A 4BMPB 4X20B 2FRVA 3DR5A 4I50A 3ZVRA 3T1YB 3AUKA 4H08A 4KQJA 5EIEA 1GEEA 5TMDA 3TTTA 2GEFA 4JI3B 3TRHA 2EZTA 2PBRA 4HRXA 2HLDD 1M2OB 2XNDD 1KBOA 2IEIA 4EJ2A 2HQOA 2WIKA 1AJEA 2YXNA 3RYHB 3OJCA 3QQPA 3TOXA 3KZ1E 1BQ3A 2LWIA 1XNJA 3FYUA 5CB8A 4DFDA 5EPOA 3SXUA 2VK2A 5KDDA 1X38A 5MN5A 1O97C 3FSGA 1ELOA 1A7JA 3AQIA 3MIIA 5FH9A 4G0VA 5C1OA 4HZGA 1XJWA 4KN8A 3HDGA 4PC2A 1T8SA 1BXRB 2LW7A 2EEPA 2DWOA 4KMSA 1Y8ZA 2R44A 1TADA 5TT1A 1VFNA 1PR4A 3CNQS 4ND7A 1Z5OA 2R1TB 1F8XA 4CQLB 2QLMA 3KLOA 5HWSA 1EFPA 3S8MA 2GETA 2UVQA 4DC0A 2ORYA 1JQEA 3ET5A 4LXUA 4DV7B 1E64A 2QD4A 2XCUA 4F4IA 1JBKA 4MKHA 2BGMA 2W71A 3FZNA 3WJ1A 5A5EA 2PMWB 1LVGA 1RD4A 2UVPB 3B7GA 2R8EA 3A1UA 1H2FA 1X9HA 4IJQA 4OXYA 3M6WA 3IKVA 1L8AA 2Q27A 1UZNA 2JH8A 1E2KA 3H3XA 4ZCSA 3TB4A 4PLGA 5LXTB 3ZKWB 1R88A 2ADOA 1L0BA 2HX1A 3NALA 4OAOA 4DA9A 3PPIA 1D0SA 4C08A 3KNZA 1NU6A 3VH4A 3HTXA 3JQ6A 4UNRA 2IW1A 1I10A 2F1HA 4O6VA 1WUIS 2WD7B 5FI5A 4ZALA 3JWJA 1LLFA 3T7CA 2XWSA 3FKSA 3FTFA 4E1VA 1MD9A 2WI8A 2J3LA 3GRAA 2ES4A 4JBIA 3KR2A 4II3A 4EECA 5C2JB 1AKQA 2ZRIA 5CIYA 1TF2A 1CVLA 2ZJ5A 4KYIB 2GAIA 2W2XA 3I2KA 1NX9A 2BDEA 4HWOA 4KACA 4UBIA 3WDLA 4DV5B 4MUJA 5BNFA 4RHUA 2WF8A 3JZIA 2M6LA 3HRKA 1KVQA 1OZ0A 4JUAA 3AMVA 4HQNA 4Z7QB 2ZE8A 4PRYA 3OUZA 1GGKA 5IK2A 2DBYA 3O83A 3OJ0A 4MKZA 2VDWA 3CTMA 2XUFA 2C82A 3B20A 1B0AA 1Q1QA 2WLSA 3MNFA 1MFZA 4AP9A 4CRWB 2EWVA 3WHIA 4L9AA 2AUTA 5DWVA 2F8TA 1HQKA 2ZJOA 3CUYA 2Q5JA 3FKJA 3PE6A 5KTPA 2H2WA 3SCZA 4R05A 3QV2A 1NY6A 4RGBA 4OXKA 3L8HA 1IAQA 1TO1E 3DUFA 5CXQA 2FLVA 2YMMA 1LPMA 3IIEA 2W6NA 2LUOA 3CRZA 1TZMA 2G1AA 2JFOA 3NGMA 2ZJFA 4XX0B 4BFZA 3HJTA 4WY5A 4ZHQF 1KFEB 5F2EA 1DTEA 2ZT6A 2AX4A 2QSZA 4ZGWA 2IBTA 4M1ZA 4EI8A 4JJ6A 4DCUA 3LPCA 3QVKA 2JIDA 1QQ5A 2G17A 3B52X 1G8KA 4FE7A 5CYPA 1JS1X 1IN6A 4FFSA 3E7PA 4Q24A 5KOYA 4YV2A 8ADHA 2QW1A 2YWGA 2DU8A 4J1SA 4AUMA 5C46F 4QT0A 1E2PA 1EBBA 3KOUA 3N6XA 3IKLA 4R9UC 3I8XA 3CBGA 4WTOA 2ECOA 2QX7A 3VU9B 4WKOA 3ZUGA 3MJEA 3ZY5A 4YP7A 5HKOA 3DZGA 3FNGA 3R6GA 2JFWA 2Y6UA 1H5NA 2AI1A 3LY8A 3V4ZA 3WY9A 4B09A 4BCBA 2B5WA 1EWTA 4C7VA 4FGSA 3V1TC 3IOCA 4B7ZA 4JLPA 1Z36A 3WL6A 4KO3S 5COAA 5KO2A 5DOVA 2EDCA 5IPFA 4E2WA 2YDXA 3DFKA 1WEKA 1R4NB 1XTZA 1YA6A 1N2IA 4DMHA 5DYGA 3DE2X 3BK1A 3VDRA 3KCNA 4IW3B 2BFMA 2EHDA 2OHFA 3AYZB 3GG2A 5AK5A 3F5SA 2OQVA 4KQ6A 1CNEA 5FBLB 7REQB 4L0DA 1ZP6A 4Y2VA 2H4XA 1K97A 3OTHA 4ZQEA 1LPSA 4D3XA 3DLAA 4FLEA 5ELMA 2VJNA 4PANA 4Q34A 5A71A 1EU1A 4U9IS 1CVRA 4X91A 3D3KA 3RUDA 1B15A 2BHSA 3H2HA 4LXQA 4R81A 5T8KA 3SXJA 2V3CC 4H60A 4DLYA 1RYHA 2ZWVA 3HVUA 3LPNA 1SBYA 1XXHE 3H4TA 1FSFA 4YUZA 5D86A 3T0IA 1WB4A 1YVRA 4FDLA 5EPUA 3CONA 2JGLA 4BV9A 4AO7A 1OBVA 1JDSA 1VKJA 1ODTC 1YDMA 2XVMA 4C7BA 1XTPA 3U49A 4BEWA 1PJQA 1LB1B 3MQ2A 3I0MA 2HMUA 4F85A 4H6VA 3UG6A 1C9MA 2YMPA 4XW2A 3K1YA 3ZCUA 2ZI5A 3OZRA 4D0NA 1HTWA 5BSKA 5CDFA 3R77A 5DZSA 2JFYA 3GYGA 3OHSX 4MGKR 1G7TA 4R9NA 2JBWA 2D8AA 2QUZA 1MRSA 2F43A 3KJGA 2I6QA 3DQQA 1QC5A 3FETA 5F64A 1WD5A 3GLHA 3SC2B 5H02A 5A02A 4B3RB 6ABPA 5EUCA 4E5SA 5H81A 3W6NA 4H9GA 4ODIA 4ZV4A 2Q41A 1LQUA 3IT2A 3CSDA 1QIFA 1VPLA 4KXXA 4D8UA 5KHOC 1WAMA 4DLSA 2D0OB 3GRKA 4Y6GB 3GD5A 1MG0A 1VLQA 3IIMA 4FT4A 1SU7A 2AG5A 3C85A 4KC0A 4Y0AA 4ER6A 4PM4A 5HK8A 1OZFA 4B8WA 3G8AA 5GM1A 3ZWMA 3SFVA 4TKZA 4NJEA 3TB6A 3DNFA 4N65A 1K5DA 4YRDA 5I7AA 1T2NA 2QM7A 1TM7E 1LXCA 2H0QA 3O7WA 5IHPA 3VNUA 1J1UA 1KI6B 4WKPA 5GADl 4HLNA 4JQOA 3ZIDA 3ZKAA 2WT9A 4JLJA 1SKQA 2LPMA 5BN3B 4MVJG 4C20A 5CBPA 1CRZA 1CS4C 4KMRA 3UBTA 4CQMB 1PLJA 2HT6A 3PUKA 3ZIAD 4BFLA 4OHPA 3ZN2A 3RFCA 4JHLA 3LQ4A 4MW0A 4BO7A 2GS9A 4NS4A 5CLHA 3RNOA 1Z2NX 3HMQA 2W6JA 4ESOA 4FZRA 4RX1A 5E6RB 1W2GA 4E5PA 3MMXA 2X6RA 3BSYA 4G0YA 4B71A 2FUEA 2OXTA 4JP8A 1T8WA 5JT1A 3J80A 4G01B 4RTNA 1FXUA 2OD9A 1JZTA 3QU5A 3THXA 3OM1A 3FTEA 3QHAA 2DBRA 1MJGA 2FE1A 3E9QA 3PGJA 4C04A 5LVAA 3TTVA 3ZOZA 2ZVJA 1MDFA 1YGPA 3IC5A 2FN4A 2GXSA 1GA1A 1NVFA 2QXTA 4XTRA 4L73A 2K4MA 4M49A 1JT2A 2A88A 4ZVNA 5TQ0B 3W77A 2W0MA 2DQYA 2ZQ5A 2CJFA 1MT3A 2AQHA 4LS3A 4R0MA 2ZJ0A 1ZVJA 3NASA 4X66B 4LZNA 4YJ3F 5G41A 2OXCA 2DEUA 2ZUBA 2IDMA 4JBWA 1EQ2A 1KS9A 2XCOA 2F1OA 1Z6TA 2GHTA 2HF2A 1UBUS 1R5NA 1LPBB 3Q10A 1OBOA 1V8OA 2J08A 2OYCA 1J9ZA 2OV8A 3LT5A 1DINA 2DR2A 5F2OA 1H3EA 4J7UA 1SUBA 4KQ1A 4WZAE 2ZYIA 1K6JA 1EVJA 2ICAA 4NONA 3ETDA 4C7JA 3BGDA 1QG2A 1QF6A 3KQNA 3TW0A 2ZKLA 3CY6A 4Z4GA 1D2MA 3BFVA 4W5HA 1D2NA 2HGZA 3G7UA 2PEZA 3P4YA 3ROZA 5LDDC 5C51B 4PINA 1E1KA 4CLXA 1X77A 1R7RA 3IESA 1LBIA 1P80A 4U7TB 4DSZA 4WJLA 3MGKA 2Z0MA 1D9ZA 1J99A 1GZDA 1TQ2A 3UJDA 3DMTC 3NM5A 4ZICA 1PFKA 3WB9A 1P81A 1XKXA 5JAOA 3CZ9A 4HUQB 4JLOA 3MG9A 3WGLA 3GW8A 4PLCA 3I5AA 3WRWA 5G1PA 1UQTA 2Z58A 3DW1X 2UVDA 5JZMA 1IQRA 4MHSA 2F1IA 2AEJA 2F8MA 3C6MA 3ETGA 2XQFA 2BSAA 3NPMA 3QV1A 3R7WA 1ZJJA 3PR1A 3CTVA 3MWYW 4A7PA 4MW7A 3VR4D 1F7VA 2OBFA 3B70A 1N5IA 2QN9A 2CJYA 2XNCA 1MJFA 1FFHA 2V7WA 1IIBA 2BP7B 3RARA 4A0FA 2I1WA 1VJTA 1LW6E 1PFYA 2R4QA 4PLZA 4YACA 3RVMA 2P2ZA 2ZIWB 1ZXBA 4PFQA 2VWHA 3L82B 4QTUB 2H9YA 5SY6A 3OIUA 1VHLA 2EF1A 2A1TS 4QUKA 4PPGA 1SUEA 1Z0IA 3NCHA 3OF2A 1FP7A 4N03A 3RRFA 1T26A 2YBEA 1C1HA 3BWCA 2TMKA 4ZT4A 1QVRA 4A0SA 3HP4A 3QKIA 4Q9DA 2JGDB 4FIZA 2MR6A 1G64A 4MI1A 1G9XA 1SBNE 2HOQA 3RKSA 4AJPA 1SCDA 3D3JA 2CXRA 4LYHA 2OV3A 3WWDA 4BNVA 1BWQA 5IZ4A 1XL1A 2W4IA 8OHMA 3EPKA 1E0DA 2PU5A 4MX8A 2EZUA 4OA5A 5EP4A 5FRDA 4LVCA 4BO1A 3LBIA 2WKSA 1X2EA 4WK4B 5J1TB 2GK6A 1XEWY 5LUAA 2CLSA 2GRAA 1FC0A 3LKZA 3IP1A 1T3TA 4GZLA 5REQB 3PHGA 3UXMA 2D2IA 3YASA 1GYRA 3TNFA 3H9BA 2PVSA 4REOA 3V97A 3LPLA 3ZQKA 3ANTA 1HT1E 2W2OA 1DOHA 2QUHA 1JU3A 1J2EA 1G42A 1SZCA 2WVGA 3H05A 1QTQA 221PA 1T9CA 5AJXA 1RYNA 3TRDA 1I3OA 4WEQA 2A5YB 5GGXA 1I30A 1IB0A 4IMIB 3U3DA 4ZN6A 3L7KA 5CH5A 1CG6A 1R1DA 4QAJA 2HA7A 2P9EA 2QOEA 1T5HX 4B82A 2J8ZA 3BXZA 4D4LA 1GTRA 4WRRA 4ZVPA 4LYFA 2I2WA 1RJDA 4RHTA 1UK9A 5B6JA 4D8TA 3V4VB 2ID7A 3GJ6A 3C1UA 5BT9A 5CA0A 2VWPA 1P18A 3DDNA 4IQ8A 5KYKA 1ZFNA 1YU9A 1C0IA 1ATZA 1QX3A 4LAFA 1AKNA 1GGEA 1JR6A 1R5OA 3ZXXA 3TLYA 3ANNA 2FX5A 3GMTA 5CDHA 1QK5A 2JCYA 1AD2A 2WWHA 3WI7A 3PFCA 3GELA 2WPNA 1MX3A 1AVTA 2H3EA 4GH5A 4KTTE 4UEOA 4WDQA 1WETA 3IV6A 3L4JA 1E2MA 3IPCA 3C5EA 4P80A 1Z6AA 1NOIA 1N75A 2PUBA 2HSDA 1XB2A 4MEBA 4Z4QA 10MHA 2IXBA 2ACKA 2X7JA 1TCVA 1R3UA 2V3VA 4EOGA 2WQ7A 2DRIA 1NJ5A 1N8SA 1VBKA 3RUAA 2PVPA 2NUPB 1C8LA 4DC1A 1QTNA 3TI7A 4NH4A 4XDYA 5IF9A 1EWQA 4D3DA 1FRZA 2CLFB 3DKKA 3PQ3A 4TTJA 1FTSA 5ECDA 4D02A 3OQIA 1CUIA 3O8QA 1NBOA 2FUG1 3ITEA 4IMRA 4M60A 2QZ9A 3I5UA 3E3MA 4R5HA 3UXYA 1T8YA 3ZX4A 5INTA 4EUEA 3OEEA 3PUVA 1DHTA 2YN2A 4WPGA 1VP3A 2C5EA 4KRXA 5FKJA 1BHQ1 1Q1AA 1WJGA 2QVGA 1RKBA 1YZQA 4LZPA 3WRVA 4OI0A 2XWJI 1U3TA 2VOJA 5ILOA 4JT8A 1SD1A 4ZRNA 3F6BX 4U7WA 3E5RA 4AULA 3G2KA 5IYZA 5A2QA 4FJ1A 1YB4A 4B2PA 4QUBA 4CTJA 1UKYA 4ALLA 1Y1QA 2ZULA 4GPAA 4O4JB 3VZCA 3HO6A 3L4KA 1RI4A 1X7XA 4UE2A 1OFCX 3PYLA 4W4TA 4MUFA 2WE8A 3JQFA 4B9EA 4Z2AA 1KBZA 1T4MA 1BN6A 2IYXA 2J31A 3MINA 4J0HA 5HIMA 4U7FA 5JNRA 2WFLB 2VEDA 5DI3A 4RVOA 4W6ZA 4DDTA 1LX7A 2ZE5A 2H1LA 1LF5A 1OJ7A 4NLLA 4IZ6A 5HCUA 5JMWA 3K70B 4UHHA 2X5KO 1RLIA 3H2GA 4OQNA 3FYDA 1RVV1 3I61A 1E1QA 5TMBA 3AYXB 5D7NA 5K3AA 3HK2A 4H7FA 1EXWA 5JCOA 1OFUA 4HHEA 2A58A 1AKTA 3FPAA 1MAAA 3I83A 2IYRA 2VS1A 1IMOA 1L5ZA 1UPUA 4Q3AA 4G5XA 4ZQHA 4C0HA 4YRNA 1XA4A 3DVSX 4NEHB 4EBBA 5BMOA 2QMQA 3MD0A 4US1R 1RJ9B 4HUJA 3H2KA 2BGTA 1JHMA 1FDWA 1JIXA 4KSYA 1HF3A 3WMWA 5I4BA 1NVGA 2FDRA 4FQ8A 4HMOA 2YV5A 5AOVA 1NDHA 4DQKA 3JQ7A 3FPBA 2C4KA 2OFFA 1DFIA 1KEPA 3P2IA 5FPSA 1IHYA 4P4SB 4TLCA 5DSZA 3PSHA 5LDGA 5T57A 1PBNA 4LWPA 3Q7QA 1KI8A 2I1LA 1Z35A 4ZZ1A 1Q6ZA 1D6NA 2J0QA 2XW6A 4WLNA 3H5WA 1EFTA 4YJGB 3RIEA 1KOJA 4LDJA 4EGFA 4HAVA 4MVJE 3VR3D 3EC1A 4ZT3A 3Q3CA 3DF9A 3VPCA 4ARVA 3IEMA 4FC6A 3BJMA 3P1JA 3QE0A 1LNZA 4B84A 1Y1LA 1B43A 1YDFA 5KKCA 5M7EA 4K9DA 4GP9A 1OTYA 1JKXA 1T2AA 1BEUB 4U2BA 4E51A 3O4IA 1Z5VA 3EGDA 2GYVA 4EI7A 2WWRA 3GMIA 1F1JA 2QX9A 1IQUA 5YASA 3C98A 1UBTS 3ND6A 2VR1A 1M34A 5CB0A 1U2EA 1X80B 2OP1A 1K7XB 1EFRD 3PDIB 4L5BA 4BNDB 4COOA 3DLBA 1DEKA 1RYZA 3CRRA 4OQQA 2DFLA 3MAAC 1R5BA 4ERNA 2OAP1 1FIUA 3MMSA 2HREA 2A94A 1ENYA 1GPKA 1RJ9A 2VPWA 4P36A 4PHHA 2L18A 1Z7WA 5FTWA 3AU8A 3IVCA 1BYIA 4TV9B 3NHPA 1GCAA 3ZGVA 2R11A 2RJNA 2V9PA 2YZ7A 5BQ5A 4ZCTA 5LBUA 2CE2X 2O0KA 3CT4A 1N4DA 3F78A 5GV8A 4ZJZA 3EGEA 2I03A 3NBUA 4PS0A 4QREA 1GSOA 1TDJA 4NE7A 5A04A 5JTUA 3FCSB 1NMYA 3JQ9C 4LDAA 5E9WA 2PFGA 1XMVA 5SY9A 3NI2A 3BKWA 1XPRA 3H7AA 5DCWA 3NIGB 1UUFA 4PO8A 2GHQA 1JZSA 2P9FA 5K0FA 1NRJB 3ZWDA 1ZMTA 4CMAA 5ECGC 2YRWA 1NLMA 4DIOA 5GWXA 2RD2A 3T7JA 5A9SB 1JIKA 1U7UA 3UAYA 5FADA 2WY2D 3W90A 1WB9A 3AKDA 4JT9A 2X1HA 2P5YA 1V96A 2V4MA 3N9IA 5EL0A 1GVHA 1NN1A 2IF0A 2JZCA 2FJ0A 5CX1A 5ESXA 4O5AA 1L1FA 3EQ9A 2IWHA 5AD1A 4EHIA 2QE7A 1ZNYA 2Z98A 1RTTA 1ULTA 3E9YA 3FVTA 3F6YA 2H85A 3NBKA 1T2UA 1WLYA 4KW7A 2B8WA 4U4AA 5K0ZA 3T1TA 3WDKA 1XU9A 4D82A 1YQQA 1CJKC 3A7EA 4JLKA 4XYEA 5FAKA 3ICEA 4HSGA 4JR2A 3JYOA 3IR7A 4YMVA 2D2VA 3S2ZA 4Z8YA 3LCVB 5HK9A 4TVOA 5MFZA 3MFYA 1A82A 1T8PA 3EIHA 2YCBA 1QR6A 3K2EA 4A0RA 4W7HA 3EGVA 1E9AA 5EINA 3LG2A 1JN0A 1Y4UA 4QBGB 2HXGA 4BECA 4DGSA 1C7IA 3REGA 5IUNC 1T8RA 3RG8A 2A5JA 1N2ZA 3R7DA 3GEEA 4BNZA 3K1ZA 4KU4A 3ZWPA 4H15A 1ZM3A 3NKVA 3LLCA 3SHWA 2NXNA 1GUDA 3DPUA 4BBAA 5D3MB 2GZ1A 2OA0A 3ESDA 3FFBA 4RNCA 1QO9A 3KFXA 2VAMA 4OHFA 4MLZA 1EGAA 1SCBA 3JYPA 4JT4A 4L8FA 1RKVA 1JDBB 3S4YA 1QIHA 4A16A 3PX2A 3U7GA 5B37A 2JGMA 2W37A 3OI7A 4OMDA 1Z47A 1X3LA 2UUPA 4AO6A 1QH1A 1YL7A 2JD1A 4JN6B 2H1CA 5GV7A 4LE0A 4KFSA 1T3GA 1U2TA 3FDXA 5CYFA 3MMZA 3UQZA 1BA3A 4CUKA 4EEXA 2CV1A 3KHKA 4WOJA 4WADA 4BRSA 3U9TA 2WF7A 4XIYA 3A3KA 2PLNA 4BP8A 1PYOA 721PA 3U60B 1OFUX 4PONA 2O8CB 5BN4A 1PKEA 3ZVMA 3JQ9A 1II8B 1UL1X 1G63A 3GV0A 4ND6A 1PP4A 1PT9A 2CLHB 3K7EA 4MP8A 3RDPA 3U17A 3VI4B 2FQYA