1ILUA

X-ray crystal structure the two site-specific mutants ile7ser and phe110ser of azurin from pseudomonas aeruginosa
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMSFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
molecule tags Metalloprotein
source organism Pseudomonas aeruginosa
publication title X-ray crystal structure of the two site-specific mutants Ile7Ser and Phe110Ser of azurin from Pseudomonas aeruginosa.
pubmed doi rcsb
total genus 35
structure length 128
sequence length 128
chains with identical sequence B, C, D, E, F, G, H, I, K, L, M
ec nomenclature
pdb deposition date 1995-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1iluA00
1UATA 1PCSA 3ABLB 4NB7A 1VLXA 2EILB 2GI0A 2JXMA 1R1CA 3QJSB 3CVDA 3GXUB 2FQEA 1CUOA 3FSZA 3N55A 3ABKB 3IE9A 2H3XC 6PCYA 3CZUB 2IDTA 1PF3A 3NJHA 4UF7C 3S3CB 1F56A 2BP8B 2HZHA 2MTAA 2BP0A 4ENZA 1OE1A 1MZZA 3T9WA 1E5YA 4FAAB 2PP8A 3OMAB 5LDUA 3X2QB 3PLYA 1AIZA 1J9TA 2J5WA 4BXVA 1JZGA 2I85A 1X9UA 1RZQA 4HALA 2VSKB 3CDZB 4A66A 4DP1X 2BZCA 2DV6A 4YSRA 4G71B 1XMEB 4L0PB 1SFHA 3NJLA 2EIKB 4UAHA 1NIDA 3MX0B 5B1JA 2XUWA 3NJKA 2FT7A 3NYKA 2CBPA 3WG7B 1L9RA 2AFNA 2AANA 1KBVA 5D4HA 5AZUA 2E86A 1MZYA 3S8FB 1TEFA 4TXVB 1NWOA 3V9CA 1A4BA 4CSZA 1MDAA 4BWUA 2FQGA 2JFCA 5I5MA 1V54B 3ZIYA 3FU7A 4BDVB 7PCYA 5IY5B 2PP7A 1RZPA 1AG0A 1XB6A 2X87A 2HX9A 1IBZA 4DP8X 2YAOA 1PNDA 3NSYA 4DP0X 1AOZA 3DKHA 4YL4A 3ZBMA 4A2DA 2W8CA 3QJQB 4G7RB 2BW5A 1GY2A 1A65A 1BXVA 1CYXA 2J55A 3NJMA 1DYZA 3PCYA 2XV2A 1AG6A 2GIMA 2BO0A 3ABGA 2GBAA 1QHQA 3OMIB 1X9RA 3QQXA 5I26A 2HRHA 4KOCA 1XB8A 3QJRB 4DP7X 1JZEA 2Q9OA 1SJMA 4YVUA 1FA4A 5PCYA 3WNJA 1GYCA 1KV7A 4KO6A 1ID2A 1OE2A 1IBYA 1HAUA 1PAZA 2DWSA 4DP4X 1PLAA 2BHFA 2XWZA 4E9QA 2ZOOA 2HXAA 4YSQA 3WI9A 2YXWA 2GB2A 3X1NA 4YSTA 2J57A 3ZDWA 3TA4D 1ASOA 1AS7A 1AZCA 1KBWA 1ILUA 2DY2A 3X1GA 2IH9A 3FQ2A 4G72B 1J9SA 1V10A 2UXVA 1NIAA 3NT0A 3OM3B 1JXFA 1BXAA 4N4YB 1JZHA 4E9WA 2YAFA 2ZWNA 4GP8B 1JZIA 4BXSV 4HCGA 4EF3A 3SQRA 2H47C 1WA0X 2FWLB 3SBQA 1URIA 1WS8A 3NJNA 3S3DB 3MBWB 1HAWA 4E9RA 1J9RA 2IAAC 3ASOB 5B7EA 1OE3A 2DWTA 2JKWA 2GC4C 2XXFA 3ASNB 1L9OA 2IDUA 4YSCA 3X1BA 3SBPA 1E65A 4DPBX 4DPCX 1WA1X 3EH4B 4FA7B 1PLCA 3NP4A 2XLLA 3ZX1A 1NINA 4W9ZA 2VM4A 3AG4B 1OCCB 1ASPA 2PPCA 4NAJA 1AZBA 5I28A 2QDWA 1L9PA 1TEGA 2YAQA 2FNWA 1ETJA 4GYBA 1JOIA 1WA2X 1JZFA 4HCFA 3AG3B 3IN2A 2VW4A 2FQFA 3FQYA 3OMNB 3IBOA 2ZONA 1KYAA 1AQ8A 4K9JA 2GHZA 2QT6A 3FYIB 2BZ7A 5ANHA 2X88A 5I6LA 1NZRA 3C75A 4HHWA 4E9SA 1I53A 1SF5A 2I7OA 4W1TA 4BWWA 4KNUA 2XV3A 3PAUA 2PP9A 2B08A 2TSAA 3CDZA 3S8GB 5AFAA 7PAZA 2XU9A 2XVBA 4KOBA 1JXGA 3PAVA 3DTUB 3HB3B 1EHKB 2XYBA 3KW7A 2HRGA 1CURA 3H4HA 1IC0A 2BP8A 1ZIBA 1RKRA 2J56A 1QLEB 1OCRB 3H4FA 1CC3A 1IKOP 2QPDB 4BK5C 1NDTA 2P80A 1PZCA 1AANA 4YSDA 3BQVA 4MFHA 3UGEA 1L9QA 1NPJA 2EINB 1PZBA 3PAZA 2ZXWB 3X1FA 6PAZA 3H56A 4G70B 1RCYA 1SDDB 3GDCA 2YQBA 2PPDA 2UXFA 1ET8A 3GYRA 3T6VA 1M57B 1ET5A 5B1KA 2FJSA 1A8ZA 1SNRA 3NSCA 1SHWA 4GXFA 5TK4A 3FYEB 1BQRA 4HIPA 4N8UA 1SF3A 5PAZA 1OV8A 5TK2A 2AVFA 4YSPA 2XX0A 4E9XA 1L9TA 3D12B 1J5CA 4YSUA 3NJJA 1PY0A 5D4IA 2DYSB 3QJVB 2YAEA 3KW8A 1CYWA 1E67A 2UXTA 4Q89A 2CCWA 9PCYA 2FT6A 2UX6A 2PPEA 2W88A 2IDQA 3ERXA 2Q5BA 1EZLA 1NIEA 1AZNA 3AW5A 3FU8A 4DP9X 4DP6X 4JKNA 1A4CA 4NERA 1AS8A 5AKRA 3DIVA 3EH3B 2R7EB 1A4AA 3UACA 5I6OA 1KDJA 1GR7A 5I5IA 4X4KA 2YAMA 1FFTB 2Y1AA 3HEIB 1XB3A 3RYMA 2IDSA 2PCFA 4GP5B 1GS8A 1WAEA 1QNIA 2H5UA 4P5SA 1GS6X 3X1EA 8PAZA 3TBCA 3TU6A 2PCYA 3T6XA 4KNTA 4KO9A 5I6PA 2VN3A 5B1BB 4YSSA 3EF4A 1E30A 5D4JA 4AX3A 2CAKA 3PXLA 2A3TA 2CALA 2EIJB 3AY2A 1GY1A 5F7BA 4YSOA 4QLWA 5B3SB 3NJGA 5EHFA 1OCZB 2UX7A 3OQRA 1SDDA 2QPEB 2YXVA 3IEAA 2PLTA 4BWTA 3EHBB 3TASA 1JERA 2VW7A 3CG8A 3SBRA 1KGYE 5E9NA 3QJTB 3L45A 1SHXA 2TSBA 4KNSA 3WIAA 1AZUA 3CVBA 1YLBB 2VM3A 2P80D 1T5KA 4WKXA 2YARA 3JTBA 1B3IA 1KCWA 1ZIAA 5B7MA 3FT0A 1AAJA 1BAWA 2YAPA 2Y69B 1ZPUA 1OCOB 4A67A 3EH5B 2OCCB 4F2EA 1E5ZA 3FS9A 3V9EA 5I6NA 1AZRA 2OJ1A 3FSAA 3AG1B 4A68A 2PPAA 1BQ5A 4RH4A 1FWXA 3PPSA 4A2FA 1J9QA 1IUZA 5I5JA 1NTDA 4G7QB 2AZAA 4DP2X 4AKPA 4KO7A 4HZ1A 2MRYA 4E9YA 1TU2A 1KDIA 3UAAA 4A2GA 2N0MA 4AKQA 4JHUA 1ILSA 3JT2A 4YSAA 4M3HA 1W6WA 4AI7A 2BWIA 2GSMB 2BP0B 3AG2B 1OOWA 4BDVA 3FPXA 5A7EA 1BEXA 1N70A 2UXGA 1A3ZA 5B1AB 2VSMB 2R7EA 2VMJA 1W6LA 3UABA 4HAKA 2WO3B 1WS7A 1ET7A 3WNIA 3FU9A 4PAZA 1J5DA 1ZV2A 2IDFA 1JVLA 4AZUA 4YSEA 2IWFA 2HX8A 3NJIA 1BQKA 1NICA 2AZUA 4WTQA 1BXUA 1DZ0A 3AZUA 3NSDA 4DPAX 4Q8BA 1NPNA 4E9VA 1JVOA 3WKPA 3T6ZA 5F7AA 5FC9A 1AACA 2IH8A 2GC7C 1MG2C 2HLEB 1W8EA 4A2HA 1PZAA 3FU7B 2IWEA 1V55B 4P5RA 4QKTA 3FPYA 1GSKA 3TBBA 3T6WA 4JHVA 2XXGA 4F2FA 1M56B 2FQDA 3BVDB 4HHGA 1TKWA 3QJUB 4KO5A 4YVNA 5I6KA 3NJFA 1JZJA 1NWPA 2XV0A 1ADWA 2WO2B 2VW6A 1MG3C 3FSWA 1BYPA 4A2EA 3NP3A 1ASQA 4AKOA 3FSVA 4GP4B 4ZK8A 4PCYA 4UANA 1JXDA 2HX7A 4E9TA 3UAEA 1N68A 1ZDSA 3NSFA 1KCBA 3N2JA 2LLNA 1PLBA 2YAHA 2CUAA 1PNCA 1SFDA 2FT8A 2QDVA 2I7SA 1GW0A 4HCIA 2BWDA 4F7KA 1AR1B 4CSPA 4G7SB 2DYRB 4DP5X 1HFUA 2IWKA 3G5WA 1AS6A 1ZDQA 3CVCA 1L9SA 1PMYA 1NIFA 5I6MA 5B1JC 4M4RB 2EIMB 2CJ3A 3IN0A 3OD3A 3ABMB 3U25A 2PPFA 3FQ1A 3S3BB 3T71A 3UADA 3QPKA 2XX1A 5B7FA 1M9WA 1OF0A 3WKQA 4GY4A 2RACA 1BYOA 1GS7A 1NIBA 2OV0A 2NRDA 2WSDA 2FTAA 2B3IA 2BW4A
chains in the Genus database with same CATH superfamily
1DZBA 3KVPA 5CJQH 4NB7A 2WQUA 4N22A 4XTRD 3AB0B 2NY5L 2GI0A 5FHAL 3OAWA 3OJDB 4M6NH 3LRSA 4WUUB 1KEGH 2NNFA 2NCMA 3VI4B 3BVNB 3ZDYB 3GXUB 2XQBL 1TQTA 2X1XR 3WKML 1R5WA 4FXKB 3GTNA 5CGYD 5DTFB 5LQBH 2BXYA 5HHMD 3BESR 3U6XA 4N1EA 1E4HA 1XVSA 3DDFA 3DROA 3BCDA 2FD6L 4HC1H 3H6JA 1AGFA 1G0DA 4WCYH 2D7NA 3WGUB 1G9ML 5IG7A 3FT4A 2X4TB 1AIZA 3Q2WA 5C0AA 2APSA 3SGDH 3X13A 3U4EB 1JMZA 2WZ0A 4YE0A 3U0TA 4XC3H 1T4KB 2BZCA 4FKKA 4RCAA 2XN9B 4JO3L 2B1AH 4I7ZC 3K6IA 3MX0B 3PJSA 1FZMA 2VNCA 3OZLA 3ATEA 4NP4H 2EICA 4DKFL 4BH7A 1BXXA 5JZ7D 5EBWA 5TJWK 4HH9B 4LCUB 3RDTB 4KKQA 3MRIA 3MUHL 1NAMH 1KCUL 2BVPA 5KSBA 3FCSB 4JRXA 2WMPB 4X6DB 1RZKH 2WNKA 4L18A 1J1OH 2R69L 4B9CA 3W5MA 2HVKA 4HKXB 1IZJA 4UWQB 3ZKMC 1HZLA 3ECBB 2QLYA 4Y4FC 5T3XL 3STZA 3TO4D 4ACTA 3B6SB 3KVDD 1S2EA 3HE6D 4TKWA 1EO8H 3FO0L 2GY5A 2GTWB 2ARWA 5KUMA 4N2DA 3QZPA 3UG5A 5LKNA 4B5ZA 1P4IL 2AJXH 2A83A 1YCSA 5GRXG 2FWUA 3L7FA 5I75C 2AW2A 2VITA 2XETA 2JTDA 4R90H 1HT6A 1WZKA 1U58A 3DK0A 4FX5A 3F12A 4JO2H 2I9LA 4IBLT 3ETBF 4LSUL 4PV9A 4QY8B 4MD4B 5DHVA 1SXCA 5D72H 2Q9OA 3HTLX 4YDJB 1YEFL 1F90L 2AF2A 3H2WA 4HUWA 1FI8C 2UZIH 1N0LB 4KO6A 4HSAC 5ERWB 3BWUC 5E2WL 43C9A 1BVKA 4JGNA 4YZWA 5FYJH 3T3MF 3BIKA 3NZ8B 2FYVA 4H7VA 3MJ7A 5HJBA 2N01B 1W0VB 2CSPA 1E0OB 5JZ7C 1J1OL 1CD9B 1J86A 3RWGA 1XR9B 3BEWA 5K1JA 4LHUA 2IMMA 2X42A 1U3NA 1WQVT 3P4OB 2EDEA 2OMXA 3B2DC 2HVKB 4LBAA 1PKQE 5HDBE 1OM3L 5KSUB 2ALWA 2UXVA 3C5ZA 3DGGA 1IJ9A 4TTDC 2DQ6A 5D7IB 2BSTB 2IAMC 1SBSH 4R7LA 5F7EH 3DVGB 4N4YB 4F2MB 3C5JB 4O58L 1N18A 5IM7B 3Q9QA 5DD3H 3GSUB 2V2TB 2GSIB 4LSUH 2IFFH 1CLYL 1KTLB 2DWEA 3D3VB 3LS5H 3FB8A 4J4PA 4WSGA 5C71A 4ZTOH 1NMCB 4PB9H 4PUBH 5JHDE 1QEWB 5E2WH 1WF5A 4LF3A 3QORA 3D2UA 4U3SB 5I8OL 1LNUA 3DX8B 3BLPX 3QARA 4M7LH 5C0AB 1TXKA 3CLWA 3BISA 1EERB 5EMYA 4HLZG 3MRKB 3OAUH 3ZY7A 1AHWC 4Z7VE 1K8DB 2D4DA 5FUZH 5EIQA 6CGTA 1U9KA 1K8IB 2X4UB 2MQGA 4IOSD 4HCFA 4OKVB 2OZ4H 3BP7A 5DTFA 5E2UL 3SKOB 1Z6JT 5D2NC 4UTAA 2HFEA 2FJHB 3QNZB 4H13C 5BZDB 2VE6B 2E59A 5JHLH 4PV8B 5AAMC 3GZPA 3M1BB 1HHIB 5AAWC 2WC7A 4JHBA 5BW7A 3TBWA 2JJTA 2AAVA 1XD0A 4NCDA 3KR3L 2BNUB 1ODAA 5GGRY 2JIXD 1R19A 3TVMB 1NGZB 1UB6A 4JFXB 4JCLA 2ZYHA 4JW3A 4CN6A 1Z9SB 3CZKA 3FUEA 1F0LA 5GS1A 4X7DC 5I1KL 4POUB 5IMOA 4OIBA 5AFAA 2V2WA 7PAZA 2XU9A 5TPWH 1QWHA 1AGCA 2F8VA 2GIXA 4F58L 3PAVA 4GEIA 4XOBA 4ZG1A 3NFNB 3MV7A 5GGSY 1QRNB 1INQA 2PW2A 3LN4B 4IBWA 4L8BB 2BSED 3H4HA 1MW2A 2CO3A 3TT3L 3S96B 3TF7C 1MRFH 1AKJA 2BIQA 1BAGA 4NKMB 4L05A 3PDOA 3GKZA 1Z9MA 1H5BC 4HUKB 2X4PB 4JFDA 1H3VA 2P80A 3FDWA 4MWFB 5IB4A 3WO4C 5IEHB 1CFNA 1CT8B 4FNPA 1PD6A 5HVWA 3UJJL 1IARB 1B9KA 5HHPA 1BMZA 3LQAC 4HIEB 3WUWG 1C5CL 2FIRT 2ZXWB 1UJTA 4GS7C 3ZQXA 1JHTA 2B3RA 2BPBA 2E4TA 5I0WA 3HBZA 4LLVA 1QUNA 1UCTA 4L8DA 3IXTA 5KBLA 1ITBB 1DBML 1IFGA 2FJSA 4AT6B 2C9VA 1IFRA 2R0ZH 3FTSA 4FG0A 4XOAA 3ZE0E 4L0ZA 4QRQB 2MWCA 3MBXL 4TNWF 3WIHL 3ARDD 4Y5VC 2BNQB 1KZQA 2XNAB 1W0WB 5F7HA 4YXKH 1NFAA 3IU3A 5PAZA 3GLDA 2W07A 3QG6B 3UTTD 2CO1A 1RERA 1MRFL 3V4PB 4G8FB 3KBFA 2YQ3A 3SKOA 4HPHA 2F8OA 3VD4A 4HA1A 4QRQA 3BQUD 3L3GB 4PVMA 4K3DL 4P2OC 1G6RB 3FQNA 3EW3B 2KZ1B 1IJNA 3BDBA 3CQPA 4FXGC 4EZLA 2YD1A 3AW5A 1WBYB 1I82A 3B9KB 4HLZH 4YGVA 3VXQB 5KYWB 5E1AB 3BEVA 2F7QA 3LEYH 1M3JA 2ZSWA 2WLIB 4ODWA 4BFOA 3SJVD 2J8OA 4P04A 1G7MB 1LO4H 3BD4A 4ZQKA 1PZUB 3DWTA 3C6LC 4KXAA 2F7RA 2W60B 3DPBA 3FRPA 1KYOJ 5I6XC 3WXVH 1IU1A 4R0LC 1A0QH 5AVXB 2ZAHA 5D7JD 5T1LD 4EVNA 2Z34A 4Q9RL 1ZMYA 4KJWD 3TBCA 2H2SD 1VAHA 2Y36H 4ODHL 4QR7A 1OAXL 4P4KA 3H9SD 1HU8A 2VLRE 1YEHL 5EEYA 4AGQA 3RP1A 2JNZA 4KKPA 1DBJL 1NGWA 5JQ6L 2J21A 2DQFA 2OZNA 4PRPD 3BAEL 4FQJL 1NCWL 2WXFA 2AKRB 4Y4HB 3T04D 3BT0A 4H8VA 2VZUA 4H2CA 4WW2B 2W65A 3IETB 4FYSA 5GGVH 4UYPA 1O7DE 1ZS8A 5H94A 5DJAA 4GT7A 2HJKB 5I15L 3T1FB 2UY7B 1RUAH 4WGWB 3L3OC 4BWTA 5DQDH 3CG8A 4UMSA 1KGYE 2GJZA 1E9OA 2DLFH 5EIVA 2HFEB 5TTRA 2LTQB 4JN1L 4JHZA 3SZ6A 1ZT4B 3MROA 5KVGE 5FV1L 2P8MA 4OD3H 1QYGH 1S8DB 2BK8A 4GG6E 3D52A 4H44C 4OZGE 4FNQA 4PLKD 1BAWA 2AJVL 4KK9D 1LO5B 1OCOB 1RJLB 5FYKE 2O6DA 3V9EA 2PCPA 4B96A 2OK0L 1QFWL 3DJZA 3VI4E 1DBJH 2MEJB 3PWJB 4A2FA 1CK0L 1J9QA 4KVPA 4PJAA 2KI6A 1EGJA 1CXFA 2XYCA 3QAZC 4M6OH 2L3BA 3WOVA 2WTRB 1V05A 2F15A 2Y5QA 1G7HB 4X4MA 4NKOA 1P7QB 3EOBB 5D7JB 4PGBB 1KJ2H 3C2AL 5D93C 2V2TA 4WGVB 3MLSL 4DPRA 5CGMA 4RIRB 5E6UB 2WIIB 2WNWA 4MKMA 3B9KC 4PD4J 2E9GA 3LN9A 2F61A 1GSMA 4HJ0C 4QRFA 3RWJA 1U30A 3LQZA 2X4RA 2XN9E 1KJ3L 2XG5B 1CFQA 2WVSA 3GUFA 4HIXL 4NRYA 4CVUA 5J1TC 3D2UB 1BXUA 4ORZC 1FFPB 4N20A 4OF3A 3CSPA 4OIIL 2ZOKB 3PWPD 3QC5X 4ETQA 4Z78A 2E7LC 1P1VA 5FR3A 1P4UA 5BVJB 2DWDA 3NIFB 3S2AA 4LLAA 5I0VA 2XWCA 5K1NA 4Y16A 1BFTA 3ZU8A 3D0VA 2AXFA 2BVQA 1CVRA 5FHAH 3EFOB 3EOTH 1FAIL 2WSKA 1WWWX 3MV9D 4TLSA 4RMWA 4M6OL 1UD8A 1EHNA 3V5DB 1ORSB 1Y7VA 2D3VA 2OBGA 2VXVL 1RZGB 4I9WE 5GRZA 1JPFA 2CKBL 3HS0A 1NWPA 3JTSA 4JRFA 5EN2B 4ENEC 4AYBA 3QFGA 1UD4A 2OXHA 2DEXX 2VXQA 1YUHB 1M53A 3P4OA 5ANME 5AW2B 5DC2A 2D7MA 3U36A 3F58H 4WO4D 4GOSA 2ZPKH 2L8AA 4UTBA 3APDA 3L4ZA 4E0RB 3GMPA 3IVKB 1U3ZA 4OLXL 3VA2C 1OP5K 3GT6A 3BPLB 3WYRA 5AW6B 3VFWA 1OB1A 2BLFA 1GW0A 2QGDA 2WZAA 4DP5X 3MRNB 3O6LL 3GLZA 3I6LE 5KSBF 4LCYA 4TV3A 4EBQH 1OAKH 3W0WA 4JFYB 4F93B 3VMPA 2P24B 3S3BB 1XHHA 2XZCL 1SJVA 4NKIH 4I18A 1KCLA 3V0WL 1MFUA 5B7FA 1RPUA 1I7ZA 3WJLA 5D1XC 5EU3B 5D5ME 5FW6A 4OZ4A 3US9A 1YHPA 2BHYA 1EAJA 1DVTA 1YMMD 5I19L 1P84J 2AEWA 5IQ9B 4KY1H 3HA0A 4JQIH 1TVBA 3IDUA 4M7ZB 5IVZA 4XZ4A 3VFGH 1JF6A 2ED9A 3RPKA 4R5VA 4LCCA 5KANI 4NKQB 3QJSB 1XXFC 3QFDA 4H0IA 4Z8FL 6FABL 1J5HA 2F53A 1MCJA 2FQEA 2X4TA 1WICA 3FT4B 3NIGF 4GBXB 4HGWB 4MQSB 4IBTA 4NNYA 4ODVL 3QZMA 3GSRA 1I1AA 1QZNA 3PJNA 3ZKNC 3B2UC 3O6FC 4HBQA 4MZ2A 1CJYA 1DFBL 3UZEC 3ZGIA 1UH3A 4MDIA 3VD5A 2NCEA 1MZZA 3ILEA 4CN1A 1E5YA 4A7TA 4FAAB 1R5WB 5CCKH 4EBQL 2CXKA 2HYMA 3MKGA 1TMQA 2HT3C 3DX4A 5FXCH 4CSSA 3GMNA 2YZ1A 4PGCA 3N1QC 2AJ3A 2DV6A 3LV3B 3WCYA 4UM8A 4M62H 2I60L 3LZRA 4FFWC 1LK3L 1QPXA 4JL1A 2HH0H 3LIZA 1DBBL 4MCMA 1YN7B 1LO5A 3PL6A 2X9WA 4U3CA 5D4HA 5EUOB 1R3LA 3LD8C 2ZUVA 2BP3A 3GI8L 5CEZL 2H3KA 3CN0A 4Q6IC 1J8HB 3H8NA 5ESQA 1YPZB 4JG1H 3ISYA 2E9JA 3LHAA 4ONHB 1T0OA 3HG1B 4PM1A 1VENA 2JFCA 4ODXB 1DLFH 4QLRA 2CRYA 2ORBH 3K80A 3P3UA 5F70A 1V54B 3EFOA 1VF5C 2W0FA 3LHPL 4DW2H 2VDOH 3MV11 4BDVB 2O61A 5CMAB 1Q0YH 1QD0A 2OXGB 1RZPA 1WYJA 2YPVA 3EDKA 5BCAA 4DP8X 1ZLEA 3SHSA 1IM3D 1JDCA 1KPRA 5DQJA 4Y9CA 5DC0A 3SE8L 2PTVA 4ODUB 4G7YH 1MPAH 2XZZA 5FOBA 5F6IB 3TH4T 3MBEC 1MY7A 5DK3A 3OBAA 5TE7L 2BH0A 3UDWC 2GIMA 43CAB 1EFXB 2BRRH 3FK3A 1XGYL 1MFAL 4I0PA 2Y2WA 1BSIA 4GBXD 3P54A 1MDTA 4KOCA 1KXHA 1NC4B 4MAYB 1WZ1H 2ICES 4L8SA 4WJG3 1EJ8A 1ORQB 5PCYA 5FDWA 1FF5A 1YDPB 5DO2C 1YEGL 1F3JA 1BGXH 3HNVH 4E9QA 2ZJSL 3QR2A 4D0DA 3CFIC 1IAIH 3KHQA 2GY7B 3K71A 3WE6B 4ODWB 2XXCB 3LH2L 4H2AA 4UT6H 4O4YH 4FFWD 4YHYC 3ZE0B 3INUL 2OTPA 4TNGA 4JPQA 3PE9A 1E40A 3D9AH 3UO1H 1OAUH 3RWHB 1SDAB 2QVTA 3MNDA 3MTRA 4FI7A 3TYGL 1XX9C 3V4PH 3WFHA 4BZYA 5E24E 1U8NA 2IOIA 1GKOA 5AAMA 1PY9A 4Z7VA 2HN7A 2FATH 5T3ZL 4HXAL 3D25B 3MACH 5DZLA 3HI6H 1URIA 4PJDF 3NJNA 2V9QA 2JMRA 1H0DA 2BS9A 5C8JA 4QCIB 1OL0A 5C97A 4LASL 1A7RL 5B7EA 1LL1A 4NPKA 1MCIA 3VXRA 4Z0XA 2V5YA 3C8KA 3TWYA 1U8NB 4FFYH 4H4NA 4JPWL 3TC9A 1B88A 1K8DA 2J8UA 2WQAA 5IFJB 3SBPA 3GIZH 2DF3A 1AZZC 3QWOA 5EU6E 4J28A 2Z1PA 3FUHA 2CR3A 4MMXA 1XF5A 4WEEA 2OP4H 2OX5B 1WHOA 3I85A 4A55A 2D31A 4JEGB 4RMUA 4U3SA 2DJUA 4JZOB 1GGIH 1LO3H 3NSJA 3DTDA 1BQHB 1MJ8L 3P3YA 2QV2A 5FO8A 4YAQA 3ZMEA 2ICEC 2VDKL 4JO8A 3EYFA 2GK0B 3A0OA 4X5WB 4ALAC 5SWSE 4JDVB 4K94H 3L81A 1T1YA 4XMKH 5I6LA 1NZRA 1F97A 3W56A 4FA8A 1K5NB 3FB7B 1ZANL 1BOYA 1XR8A 1ZV5A 3QQ9D 5T1MB 2B08A 1G7PA 5MP6L 3MZTA 4OLVH 3VXMB 4MA1B 3ULUE 1FDLL 1BM3H 2VDQL 4OFKA 5FEBA 1NCIA 2PMZA 1HEJC 2Y6SD 5FCUL 5A1AA 1SJEB 3AWEA 1P7QD 2WJ5A 3I3BA 4V1DD 3C8KB 2A74B 2VDQB 1G7QA 1GZHC 3S98A 5F1IB 2XYBA 3OKMB 2MFNA 3FL7A 1D6EA 1ZHKA 3HI5H 3VFNA 2ETWA 4AH2A 3II1A 1XV8A 1LO4L 1OCRB 1QLEB 3H53A 3VD1A 2CKNA 3L1FA 4GG6B 3QWQB 4B0MM 2QQQA 3EG9B 4L3CA 3P3RA 2JB6B 3DBXA 3UXFA 2ITEA 4OZHF 2VDKH 4YDJA 5D2LF 2H6PB 3GXMA 5C3LD 1C12A 3X1FA 4L9DA 4NWUH 2ZP9A 4HJJH 4XTRC 3PS6A 5ESVB 4CGUB 1E3FA 32C2A 1SDDB 4JFHE 5DJCB 4HAGA 5I1GL 2R0LH 3DHMA 5LCVL 5JQ6H 2AEQH 1S7UB 1M57B 1ET5A 1XGQB 2P3YA 3ZTNL 2XWRA 1T89A 2N59A 4FYQA 5IB4B 4J3OC 5TK4A 3S3SA 5KVEE 1UZGA 3FYEB 4YE4L 3FHEA 4U7MA 4ZW6A 4TSAL 3RNQB 4B0MB 1N7ML 1Q94B 1RZ8B 2J1WA 1BBJA 4EI6B 1CG9A 2OYPA 4YWGL 3O8XB 2XX0A 4L8SB 1OP3H 4ZFOL 1IGJA 5F6HI 3D87B 5I17A 2R0KH 1FL6A 5CJOH 5A2JH 2EDRA 4FXLA 1JAEA 3CC5A 3SKNB 2DLFL 3D07A 5CJ8A 4MNHB 4CU6A 2HCZX 4H5SA 4PFEA 2UXTA 1R6VA 1LDPL 2IAMD 5K9OB 2E8YA 4JQXA 4PRIE 3LY6A 3EGSA 3N44F 2B2XH 2UVFA 3RVWC 2NDGA 1XF2A 1HKLL 1N8ZB 2TAAA 2VDLL 4TULH 4UNVA 1H3UA 5GZNC 3BMWA 2DI9A 4U1GB 4C8XA 4NN6B 3V5HA 2MOQA 1HCZA 1NC2D 4HWEH 1GL4B 1UACL 2AEQL 1MEXL 4LLDB 2XBZA 1J1PH 3RWJB 2XWTA 3MCG1 4YHKH 4LVEA 2XQBH 3VRIB 3M45A 4YE4H 3GHPA 2V3DA 3MYJA 3EBAA 5SWSD 2B4CL 1WC7A 2OL3L 4EAEA 5I6PA 3SPCA 1MHPH 4Y1TA 4GBXC 3IWVA 2H8PA 3PXLA 3S36H 1SLWA 2AC0A 2DH3A 1CTOA 5IBTH 3O9WD 4X7FC 3O0RH 3BUYA 2WP3O 1A64A 4HJ0D 5DS8B 4QRPB 4GG8B 2WAQA 4IGBD 5IMLB 1J0KA 5IB1A 3VXRD 3ARZA 1AGEA 2JIXA 4EIUA 2P52A 1UQSB 4R9HA 5C2BL 4LRNH 2CE6A 5AYUH 1D2PA 3Q8AA 4PRHA 4R8WH 1HHGB 1QBAA 5J12C 5ICYA 3HN5A 4ZXBA 1U8HB 3WTTA 1SHXA 2TSBA 4Z3FA 1ZVYA 3EOTL 3QEUB 3VSQA 4WKZB 4IU2B 4DJMA 4KQ4H 4Z0BL 4U1MB 3TA3A 3TN0B 4NS0A 1O6TA 5ICZB 1UM4H 3ULVC 4Y16B 1F6AA 4HIIB 1QWUA 2DMGA 3IFPB 4PG9A 1X5GA 3J2PA 1SEBB 3CFTA 3EH5B 4PMEA 4HQQL 1U8IA 1H6UA 4GQZA 4NM8L 3S5LB 5A2AA 2J6EA 3ZSSA 4YHLL 3AADB 1IEAB 4BHUA 5H8DA 4D7PA 3SO3B 2ZPKL 1CL7I 1N10A 4G6KL 4WKZA 4LKCA 1KTDA 4FFZL 4DEPB 3CXDH 4DKAA 4YUEH 2WB1A 4S1QL 1ILSA 2ZP8A 4W6YB 5DT1L 5C0FB 1W6WA 2NY2C 1G9MC 1ZEAL 3KLQA 5DS1A 2X9XA 2J12B 1RUQH 1HHJA 3MAWA 4FTVA 3OSVA 1UFGA 4DQAA 3FPXA 5FV2A 3ZQ9A 4BFFA 3K6OA 2VSMB 3WUZA 2R7EA 4Y2OB 4PJIE 4UT9A 3FOMB 1T5XB 2YN3A 3UTSE 2X4SB 5D1ZD 3WSQL 4G8EB 4K3GA 5KN5A 2IDFA 5FYJL 1J8SA 3V0VB 2X44D 2A6IB 1NICA 3O9WC 5AVUB 3CAFA 1UUNA 3BX7C 1UM4L 3QWNA 1HS6A 2E9BA 3KL5A 1PIGA 3HZVA 5EUOE 1JVOA 2CLZB 5E1AA 5LLIC 4KY1L 5EU4B 4HQQH 3PWLA 2G9HB 1W15A 1KIPA 3RU8H 3W38A 1JRHI 4YHLH 1I3RB 3ZDZF 3RIKA 3PV7A 2KZBA 3HBQA 2VXQH 3JV6A 1JUFA 1MWAL 1S7TA 3OHMB 2QTEA 4ZQTA 3QPXH 3K4ZA 4JKLA 1M56B 2OMUB 4S1QH 3NDYE 1HEZA 3RGVD 4PJIA 4U7KA 3SYOA 1QTPA 4ZUSB 2BOCB 4IRZL 4NRZB 3QUZB 3ZL1A 5B8CB 3LS5L 3SDDB 5B3JF 4OV6F 1T1WA 3DVNB 4XBGB 5ETUA 3D3VD 4WI3A 3FQUB 1P6FA 3TN0A 4TUKL 4U1MA 3TA3B 2KH2B 3VXOB 1XQ4A 2BOLA 5SX4H 4NOBA 3P40A 4EI5C 4H0HB 3F83A 3OF6D 4P2RA 2I7SA 1KYDA 3A24A 1PZDA 5I8KL 5CN3A 1RUPL 3TEWA 3MCLL 1JCVA 2RMNA 4OI9A 4XC1L 3HR6A 4LAQH 3CHRA 4Y5XA 1I4FA 2JI2A 1AH1A 1VADB 5E1HB 1AGEB 2JIXB 3VXSE 3QUZD 2ZP0T 3FMGL 2D2CC 1JV5A 3UBFA 1U3YA 3FQ1A 4KZ0A 2CKBB 4P2QA 5DRWB 3ECWA 3SDDC 5K9JH 5IK3B 3DX6B 3SCMB 1E9PA 3OHXC 3Q06A 1NC2A 2BC4B 1Z3GH 1JF5A 1VZIA 3KGTA 4MMXB 1G7IB 2BW4A 1E5UI 4ZSOA 1BG1A 3CLEH 4XVTL 1DL7H 3B83A 3OC8A 4YGVB 4M8QB 5E00B 3BDYH 2WWMD 4NUGL 4HXBL 4JRYA 1E8ZA 2UWEF 5FLVA 2VKXA 1GGTA 5KVFE 3WJJA 4W81A 4XXCC 1MNUH 2RA1A 3N55A 4BZ1A 3QGVA 4Y2LA 2VDPH 3I6SA 2IDTA 1SJXA 3F7YA 3RIAF 4XAKD 4DGUA 5KWYC 3M1BA 1MN4A 3POCA 3MCLH 4ENZA 2GBUA 1XH3A 4Q2ZB 3O9WB 4IKKA 2GQHA 1F8TH 4IBVA 4MNGA 1N6QH 3G3LA 1HNGA 5DJYA 3X2QB 4S1RL 3R4RA 3TT1H 3BKJL 4Z7NE 4WV1A 4QWWD 4OT1L 1IILE 2KLRA 4ZOBA 1BGXL 3MXWH 1M9SA 4W9CC 2ENQA 4UT9L 4XN1A 3S5LG 2ZJSH 4F8QA 1DSFL 5EEWA 3NA9H 4WRLA 1D7BA 2SEBA 4N2BA 2FT7A 2NY7H 4KUCF 1MOEA 2H26A 2C4FT 3UMNA 4IOIB 1TJIL 1S3RA 4Z7OB 1OXYA 2ADJA 5IKCA 3INUH 2AAAA 2PO6C 5KSAC 1NWOA 4NUGH 1MDAA 1QI3A 3WFDH 2D3LA 3PGFH 2J3SA 2QTVA 1HQ4B 1IAMA 4N1CA 1JWSB 3KNBA 3KS0J 1WE5A 2BINA 1AGBA 4F91B 4XRCA 2ZYIA 1N12A 3N6YA 3PGCA 4U1SA 4F1ZA 5J1AB 1IGCL 1YY9C 3BP5A 2B1OA 4R96A 4FLHA 1I7RB 4NIYE 2Y7MA 4PJXF 3H9SE 2NNXA 1IC5H 3MCKA 3L9YA 4J3WA 3F2LA 5E8DL 5D9SB 1KB5B 1S9YA 5TQ2H 3NJMA 4IQHA 1J10A 3CFDB 3O8XD 3VSVA 3L17A 3UYRL 1VCAA 3BPOC 1G7IA 4ZSOB 1PLGL 1YY8A 3BSZH 3DTXB 3MV9E 4NC0B 3NRPA 5DLLA 4F7CB 1X9RA 1HHIA 5E2VH 3SDXF 3MA9L 4JY6A 4HUNB 3WNJA 1OF2B 4AK2A 3MRPA 4C56A 4CMHB 1FIGH 2K6ZA 4CNIB 2RAMA 1V3MA 3HRZB 3BAJA 4XCCL 1HAUA 2MMXA 3H1ZA 4LPCA 4UM9A 4Y2DD 4ZFQA 5KYUB 2WZPD 4X5XA 1AP2B 5KZCD 2G5UA 2EDWA 1TQCC 3ILPA 1AS7A 1JD7A 1A6VL 2EDDA 2ZKWA 3ARGC 5L4JA 2DBJA 1KPUA 4PY8J 1KBPA 1NC2B 3JZ7A 4LL4A 1F11B 4QNPE 2X4QB 3FQ2A 1Z1WA 2FO4B 3BAEH 4FQJH 4U1SB 3PL6D 4I2XA 2WZ5A 5L9DL 1QEWA 1BECA 5DJDB 1GPOH 1EGJH 4WFEE 4PJHF 1I8MA 3M1CA 3ULUC 4PJCF 2HJLB 3ARYA 3T2NL 5IMMA 2FWLB 1UA6L 4YFDB 1DJGA 3S3DB 3WDJA 3P9WB 2WVTA 4XN5A 4WW2C 5LBSL 3RFZB 1ED3B 4S1DD 4HEME 4WWKD 5ISZE 1P4LB 2X28A 1XF5B 5HHOD 3WUWB 2X6VA 15C8L 1BDYA 3QG7L 2MCPL 1MAJA 2YPKB 3ZDXF 4HIJA 4PCTA 4PJEE 2ZXCA 3UAJC 3TBVB 5EBMA 4JFED 1A1OA 4DPBX 3OXRA 4YQXL 3DO3A 4UMGA 4Z0XB 3HZVB 1NINA 3OQ3B 2XJKA 5HDRA 4I0KA 3T3MB 5K9QG 3L4UA 3MFFB 3LKNA 5FHBL 4P2QD 4WWOA 5LCVH 5IHBA 2XPGB 3HC3L 3ZK0A 4AEHL 5CKAA 1KEGL 3FQYA 1QR1B 1QSEB 3NUKA 1J11A 3LRHA 3DUUA 1TEYA 2G2NA 3GPEA 4LCYB 3O3DA 2ZUXA 1IGTA 3LEXA 3KPNA 1AQ8A 5GRJH 2GHZA 5K39A 4ANUA 5E51A 1CLOL 1BPLB 2YEVB 3A5VA 5L8KB 1EXUB 2NY3B 3UJTH 3ZSTA 3PDGA 2AXGB 4E9LA 1T83C 5C86A 4QRPE 4LRIC 3RWIA 3IVKA 1RVFL 3S8GB 2VERN 1CGWA 1N64L 3N43F 5C7XL 4NN5B 4KY2A 5E6IA 3UO8B 4FLOA 4XI5C 3LNEA 4NUPA 3DRTB 1Y18A 4YQXH 3PHAA 2FH6A 3T0DA 4PWJA 4AIXA 2ATPA 2PWDA 4LSRL 1GC1C 3ECVA 4B9GA 5C0CB 5IW6A 3O6FD 4NP4L 2LHAA 2XI9A 2YOCA 2ID5A 3CN2A 3HC3H 1C16B 1RPQA 3A6OA 2WJ7A 4K9EL 4LGPB 4UT6A 2EIBA 5C0BA 2Y23A 4ZX5A 2X1QA 1ECZA 2EIZB 4KRPC 1LEKB 3MGTB 1QFUL 3SE4C 3BKCL 3N44B 3QWRA 1GZQA 3CSBA 1NQBA 1L6ZA 2RFXB 4K0OA 2WK2A 4Z76A 5ADPH 4QIRA 4QGTA 4JHAH 3SSGA 5GRVL 3U0PA 1C9SA 1NC4D 5K33A 2AJXL 4UV4H 3GC3A 3BD3A 4ZOCA 3KEHA 3OKNA 3MLUL 3VA6A 2Z4QA 5GS1C 5B38G 4MD4A 1AYOA 3EYOB 1OEZW 3QO1A 1F4XL 5EU6A 5A7BA 3ISWA 3ARBC 4JM2C 4APQC 3D4CA 3O2DA 3JV4B 4JPKH 3GBMH 2BXZA 3GMLB 1JWUB 4LLDA 4U1KB 4F5CE 1A4KA 3MLWL 1BQUA 5DHXB 1EZLA 4Z0BH 2E7LA 2C9SA 1EUTA 1FHGA 3ARSA 3RIFF 3MNZA 1G7LB 3BKCH 4UTBL 1HSAA 2PCXA 2R7EB 2X3CA 4KKLC 4NO0B 3H9HB 4OH2A 1R75A 4ZXBC 1G9NL 5ADPL 3TJHD 1SDYA 5IF0A 1KJMA 3X11B 5LXGH 2ZT9C 5CU9A 4AYFB 4GMSL 1B4TA 4XCNB 1BD2E 3CJJA 1KN2H 1K72A 2B59A 3MRLA 5I1HH 4YHYB 2Z8WC 4U1IA 4KQ0A 3PDDA 4O58H 5IW6B 1PAMA 5JPNC 2VLLB 5B1BB 2W0PA 3C60C 5IFAL 1H3PH 2VZTA 1VRSA 5DJAB 4WW1B 1DQLH 1IM9D 4QHMA 1YYLH 5TE6H 2R2HA 3RY6C 5IOPA 2QVIA 3ZUNC 5I8EB 3ULAB 5CCKL 3LZPA 2O5NA 4JPKL 5HGDA 3KM1A 4PUBL 1LE5A 3TIEA 1GA2A 2H0JA 3WMPA 1MI5E 5BO1H 5CINL 3NPZB 4WVRA 1M2VA 1A6ZB 5B3NA 3PQYA 1LXMA 3VRJA 1SDDA 1OHZA 2H9GB 3VFOA 2HH0L 1TTUA 4UTBH 3D18B 1WBXA 1MIEL 2MTPA 5E9NA 3CIQA 3ZZQA 2WOYA 4WI8A 3RU8L 4OJAA 1FYTE 4L8SC 3QZWA 2ZSVA 1NEPA 4MA8H 1COBA 4HW6A 2P43B 4PS3A 1MVFA 4CVXB 4E2OA 2GEEA 5BV7L 4OCRH 3JVGC 4CKQA 3GMPB 4XP6L 4O2FA 2NX5D 3JTBA 4PCKA 2Z31C 5JHLL 1S7SB 4EN2A 3E7JA 1BREA 2BIPA 2DTML 4K8RH 4R0LA 3D2TA 1H9DA 3PG2A 1QEXA 1Q0YL 4AJ0A 2HPTA 5I6NA 4FLSA 3V8CA 1IEBB 3FUKA 3KR3H 1OQOA 3IF1B 4EMZA 5ACLA 4P2YA 5C70A 1AQHA 1YA5A 1BQ5A 3NH7H 4WTXA 1GZPB 2H0PA 2ZYSA 5I5JA 5AW9B 2NMSA 4DP2X 5DRNB 5LBVA 4LSTL 2E9WA 1IAIM 2YA1A 2K4WA 4AKQA 4MJ2A 4PJAF 4LEOB 3RGVB 4AGOA 3WN6A 5CINH 5E4EB 4F58H 2VLKA 2HT2D 1OP5H 1NCOA 1G9NC 5HVGB 5IB5A 1HOCA 4Z1PA 3IFLL 4HS6A 1KTRL 4DOHB 3KLDA 2DEYX 4XC1H 1A7OL 2D7OA 4BHUI 2VMJA 3L54A 1WZ1L 3VFRA 4FQQB 2PR4H 3VI3B 1IBFA 1V3KA 4QJ4B 5B4MC 2JELL 3L2NA 5DVLA 5ID0A 3TN0C 1QKZL 3IFOA 3L3OA 1WWAX 2A74C 4GW4A 4MA7H 4YXLH 4TVPH 5F1NA 3SIKA 3LIUA 4OCRL 1E4KA 1DZ0A 4LDOB 4LP5A 1OGAA 5GS0H 3UJIH 4K2UH 1NPNA 5CLTA 4P23D 1HWGB 4NJAL 4K8RL 5E5LA 4GAGH 5JHMA 1HWWA 2VL5B 5JIIA 3TTYA 1XGZA 4XVTH 3INOA 1SBBA 1TFHA 2F54A 2ZD0A 3HC4L 5EZJA 1PZAA 4Y9FA 2Z3FA 4KFMA 3FU7B 5D55A 5D7SH 1VZHA 2ERJB 3LZFH 1AQDA 1KXVC 4DTGH 3CUPA 5KS9F 4OF5A 2G60L 1EJOH 3LXAA 3O6MH 3OHXA 3N1GC 4OJFH 3WIHH 1MCWW 5F96L 4YVNA 4JY5L 3UP1A 1GGUA 1NGQH 1NJ9A 4OB5L 1OP3K 3BAKA 4U1NA 2IANB 3IFLH 2DPKA 3WKYA 5M94B 4ZTPH 4GP4B 4XVSH 1WZAA 1F86A 5JOPD 4HISA 2UY6B 3OPZL 4UANA 4UCFA 4WEMB 4Y2NA 3NSFA 2ZX8A 3GMOB 5GS1B 3WD5L 3EHBD 3CFCL 3RWHA 4K3DH 1AHMA 4QRSA 2CO7A 4AL8L 4X7TB 3MROB 1PQZB 2MQCA 5E94B 4ONOA 1MLCA 4JM4H 3GIZL 2OAAA 2C9XA 2M1KA 4JRYE 1G9HA 1RURH 1CLZH 4QRTB 3O6KL 1PFOA 4PJXB 3FO2A 1TTGA 3NTCH 3RTQD 3WHE0 4HAFA 2W1NA 2IGTA 2IWKA 3G5WA 4MYWB 4UINL 1KTKE 1PSKH 2XZAH 3LRGA 5IWLA 3P4MB 5DFAA 3ZJAA 1QBLH 4HS3A 5E8PA 1AR1D 3U25A 2OMZB 4J3OD 1FVEB 4D3CL 4QAMB 4D9LL 4ZS7H 3T71A 2XKNB 1OK0A 1L7IL 3QVAA 2WKGA 3REVB 1CU4L 1D7FA 3MRJB 4X5RA 1QABA 1GS7A 4A38A 2NRDA 1AO7E 3T65A 3QCTL 2HTLD 1YECL 2YO3A 1T22B 3DVIA 4IRJA 3KBEA 4MJ5B 5SWZE 3FO9A 1I7UA 1U8LA 5IOKA 3OPZH 5IIEB 2MIZA 1ZANH 4G9FE 4OGYL 1J0HA 4WK4B 3SPHA 3RFRA 4I4WB 3SY0B 1MELA 3I6LD 4QHKJ 1AKJD 3CVDA 4BE5A 4OLYL 2P5ED 5FCUH 1MVUA 2BNRE 2X6CA 3ABKB 4LVOC 3D2UD 4FQCH 2BP8B 4S2SA 4RFOL 1GCFA 3BXNA 4LLUB 2GJ6D 1AQMA 3WS6A 5HD8C 4ZO8A 2L04A 4HEPG 2J4WH 2SEBB 4EN3C 1LILA 3BUTA 3AWGA 1EZUA 3JV6B 3PLYA 1ZXQA 1I8UA 5FA3B 3VO0A 5FFLA 2WGNB 3T1WA 2IBZX 3APNA 1GOHA 4D9LH 2Z6FA 3CU1A 4L9LA 4CKVX 1AO7A 2P7TB 3MXVL 1GZHA 3IGUA 2UZXB 1J05A 1FZOA 3K5RA 4WFFD 1NIDA 4JZJA 4JFTA 4JO5A 3NJKA 2EXYC 3NYKA 4ONGL 3IBEA 2AI0H 4X7SH 1SM3H 5EF2A 2B5IC 2CBQA 2DMCA 3K6FA 3DIFB 2GAZA 5AZUA 5CEZD 1W2KT 4JPVH 1CK0H 2IPKB 5GS2D 4I5BA 3ZRSA 1BYNA 3KYMA 1A4BA 1OT2A 3KCPA 2EC9T 2YJQA 2EACA 3OR6A 1EGJL 4OLYH 4HP5A 2MJWA 2IMNA 4EUPB 3NSXA 5I18H 2XVKA 2AGJH 4OCWL 5BZWA 4BUHA 5HDQL 5DA0B 5DD5H 2EDLA 3MLSH 4P23C 1JHTB 1X9LA 3HS9A 3F85A 3KPQB 3OKOA 3QDGA 3QJQB 4W9JC 5DQ9A 3VG9B 2IIJA 1JK8A 4KXZH 1GY2A 5KYNA 3MV01 4HIXH 1PG7L 5CGTA 1TTAA 4YXHH 3TWCL 4R97C 5I30L 1XGPB 4CC1A 3CBJB 2DI8A 1W16A 2ARJA 1D9KA 4GW5B 2Z91A 5I26A 1TG8A 1BQHG 4WU5A 1A3LH 1UWEH 4ZTEA 2EE0A 1N5YH 4HJEA 5FHBH 4G5ZH 1IAOB 4KJWC 5FO2A 4L0YA 2FX9L 1U8HA 1QR4A 5CGBA 2GEQA 5D7IA 4DP4X 3ETTA 4GRLD 2ZOOA 5EOQL 3VYOA 2X89A 1F4HA 1TSRA 2VRQA 2B4CH 4YSTA 1KLGA 2LTQC 3TA4D 3ZMRA 3IJ8A 1NL0H 1SY6A 1ASOA 3QUZA 4Y19B 4BKSC 2N7BA 5CP3A 3ZDXB 3RX9A 3N41B 3U2SB 2WZPA 3KYOA 5JQIB 5TDOB 5KVDH 1NEZB 3LSOA 4IKJA 4OCMC 2ZCKL 2DI7A 1J9SA 4WNQA 3KPOA 4CC0A 3O0RL 1Q38A 1V5JA 2XDHA 1WCBA 2ZTBA 5EEZA 4IOFD 2YAFA 1SOQA 1UH4A 4WJ5A 1ZA3A 2F1AA 5B1CA 1P4BL 3SQRA 1AD9A 1MSPA 3F6IA 2ADGA 3TWCH 5FPIA 5I16A 3UTTE 4OZIB 1DQML 2QQNL 5EULV 1I8AA 1WC7B 2XPZA 1OSEA 4DUWA 3NIDB 1MRDL 4LRNL 5C2BH 3CZNA 1VDGA 1EA9C 4LCWA 2JKWA 1KCRL 1FZJB 3ROLB 2Y07L 2R9HD 3ARTA 3OLIA 4EEEA 2HLFD 4MBOA 3D85A 3V0WH 5DD0H 3W37A 3L5WA 1PLCA 2JKRM 4J3UA 1DQQB 4LK4A 2E6QA 4LPWA 3HI1B 2VJXA 1N0XL 3B2VH 1MCLA 2RQEA 2PPCA 2P5PA 5CIPA 1G4RA 1AZBA 2GJJA 2EIZA 2YAQA 3RVUC 3WFZA 4BGLA 3VMOA 2Z1KA 5C07A 1JZFA 3RAJL 4GUPA 2IGFH 2L0DA 3MV7E 4GB9A 4JN2A 4LCUA 3ZE1F 4XODA 2I07B 1ZEAH 3QDMA 3C6SB 1MAMH 1HSAB 2BZ7A 2GBTA 2EDOA 4Y5VA 1H9VA 3HFML 4WENB 1OPGL 2OJZH 3G5YA 1P5UA 2ZG2A 3RUGF 3SKMB 3SEPA 2TSAA 3MO1B 4L4VE 5T8IA 1FYHB 4YDIL 3AREA 4PJAB 2BSEA 3QZLA 3OTTA 1FNEA 3B2MA 3EZJB 2WUBH 2AQPA 1EXUA 4LESA 4LOFA 2JF1A 2YK1H 5DJ8A 3M8OH 1M71B 3OAZK 2D03H 4FNLL 4FHJA 1N26A 5GRUL 3MLTA 3CFBB 1GH7A 2W81C 4DCQA 2I9LB 3CZGA 3K0WA 2IH1A 1SN5A 3CZFB 3KL3A 2ZUTA 4WSKA 4GMSH 3V5KB 1FNEB 3RAJH 4NJ9L 4HU8A 1MFCL 3U0PB 1AANA 5I1HL 5FYLH 1QLRB 4TPRL 3BHBA 5I1AA 1GHFH 4XP9H 4ZUUA 4CSTA 1JPGB 4EO5A 4WHYG 2YD3A 4X6CA 5D7LD 5FYKH 2FR4A 3IJYA 4HIHB 3VTAA 5B1KA 5D9SA 1IM3B 1RV6X 4G42A 3VXPB 1SHWA 2BVEA 3PP4L 4BQBA 1C8PA 3VXTA 2CHDA 4XP5H 1D5MA 4FRWA 3K2IA 4NZJA 1ZHLA 3SKNA 4PBVC 4DOHE 3KXFE 3KBPA 3OJMB 5IVOA 2OSLB 5JYLA 1TZHB 3QIUA 4N8VA 5T1KA 3L4VA 4D7BA 3QDGD 2FGWH 1FBIH 1WZLA 2BDNH 5CIPB 3EYQD 5L0QB 2HMID 1E2ZA 4ZAKD 4PVBA 2OPCA 2ATPB 2AERT 2X0VA 2EKJA 1DQJB 1YEIH 2CHNA 4IMKC 3MRMB 3UTZA 2CCWA 4X8JB 4R6UA 2Q3AA 1CLVA 1SJHB 4UOW0 3M88A 4YNYB 3RHWK 3CVIL 3FQWB 4EQ2A 4XWOC 3IXAB 4X6BA 3L5IA 4J12A 1CF8L 2KPWA 3SZKC 1P7HL 4NERA 1K6QH 2FK9A 4ELMF 5KYXA 1BF5A 3QWOB 4JJOA 2Y0SA 2Y22A 4YS4A 1DL7L 1E90A 4Q6IA 3U1SL 2G75A 2GITB 3MA7B 2Y1AA 1MCRA 3L5XL 5C09A 3UO1L 2OFQA 2F9BT 5FGBC 3BD5A 1EH9A 4QUOA 2RJMA 1NLDH 1JGEB 2IALB 3HKZA 3NCJL 4PTTA 5K1VA 3TU6A 1G0XA 4AH2B 3NBNA 4I77H 1UC6A 5ADOL 5D7EA 2W07B 3QG6A 5HGAA 3ULVF 3OKMA 1DVFA 1BLIA 3EF4A 3GS4A 3RRQA 1T04A 1IGFH 2BNQA 5H37H 1EO7A 1MY5A 3B3IB 3QQDB 2CALA 4AUJA 3GO1L 1Q9WA 4BKLB 3V4UL 1TQWA 3BKJH 4HIJB 1VHPA 4X98B 3QIBD 4I0PC 5KOVC 3ARED 5CEXA 5HHMB 4KXZI 5CILH 3RZCC 4E42B 5HPMA 3U0WH 1BFSA 3A4DA 3BW9B 1KB5L 2VDNL 3M1OA 4F27A 3WTWA 3PABA 4ISVB 3I50H 4NI3A 4OUUB 1JPEA 4X6CF 5C7ZA 1M2OA 1LWJA 1JGVL 1PFCA 3QPQD 2WVVB 2HJLA 5IMMB 2APWA 4MQXC 3L5XH 3TBTA 4PY8I 3P2BA 3CXHK 5L88H 3T2PA 3RL2A 4OBSA 3LNGA 1MFDH 3N9GH 3O6FB 4I48A 4R7NA 4CU7A 4EZKA 1SY6L 4U6VH 4NKMA 1CFTA 3BDXA 4YHNA 1EX0A 2G75B 1BVNP 1KCWA 4JY5H 5IB2B 2VLRD 3BGMB 2V6HA 3HBPA 3VFOB 3RLSA 5AVYB 2CPCA 5DMKA 2VRAA 4PJDA 3O2VH 1OSZB 3FSAA 1FG9C 3VRLF 43CAA 2J1XA 1RAMA 4GXVL 1FWXA 3PPSA 4PLKC 4JQVA 4MCYB 2ZWZA 5CCGE 1NTDA 4YNYA 2NY3D 1FQ9C 1MFMA 2MRYA 2OKMA 4JFXA 3UAAA 1A6AA 4N26A 3WIFA 2CWRA 3IFOB 3L3OB 2PR9A 4HS3B 2YA0A 1DVUA 1GYVA 4HS8L 4JM4L 4X5QA 2JCWA 1PLGH 3O6KH 4NN7B 5HD8D 1G7MA 2AQRA 3MU3A 1OB0A 2UXGA 1INQB 3HI5L 2GUOA 4LCIL 3HFFA 2XV6B 4RGOL 5FS5A 2R56L 4LIQH 2VZ1A 4F5CA 1X5KA 1GYAA 3BAWA 1PVHA 4AYFA 3GBNL 5L88L 2VUKA 4AZ8B 5BV7C 4P4RB 1KB5A 3JWDL 1BHGA 3QJOA 4DVRH 1V8HA 1B6DA 2G5BB 1X7SA 3WKPA 1Q72H 1A02N 1N9PA 1B4JL 1PZ5B 2MCG1 1E3ZA 4LGRB 4NUJA 5FLUA 3DXAB 1RP8A 2IANA 3MODL 1KYOK 1YZZA 3BPOB 2VLJE 4PW3A 3KPRB 4HPYL 4K5OA 4TVUA 3SOBL 4DEUA 1JHKL 3SE6A 3L9EA 1HILB 1A6AB 1VESA 1EJFA 2HG5B 3LPFA 4GQPH 4P3CH 3FBQA 1NAKH 2V9TA 3T2NH 4OM0L 4PVNA 4FQCL 1VGKB 4KVNL 5IIEA 5IJVA 3AT9A 2BVYA 4L4TE 2VL5A 4BZ2A 3KPTA 5IGXH 1FL5B 3LS4L 4OFYA 2XBDA 2XICA 3DUHA 1TJMA 4HGKC 3S4SG 4YC2B 3EJQA 1T03L 3K72A 5DS2A 5HHPB 4FHKA 4Z7WF 3B5TA 4X8JA 2WW8A 4YR6B 2CUAA 4QO1A 1DANT 4RBPH 5GJTH 3SDXA 4H1LA 3TZVB 2LE9A 3MC0A 3IFPA 5IQLA 1T7ZA 5KBKA 2Z4TA 3CZSA 5T5NF 3L6FA 2O61B 4NAQA 2WY3B 4EPSA 1SM3L 5DEJA 1L9SA 4M5ZH 4JO4L 4PP2A 5KBDA 3QIWC 5I6MA 5C0BB 4OQTL 4HPYH 3IN0A 2F8XC 3GD1C 2YFNA 1JGDB 3ABMB 4HETA 3STLA 4F33B 1D7CA 5C3IA 4GAJH 1HL9A 2V33A 3NFPA 2WXLA 1I3RA 3NRQA 4JPSA 4ODUA 3VFSB 4K23L 4YDKL 1E6OL 1VFAA 3PV6B 4WI5A 4P3CL 1M9WA 2FWOA 5F89B 2DS4A 4NM4L 5A40E 4Q9QH 4ZMAT 4HJSA 4BUGA 4X6CB 5GHWL 4NNPL 1CR9H 4FD0A 5J0BA 4IDLA 1S3KL 3ESPA 3O0LA 3DJRA 4NC1E 1ZVNA 1TPXC 1S7SA 1GGBL 2A6IA 3N91A 2YPLB 3V0FA 1EEQA 4Z7UB 5H2BB 3CGTA 2R1WA 4LHJB 2OCJA 5HY9A 5KW9H 1NMBH 1SZNA 3GSNH 3NIDE 4FZ8H 2H3XC 1BZQK 5E9AA 4MA1C 3DSNB 3C6EA 1CE1H 5F88B 3FZUD 4LSRH 3CCHA 3WEXB 3GTTA 1D5XB 1A4JB 5IBLD 1I8KB 4N2MA 4DGIH 1EHLH 3DGCR 2CO6A 1KT2B 1T2QL 4E68A 5DURB 4JO4H 5ABZA 2H2PC 4BQCA 1VKXA 1NCAL 2IPTL 4MJID 1WCBB 2I9TB 5T1KD 2QVMA 3IGAB 5EBWB 2ITDA 1Q0XH 4HF5L 4PG2C 4YSRA 3M6DA 5I8EA 4BSWA 3QI9D 2CBMA 4F15B 1KWGA 2Y7OA 3WG7B 3TF4A 3L4CA 1ZD6A 3FCTB 1OD7A 2VAAA 2X1PA 1NLBL 3BIBX 4O00A 1XSOA 5E99L 5MEPA 3KS0H 4E5XG 1HEHC 4P4KD 4FQ2H 1GGBH 2ZF8A 5HYJD 2AABH 4QRUA 1C16A 3WS3B 5DO2D 5JPMB 4YUEL 4IBSA 5GQBA 5FIEA 3U7WH 1W91A 1P4BH 1GOGA 2R2EB 3BP4B 4Y4KB 4BCYA 3ISRA 1XGPA 2QSCL 1T20A 4PJ5E 2HB0A 2RB8A 4DGIL 1EHLL 3C5XA 2Q1EA 4N6RA 1I3VA 4X9BA 4FQXC 3DHJA 2W8CA 4MS6A 1NCAH 2IPTH 4Q0XH 4QPEA 4XVJL 4XCEA 2A77H 4GKOA 4QRAA 5BQDA 2WBWB 3MUGB 4IMLB 5GS0D 3CU7A 5BRQA 1BVKB 2B5IB 4HLEA 1EANA 1CVSC 3MRCA 4YBQC 4P2OB 2WTOA 3ESOA 5T5FH 1IL1A 4H8WH 5CP7A 3QA3A 1BX2A 2D7QA 3FU3A 3LH9A 5JIDA 4YVUA 3M86A 1QSFD 3IPBA 4LP4A 3QW9A 4Y5XC 1FZKA 2VXSH 2F74A 1RU9L 1LP9F 3KWVA 3RPIA 1I31A 4P2QE 4PRBA 1ERNA 3MUGA 1HVXA 1CICA 1QQDA 4IMLA 3KYMB 2N3JA 4JZJC 4J7RA 4ZBJA 5DZNA 4AYEC 2BHFA 5L6YH 1LE9A 1HCVA 3IMTA 3GIVA 4HJTA 1M1SA 2C5DC 3Q05A 1UXSB 4QRRB 3U36B 1U8IB 3WY1A 1MAML 4V2BA 5GGVY 4J5VA 1AZCA 1BIIA 4QOKE 5MI0C 3ECBA 2CLRA 3ARPA 3I3EA 4ERSL 3I9GH 3F7RA 3J07A 2V0AA 1FGNH 4Z3HA 1IMHC 2PWHA 3D4ZA 1JXFA 4W4NA 4O2CB 4HFWB 5IB3A 4LEBA 2JKJA 1NKOA 4DAGL 1YYCA 3ES6B 5KJ4A 3K6DA 3TESA 3QHTC 3TO2A 1A14L 1X5MA 2BVQB 5AOIA 3W57A 2VAAB 3BWAA 3KWWB 4FNLH 3G6DL 2ARJB 5D71L 4LAQL 4JDZB 1MVUB 3G08B 1S9KC 3O4LD 3U30C 4MA8L 3I9PA 1EZVY 4OV5B 3TNNA 3BE1H 1AXIB 5KS9A 4NRYB 4YSCA 1MWAA 2OR9L 4FQXD 4XP6H 3X13B 3ZTCC 1WFTA 5DJ2B 3U6RA 4BGDA 1Y07A 4FA7B 2BFVH 5JMRA 3ZDZB 3SYPA 4RNRB 3MREA 3ETBJ 2A4CA 5FKPB 3J7HA 3L9RB 1I9EA 3P11L 3QQ3A 3RVXC 5F71A 3I02A 2AQ3A 3QO0A 4A37A 3AG3B 4I3GA 1AQKH 4WLCA 5C0RH 4Z7WA 1QVOA 2Q2LA 2W9LA 5HYIA 1P7BA 3BPNB 2VXUH 3F00A 2EEDA 1M7DB 4K9JA 3T4YB 4N3UA 4F7CA 1L3NA 5FA4B 1XH2A 4JR9L 1QLEL 2V8LA 1NBVH 1MNNA 5JTWA 2ENJA 1F8TL 1JPTL 3T3PB 3LRKA 3VGEA 2J25A 4GQRA 4L9LB 2WXIA 3QZNA 5ANMA 1OAYL 4PJBF 2ARJQ 3QNXB 5GGRA 4NBXB 4Z7QE 4B60A 4FC3E 5D7LE 3FB6B 1CF8H 3B7TA 4E5XB 2R1YB 5C0JB 3BZEA 1B0RA 2WD0A 3EYQC 2W95A 4MJ6A 5HHOE 3SGJC 1IC4L 3NVQA 4HIEA 2HMIC 2XN0A 3C12A 3UC0H 1JZ6A 1Z5LA 3Q48A 4PEEA 4BFRA 4Z77A 1U8QA 5DF0A 4J3OF 2OI9C 3CHPA 3QCUH 2H1LM 1NDTA 3PHSA 2PYEE 2V9UA 2W65B 3IETA 4EDWL 1IAKA 4OQ1A 1F13A 1F4WL 3H9ZA 2H32B 3MRFA 4RDBA 4MJ6B 4UAOC 2CGZA 2VXUL 5BOPA 4JG5A 5CSBA 4CVZA 1RHFA 2HVBA 4MCNA 4M29A 4UNIA 4U49A 3ME0B 1ET8A 4BSVB 3GYRA 3T6VA 5K39B 4M4PA 4IGBA 5D7LA 2W59A 2BIMA 2XG4B 4K3HA 3V4UH 4GKSB 4F3FA 3T2LA 1TQBB 1NGZA 5K69A 3MUY1 3VFVA 1X5FA 3C60A 5CUSH 5FM5O 2A99A 2FUTA 4N8UA 4WU7B 1U8KA 2JQMA 5CILL 4N2GA 1RURL 4Z23A 3DO7B 1LEGB 4BA0A 2DN7A 4E9XA 1XCXA 1KF9B 5E6IC 2FAUA 3T8MA 3NTCL 1IFHL 4XPBH 5GGUA 3NJJA 3D25A 3KPSB 4OCSH 1NBYB 3V95A 2WLIA 3QJVB 2A74A 3HG1A 3ARFC 1NCHA 5CCHE 5KBMA 4X6DF 5ESAB 1F41A 3IAQA 3K2KA 3MA7A 2GT9A 2PTUA 2GTQA 3ORJA 2A7BA 3VMNA 4A7GF 3NEEA 1L7IH 2C9RA 1BF8A 3DXAE 3QEGH 4DP9X 2GTZB 4NPYA 4UOJA 1R0AL 4KHTL 4KI5C 4MD0A 2J71A 3KPSA 3AQYA 3DIVA 4KKBD 3K71B 1KFGA 2GUOB 2ZOWA 3O2VL 1ZT7B 3MRQB 4KK9C 5DURD 1KDJA 3FQWA 5SX5K 5EA0H 5F1SA 5JXEA 5AW1B 4MCZA 4CUCA 3VWKC 2XWJA 4OGYH 2PYFB 5EBLA 5ENWB 2Y72A 5E5MA 3W81A 5JW4Q 4RGNB 2ICCA 4ZUTB 2VC2H 4WI0A 5L9DH 4KDVA 4NT6A 2MOGA 2R1XA 5LG1A 1WAEA 1GPOL 2X3AA 4P5SA 1GS6X 4HCRA 5D6CA 5FDWB 1IC7L 3X1EA 4JZOA 2NYZA 3KWWA 2KPNA 3HIZA 4Q6IB 2GSIA 2Z65C 3LN5A 5C6TL 4MCYA 5D2NE 2AHIA 3CIAA 3PPEA 2YPLD 1ECYA 3QDAA 1A6ZA 4LCIH 3ILPB 2J4WL 4TUJB 1HH9B 2P5WA 4K7PY 4ZFOA 4FS0A 2ADIA 3D3VE 3DIDA 5FW8A 5IFJA 4TQEH 4UQCA 5L2JA 1VACA 3UBXI 4OM1L 5B3SB 2P8PA 4HK0B 1MFVA 4ZFFB 2X4OB 3MJ6A 1L7TL 4YFEA 1OCZB 3MXVH 3RL2B 2LT9A 3TVMA 2XTJB 5DGRA 3GUTB 2YD4A 4M4RA 4DVRL 1JPGA 2CA4A 2YXVA 1JTOA 3MRBA 4LEXL 3MTXA 3VFPB 2C1PA 3K8LA 2VLME 3AABA 5DU7A 1S7WA 3MODH 1XH0A 4ODXA 3RJOA 1ZKAA 4Z7WB 2O30A 4Z7VB 3ZIMA 3JYCA 2WLZA 1FUNA 1DO6A 3CVBA 3SKJH 5IT2L 5A6LA 2OW7A 3G5VB 1N8OE 1QASA 2CO7B 2KDYA 1IC7H 1O9WA 2V7HA 4XCYA 1HC1A 5C6TH 5SWQB 5DVPA 2YPLE 5BV7B 4Q9CA 2OJ1A 5IGXL 1HIMH 4V11A 2WO4A 2VZSA 5E6ZA 4XPAL 3SQOL 3OJVC 2NNAA 3OGOE 4OCYH 2AJYL 4AKPA 1B6UA 4HZ1A 4K3JH 1JTTA 3IJSA 4E9YA 2I32A 2X4SA 1ACXA 4F15C 1DDHA 1J12A 3II2A 1F3JB 1PG7H 4YXHL 1EEUA 3HAEA 1K8IA 1O5PA 4WAFA 3IDJA 5I8CB 3CFEB 3BFWA 2FEDC 2H45A 5B1AB 1LO2H 4HUMB 2VZ3A 3PNWA 3ZN6A 3HPJB 3VRJB 1S5IL 2P26A 3QEQB 4EOWL 4G5ZL 1NUFA 2XWTB 4CC4A 1KEMH 4XXWA 4JM2A 3KGUA 4APQA 2IVFC 1WEJH 2DM7A 5FOBB 1SMAA 4GAJL 1A5FL 4WTQA 3QORB 4PRAA 3NABH 5EOQH 4Q8BA 5EU7E 3OZKA 3N85L 1M6UA 2AEIT 3MRMA 4N90D 4PWIA 4BZ2H 1JN6B 5H35B 3BC9A 1R5IB 4Q9QL 1GZQB 3VFRB 4JRYD 3M17A 2PYEA 3IPEA 1UEYA 4YLBA 2A73A 2ODHA 2R0WH 4QHKI 3V79C 2VXTL 2AK4B 4PGZA 1V55B 4OCYL 1JV2B 5JXED 3T77B 4QKTA 2MCMA 1ZHLB 5DHVH 4F2FA 3ZTEA 4NO5A 4NZRH 5D1ZI 4K71C 5DRNA 1ADWA 2J6WA 4GKZB 1U92B 1DQMH 1CG9B 5F0MB 3ZO9A 4OFPA 1OB1B 3VFWB 2VDRH 4KI5D 4ZK8A 3VH8G 4ZPVB 5D1QD 5IUSA 4YDVB 4YZFF 4XWOD 2F5BL 2WLYA 2WLJA 1X5IA 4PJHA 2C4FU 3JSSA 4N1HB 3PYCA 4GNKB 1JZ4A 2PXYC 4QXGH 4C56D 4M5YH 5KN5B 1CD1A 4KZDH 3FFCD 4Y2DB 5DI8A 3I9IA 3LD8B 2MNUA 3HHSA 3DJSA 4F8PA 4FFVC 1DJZA 2A9DA 2G0LA 3L2LA 4UTCA 3P9MA 5HYSG 3NA4A 3O3DB 1NLBH 2N7AA 2WXKA 3WV0A 3QIBA 2JKTM 5FGCE 2I24N 3E6HB 2A9AA 1YN6A 3WFEH 5DHMC 1ZT1B 1CIDA 4AC4A 2IC2A 3D1MC 1PZ2A 2I5YL 5ALCL 2XX1A 2YS4A 1LP9B 2IG2H 4HMCA 3U7WL 4Z3JA 4BIKA 1CFBA 4ZFGL 5TH2A 1WISA 5BZXA 2R8SH 1KCVH 3ABLB 4ZUSA 3W39B 3IJEA 3K8MA 1F6AB 4HIIA 2F1BA 4TSBL 1MF2L 5DJZB 5FWQA 4HC1A 1RI8A 4AEIH 1KGUA 2A77L 2EDHA 2M26A 4QXGL 4RSVA 2NTSP 1KB9K 3NCBB 4FEIA 1XTLA 3WNOA 4OLZL 5BO1L 4A63A 5IF0B 4XBPA 4XPGL 1FH5H 1NGYB 3H2QA 5JXAH 1G6VK 3MRGA 3BH4A 1J8HD 4J8RA 2MHAA 1ETZA 4K7FB 1LD9B 2J5WA 4XNMB 1JG9A 2KQNA 4HG4K 4ADIA 1BFVL 1X9UA 2GAZB 1TETL 3C09C 5ALCH 4ZNCD 1WBZB 4QJ3B 3N04A 3QUYB 1NEZG 2H8PB 2L7UA 4DGWC 1GHFL 3M7FB 3VYPA 1ZK9A 3MNMA 1HZKA 1D5XA 1HXYA 1H8LA 2HJFA 3QUXC 4U4BA 4XNZB 3UPRA 1K3IA 2OTWA 3FOLA 4XP1H 5FK9A 5I0XA 3P3TA 1FH2A 3TPKA 2BJML 3ASWA 4IRJC 4LSDA 1LO0L 5EWIH 2R15A 3MV9A 4WY7L 3SBWC 3QAQA 3SQBB 5JA9A 5IP4A 4N8CH 1E4WL 5I0YA 5T33H 4P5TC 2NXZB 4JJHA 1WCQA 1MCCA 5CO1A 2FO1A 5D7LB 1UKSA 5ICZA 1KY7A 2HWZL 4G7RB 4AT6A 2OCFD 5I2IA 3HG2A 1OAJA 2Q7AA 4OD2B 2QR0B 5CLZA 3CXFA 5FA3A 1FL5A 2HFGH 3ARRA 3MUUA 1XGRA 2BO0A 2GSGB 5GS0L 3AS1A 4J8QA 2FGZA 2EDNA 4FQLL 1D5ZA 3G6AA 3HZ3A 4L1HA 3UAJA 2HRHA 4D0DB 2WNXA 4X0KA 4HDIA 4NHCL 3X3FH 1CYGA 1SJMA 2A6DB 1F5WA 5LGJB 4NKOB 4IRSD 4CL7A 2CK0L 4QHUA 3HUJF 2Q86A 1J18A 4JFOB 2WXHA 3SPVB 3VVWA 4WTZG 2C3VB 2HXAA 3ESUF 5MHSE 1NGQL 4OB5H 3X1NA 2R1YA 5C0JA 3BZEB 2B0SH 2FL5A 2V37A 4G9DA 2ZSWB 5HI3C 1B3JA 1RJLA 1IGFL 2FZ3B 1QLEH 3D85D 5CJ5A 5DVOA 4ELMB 4FG6D 1NFIB 4WO4B 5GIRA 3GO1H 1CGVA 4F1SA 1V10A 5M95B 2HT3D 1NFDF 2WN2A 2JB6A 3T0EE 2F8IA 2ENYA 2PWEA 3QUML 1JZIA 4GG6A 3DMMA 1G6RL 1UB5B 2DQCH 3KPRA 3G6JF 4ZAKC 3HRZC 4P5KB 4JB9H 4UILH 1U4FA 3TNMB 2ZUYA 2AQNA 3JYBA 2EDYA 1TZGH 4KAQH 3OHXB 3IKCB 4GKLA 2WQXA 5IWLC 3BN9C 4FZEH 3QCUL 3BSZA 3HE6A 1II4E 2CU9A 1MFDL 2ZUQC 2WP3T 1DLHA 3N9GL 4MQ7B 4YBLB 2YGQA 4AVHA 4AZ8A 1CDCA 1XCTB 5ELIA 3KMDA 3RDTC 4N87A 4Y4HC 2DTSA 4IJ3B 1CDJA 4L4VA 4PG2A 5D5MB 1A9EA 1MCNA 2EO9A 2JV6A 4W6XB 1ZV9A 1S9VB 4TUOB 1T1YB 1RZJH 2JKLA 1H5BA 5AVZB 5KS9B 3AU1B 3VM5A 3V8OA 4YPJA 1ZSDB 5FYJU 2EUVA 1SOKA 1SGKA 2I27N 3UTZB 5BRZA 4LLWA 5F0LB 4JLRB 1DJSA 2J88L 1I8LC 3QUKA 4X8XA 2NNRA 3N41F 4N2AA 1V7MH 2Z7YA 3R19A 4HBCH 4AXWA 2JB5H 1YAIA 4CDGC 1KIRB 3GEFA 1BAFH 1S9VA 1QRNA 2PW2B 3LN4A 4YDLC 3UOAB 4NQDD 1XMWA 4AVIA 3QDGE 1U8CA 1A1MA 4A39A 2VN6A 4Y19D 4NWTH 1UOVA 2XTJE 3UZQB 4PWEA 4NQTA 2XVBA 3FT3A 1UXMA 3EG9A 4L3CB 1WAAE 2B1HH 1CBJA 1VJSA 2NTFB 2H0EA 4R7VA 4ZUUB 1R0AH 4FKEA 2K4AA 2DMKA 4XN2A 5J6GB 1UWGL 2D9QB 3B8SA 4O5LH 2AS5M 5L2KE 1VEOA 1HOCB 4PWFA 3MUZ1 5KVFH 4I0CC 1YY8B 5F8RC 3WFBL 1EWHA 1MFEL 1IKOP 3QIWA 4ONHA 4ES9A 3E6HA 4BK5C 1KYFA 1JHKH 2F74B 3W0WB 2XRAL 2WQWA 3MSPA 3EO1A 2Z8RA 4M3JA 3LMJH 1B0IA 1JPSL 4IGBB 1S7XB 4NO2A 4GH7B 4OAWB 4LSPH 3AGVA 3Q5YA 5CHNB 4G8GA 4EDXA 2CLZA 3PQYB 2YQBA 3IYLW 4FLRA 4MHHG 2YMXH 3UTPE 3WMQA 3TFBA 3GEWB 5IJCC 1HCFX 4XCEB 1DBKH 2OQJB 3S3PA 4Q6KA 4TQEL 5I1DB 4NWTL 2E7MA 1ZXKA 1P5UB 4OM1H 1UYWL 5L8LB 3EGDA 2ZNXA 3T8XB 3BUBA 4AK1A 1I4FB 1S78D 4XHQA 2ED7A 3GHBH 4X80L 4XT1C 2WQSA 4JFVA 1H5BB 4XBPB 4PGJA 5CJXC 5ICUA 4HSQA 1D5ZB 1NM4A 3G6AB 4EXPX 4KQ3H 4C59B 2YAEA 4OZIF 2NY0C 1MRCL 4Z95H 4NQDB 3GK8L 1U3HB 2UX6A 2ZCHH 1BZ7A 3MLXH 1KPRB 1UADC 2D0FA 3HVDA 5IVZB 1SXZA 3MX0A 3PJSB 5AKRA 3KJ6L 4BSWB 3EH3B 3MOBL 2V3EA 2DQMA 2KERA 2YMOA 3TIDA 1S3KH 2Z31D 3CSYA 2JKIS 1FFTB 1OY3B 1AHWA 4M1CC 3AGWA 3UP6A 1Q1JL 1ZT1A 4HJGA 1OCWH 1TCMA 5KJRH 1TJGH 4P5MA 1DVSA 2X4UA 4HWBL 4NGHH 3SOTA 5CEZE 5EIIA 3MLPA 1YEKH 4KV5E 3BIAX 4GAYB 2Z4QB 2QQNH 1M71A 2VLJA 1DEEA 1E30A 2XVLA 5CJQL 1AOHA 1X5YA 4HPOL 4LARL 5IB1B 2R4RH 5EFIA 5JW3H 3CZEA 4UBDD 3OZ9H 4UDTA 1TU2B 4L2YA 4PJGA 1JHLH 4JAMA 1KEML 5AVVB 4YSOA 5CBAB 2XTLA 3NJGA 3SKMA 1EVTC 5D1ZC 5F7MC 3CFKA 3BKYL 3AUWB 4OI8A 5T1DL 1HH6B 3QDJB 3VYNA 4BZ2L 3HCVA 3NCFB 4WI4A 5FGCB 2FD6H 4LVNB 4X0KB 2Y24A 5ES4B 2P5EE 3U1QA 4H0GA 3PRZA 3C5JA 1U91B 4IDJL 5ACMA 3FUIA 2BSCA 1NKRA 3A67H 4ICWA 4Q7DA 4RMBA 4RSYA 2P5WE 3ZT6A 2C9AA 1QA9B 3FQUA 4ZZKA 4FYTA 3LKQB 4ELKA 1JNHA 3VU2A 2UYLB 3P1VA 4NQCD 3FUNA 4KTDL 4DKFH 3IDYB 3HZYB 3GI9L 2VDRL 3L8QA 1HNFA 2JK5A 3MGTA 4YLCA 4NQEA 2AZAA 1RL1A 1A7PH 4HWZA 3RWIB 2X4RB 3A6BH 1C08A 1XWVA 4M5YL 2ALAA 3EXJA 3VGHA 4PGDB 3UPCA 1UH2A 5FECA 3S5ZA 1N0LA 3DUSA 2AITA 1O7SA 3R0MA 4X50A 2BY3A 4WDIA 5T5FL 2X40A 3O8XA 2KMWA 2JH2A 3EADA 2J1KA 4M8UA 1RJYB 3FO0H 3PREA 2ZYRA 4HWBA 4LSQH 4BUQA 5JYMA 1QR1A 3GMQB 4NC1C 5EOTA 3V4LA 2ZF9A 3WNIA 3ZKXC 1UVQB 3P0VH 2R1WB 1JVLA 4YHZH 4YSEA 3C5SB 5BJTA 2IWFA 2P5WD 1E3XA 1OGTB 1XEUA 5G4MA 5FYLL 2OL3B 5E1QA 1SLUA 3I6GB 2WQVA 1J7VR 5DJCA 1OQXA 1TQBC 2GUYA 3ZYIA 4R7DA 3BT2L 1RJYA 5LGHH 1WBYA 5FYKL 3MRGB 2AK1L 2V7HB 3DYOA 4PS4L 4XCYB 1WUZA 1U92A 4MS8C 2R59A 4XNQB 1NCCL 4P4RA 1ACZA 4X4ZA 5I16B 5IVXF 2J1YA 3LX9A 1IVLA 2BVPB 5AW8B 3A6BL 2VDLB 3WEBA 2FBJL 4KO5A 1GYWA 1LJMA 3RKDC 5I6KA 3GS0A 4ZUWA 1IRAY 3K8KA 1E27A 4M02A 5BRZE 3K1KC 3WAJA 3H0TB 4XPGH 3S35L 1R24A 1DN2A 4KKBC 5EEXA 1FBIL 2Y7QB 3U2SA 3FSVA 2Q2EB 3SDXB 3TZVA 3SPGA 5D7IE 2WLHA 3QH3A 1OM3H 5IFHL 4KI5F 4RVBA 4KUCD 4I2XB 4OTXH 1GGYA 1RXLA 3WMSA 4Z5RB 1BBDL 3IGFA 2GKIA 5F7EL 3CSFA 4AL8C 4FQ1L 4KVCL 4LLVB 2NSQA 1RUKH 4ZFOB 5ABAA 3TONA 1SFDA 4ZX4A 5I1JH 4PRIB 3AVEA 4J39A 3T3PF 3FONA 2CUMA 2X9ZA 3BGMA 3RA7H 4L9LC 4MZ3A 2G3MA 4M8VA 1URZA 5C0CA 5KVMC 5CEYB 2WLLA 3WGVB 5JHDB 1Q94A 1RZ8A 1UJ3C 3HCVB 5AZEH 4YN3A 5JR1H 4DK6A 3ARDC 4POZC 3HE7B 2EVJA 3UTTA 4NEHB 4PJFF 3SE3C 1LO0H 4U1GC 4M7LL 3KZ8A 1OF0A 3NCYP 4GRWF 1SYSB 1HTYA 5KYYB 3SE9L 1LEIB 4I8DA 2KUTA 2DIBA 2L7EA 2OV0A 3WFCL 3LKPA 2WXNA 3PWNB 1AKPA 4HWNA 4IIQB 3BEVB 4LHQB 5SWQA 1CGYA 32C2B 4XWGH 5D7HA 1MW0A 1BZ8A 3L1EA 5IROC 3QI9A 4JQVC 4XAWH 2MNJB 4N86A 3W9DB 4OTXL 2LGNA 3V4VH 2HFFA 1AYRA 2J43A 2LR4A 3KJ4C 1AR1C 3V6FB 1UFUA 1INDL 3EKCA 1ADQL 2OJEB 4A7UA 1GC1L 1JNJA 4PJGE 1BJ1H 3U0WL 3IMVA 1XCQB 2FVNA 3NJHA 3S3CB 1F56A 3MRHB 4GRMA 2BP0A 2A73B 2AJSH 3T0EA 3MLRH 3U83A 3GTVA 3PIQB 1GGCH 3CUPB 4F7TA 1NCGA 3L1OH 1G1YA 1RK0B 3OXSB 4OGAD 5AALA 3IS1X 2DLTA 2B16A 3CDGA 4BXVA 3DV6B 2O1AA 1LYQA 5I1LA 3ZR6A 4X6FA 2W38A 1RZQA 5LAXB 1NFIA 1QFHA 4WO4A 5GIRB 1M7IA 4OY9A 4DP1X 4F8NA 3LQZB 1XTMA 2CIKA 1X7TA 2DQFB 3MRKA 5DMKB 2B0SL 4DZBA 3TT3H 3QC6X 1KBVA 2O4EA 3H3PL 5J1AA 4ALAL 4ENED 3HPLA 4GXVH 1ACYH 4PWKA 2CUHA 1OARH 3VACA 3N3EA 5D1XA 4XNXH 2FDBP 1ZTXE 3CX5K 4MAYC 4L1BA 2PCFB 3TBTB 5JMOC 4FYRA 25C8H 3UJJH 3GZOA 4DIXA 4JGMA 1U3JA 4MX7A 2EO1A 1A47A 1BVLA 2Q3ZA 3L3HB 4XNYL 3VXNB 7PCYA 4WTWA 8CGTA 1XCQA 2Y2YA 4Q58C 5LAPA 2EIDA 3O41A 3HOGA 3Q9PA 5EORL 2K7QA 3B7SA 3H85A 1TZGL 4D9QD 5HHXH 4G6JL 4IKNA 1QBML 5DUPH 3VXQA 5AVSB 1B4RA 1GW6A 4NLHA 1MKFA 5MENA 3APFA 5MEOA 3GBNH 3SYAA 3W9EA 2ZIDA 3DV6A 1GZPA 2J55A 4PR5A 3VTTA 3HRZA 5MI0B 3PWNA 2NQDA 1NKGA 4M43H 4AC2A 3KH3A 1F6LL 3PGDB 4KHTH 2E76C 4GSXA 2NW2A 5D1ZA 3T4YA 1DE4A 4M48L 1H8SA 1LMIA 1GIGL 4MJIE 1EXHA 4HIQA 4PTTB 5TGBB 3FBKA 5LG6A 1GYCA 2YGVA 1KG0A 4NZUL 3AUVA 4XNXL 5I1EL 4H20H 4KJQD 2WLLB 4ZMWA 1PLAA 2EDJA 2XWZA 4XPFH 4AG4H 1E7UA 3C6LD 4FG4A 4PJ5A 2Y4SA 4PRNB 3US0A 2N1KA 2VR5A 3RUGA 1Q9OB 1YNKH 3ZR5A 4NYLB 3UYPB 1WDAA 1E8XA 2QQLL 5AOJA 3BGFC 5EORH 1XAUA 5L7XH 2CDFA 1SYSA 4U0RC 2Z8VC 1KGIA 1FIEA 2C3VA 1DDTA 4JPIB 1T03H 3FW6A 4MJHA 2A9CA 4M56A 3OM3B 4PJ8D 2EC9U 1BXAA 4QEGA 2X4PA 4JFDB 3BPCA 4BXSV 2XTJD 4X9IA 1L6PA 4N0RA 2XHNA 5CSZB 3FCUB 2D4FA 2F54B 5EZJB 1UM6L 5F7DA 4MVBD 2VIRB 4XGZB 1XCWA 3WKNA 4ABUA 4NQDE 2OMUA 4MNQE 4NZTL 3QDHA 3E6FB 2F53D 4J6RL 2E7HA 4POYA 4J3OG 3HBGA 2ZOTA 3VXSB 3MJWA 5BS0A 3SKJL 3PWPB 2E74C 1ZJAA 1QOKA 1IM3A 2BMKB 3KPLB 4H20L 5EO9B 2KZWA 1JPSH 3H9HA 1JNLL 2A1WH 3EJRA 4OKDA 5J13B 2V17H 4IS6A 3ZTJG 3BEWB 5HVFB 1I1YA 1ZE3H 5CU5A 1KXVA 2WSPA 5GHWH 2MCAA 1MI5D 1K9TA 5L7XL 4HS6B 4WWKB 1TEGA 3D4GA 2W94A 4XCFL 1JOIA 2R39A 1NUNB 3WLBB 1ONQA 2DLIA 3OMNB 4MMYA 5MEQA