1ILUA

X-ray crystal structure the two site-specific mutants ile7ser and phe110ser of azurin from pseudomonas aeruginosa
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMSFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title X-ray crystal structure of the two site-specific mutants Ile7Ser and Phe110Ser of azurin from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metalloprotein
total genus 35
structure length 128
sequence length 128
chains with identical sequence B, C, D, E, F, G, H, I, K, L, M
ec nomenclature
pdb deposition date 1995-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1iluA00
1SDDA 1AZNA 1V54B 3BVDB 1RZQA 1KV7A 2YXVA 2E86A 5AFAA 2PLTA 2GSMB 4BXVA 7PAZA 3FQ2A 1CYXA 3NJJA 5PCYA 3KW8A 3N55A 2FT8A 2PP9A 3HEIB 3NP4A 2XV3A 1MZZA 2EIKB 1RZPA 1GSKA 1NDTA 1BQKA 2DWTA 2XYBA 2YXWA 1RKRA 2DY2A 3ZBMA 4DP8X 1FFTB 1KCBA 5ANHA 2XU9A 2NRDA 4E9QA 4YSQA 4WTQA 5TK4A 2IWKA 2PP7A 3HB3B 3NJNA 4GP8B 3S3CB 2UXVA 2HRGA 2VN3A 3FYIB 2FQEA 4DP5X 5D4JA 4FA7B 5I28A 4E9RA 2VM3A 4A2FA 3CDZB 3UAAA 4DP0X 1BQRA 2IDTA 1DYZA 3EF4A 2LLNA 4W1TA 1NIAA 1A65A 2YAFA 2PCFA 4A67A 2P80D 3V9CA 2ZXWB 1ZDSA 3AZUA 3FS9A 2H47C 2QPEB 2AZAA 1OE3A 1ET8A 2YAMA 1M56B 5B7MA 2ZWNA 1PNCA 4CSZA 2AANA 5B1KA 3ASNB 5I6NA 1BEXA 3AG1B 2WSDA 1AACA 2TSAA 5B1JA 4GY4A 3ABGA 1ZPUA 2N0MA 2HX9A 1KCWA 4BXSV 3AG2B 4HAKA 1AG0A 4DPAX 1PNDA 5I6KA 2HLEB 5AKRA 1FWXA 3KW7A 4KNTA 5D4IA 1JOIA 1FA4A 4HCFA 3FQYA 2EIMB 4KO6A 4DPCX 3IE9A 1N68A 3CG8A 1L9PA 1PLAA 1J9TA 4Q8BA 2PPDA 2GIMA 4F2FA 4AKPA 3NJFA 1B3IA 3FSAA 4BDVA 1TEGA 2J55A 2HX7A 2BP0B 1J9QA 3BQVA 1E67A 3JT2A 4KO5A 4YVUA 1UATA 4ZK8A 2I7OA 3AY2A 4TXVB 1W8EA 4DP7X 5F7AA 1JXDA 2UXTA 1JXFA 2RACA 2IH8A 2IH9A 4GXFA 3NJHA 2OJ1A 4N4YB 1OF0A 2DWSA 4FAAB 4NB7A 3D12B 3OM3B 3IN0A 1CYWA 2I7SA 5I6OA 2XX1A 2VW6A 3S3DB 3ZX1A 1V55B 3X1EA 1A3ZA 3WKQA 5I6MA 2PCYA 4E9XA 1HAWA 4A2DA 3CVCA 5B7EA 4F2EA 1YLBB 1E30A 4QLWA 1PCSA 1HAUA 1ZDQA 4BK5C 1PY0A 1J5DA 4X4KA 3OMNB 1A4CA 2ZONA 2Y1AA 1IKOP 1KBVA 3OD3A 4A2HA 3X2QB 2FQDA 1CUOA 5D4HA 3EH4B 1OCOB 4G7RB 3CZUB 1OOWA 2BP0A 3ABLB 5I5MA 3SBRA 1URIA 2FJSA 2BWIA 3OMAB 1XB8A 1N70A 3QJUB 4E9YA 3T9WA 3FSZA 1ASOA 2I85A 1GY1A 2CBPA 2QPDB 2R7EB 2YAEA 1J9SA 4HCGA 3G5WA 4GP5B 1W6WA 3NSFA 2BHFA 1JZIA 3S8GB 2GI0A 5F7BA 3DTUB 3FQ1A 4G70B 4A66A 5I6PA 2XXFA 1JERA 4JHVA 4HHWA 1ZIAA 2TSBA 1AZBA 2H5UA 2IDFA 2FQGA 3RYMA 4KOCA 2BZ7A 3MX0B 4M3HA 3UACA 1XMEB 1IBYA 3TASA 1BQ5A 3EH3B 4G71B 1NIBA 4JHUA 5E9NA 5B7FA 1NIEA 4M4RB 3WI9A 1PAZA 1WA2X 2QDWA 4UAHA 2OCCB 1ETJA 2YAPA 2CUAA 4YSUA 1OE1A 1PMYA 2EINB 1A4BA 1JVLA 3PXLA 1JZFA 4BDVB 4YSCA 5TK2A 2P80A 4YVNA 1ET5A 2VM4A 2X88A 1BYPA 2EILB 1ASPA 2BZCA 4JKNA 1RCYA 2R7EA 5I5JA 4BWUA 1AG6A 1MDAA 3NSYA 1OV8A 3H4FA 1GS8A 2B08A 4K9JA 1AS6A 2VMJA 1AS7A 4YSOA 4RH4A 1NWOA 1OCZB 2BWDA 1ID2A 1WS8A 3UAEA 1JZJA 2VW7A 4YSDA 2HX8A 1QHQA 5PAZA 3NP3A 3QJRB 1PZAA 1SF5A 2UX7A 4E9VA 1T5KA 4P5SA 4AZUA 2DYSB 4E9WA 2CCWA 6PAZA 2VW4A 2FNWA 1NPJA 1BXAA 1NPNA 4W9ZA 2IDSA 3UABA 5FC9A 3EH5B 3GDCA 3QQXA 1ZIBA 4YSRA 1L9SA 3NJMA 1TKWA 3OQRA 1M57B 3TBBA 1JVOA 2W88A 1F56A 2UX6A 1GS7A 2GB2A 1AZUA 4BWTA 1A4AA 1WA1X 1EZLA 2IDUA 1SJMA 4E9SA 3NJGA 2MTAA 2FT7A 2VSMB 4L0PB 1XB6A 5A7EA 1WA0X 5LDUA 4EF3A 4UF7C 1L9QA 4YL4A 3JTBA 4AKQA 2IWEA 6PCYA 3NSDA 5IY5B 1AQ8A 2XWZA 2JKWA 3FU7A 3NJKA 4KOBA 3TA4D 3DKHA 3NYKA 1SHWA 4Q89A 1ET7A 3ERXA 2BP8A 2AZUA 4HCIA 2GC7C 3PCYA 3S8FB 4AKOA 4AX3A 4YSTA 1OE2A 1SNRA 4DP9X 1ADWA 4E9TA 2BW5A 2AVFA 3X1FA 4PCYA 9PCYA 2EIJB 1JZEA 2BO0A 3T71A 2JXMA 1BYOA 4UANA 3T6ZA 3UGEA 3ABKB 1SFDA 3IBOA 1CURA 1SFHA 4HALA 5B1AB 1MG2C 1ASQA 2PP8A 2GC4C 4YSSA 4KO7A 1M9WA 4HZ1A 3V9EA 2YQBA 4A68A 3FU9A 3FSWA 3T6VA 1TU2A 1AIZA 3ZIYA 3QJQB 1J9RA 1OCCB 2CALA 3AW5A 2XVBA 2HZHA 2YARA 1WS7A 4F7KA 3OMIB 2Q9OA 2ZOOA 3EHBB 1AZRA 4N8UA 5B1JC 1A8ZA 1XB3A 3NJLA 5I5IA 2FT6A 1NWPA 1X9RA 3U25A 5I6LA 2CAKA 3FSVA 4KNSA 3PAZA 3NT0A 1GS6X 4PAZA 1NICA 1GYCA 1SHXA 1JZGA 1J5CA 1MG3C 3MBWB 3CVDA 3FPXA 2XV2A 4A2EA 2HRHA 2CJ3A 2QDVA 4NERA 2XV0A 4P5RA 2PPEA 2B3IA 1JZHA 3GXUB 2GBAA 1JXGA 1AAJA 3PAUA 2DYRB 4G72B 1E5YA 1BAWA 4YSEA 1KYAA 4NAJA 1ILSA 2HXAA 1PLBA 1V10A 3QJSB 3SBPA 1CC3A 4HHGA 3ABMB 2FWLB 5AZUA 3PAVA 3T6WA 2J57A 2WO3B 2BW4A 1X9UA 4KNUA 3X1NA 1L9TA 1AANA 4ENZA 4BWWA 4CSPA 1KBWA 2A3TA 3FU7B 1IBZA 4MFHA 1MZYA 2QT6A 3CVBA 4G7SB 4AI7A 4DP6X 1ILUA 3DIVA 1L9RA 1TEFA 1GR7A 2BP8B 4G7QB 2Q5BA 4KO9A 2PPCA 3NSCA 4HIPA 1L9OA 4QKTA 1QLEB 2IAAC 3TBCA 2Y69B 3C75A 1PF3A 1AS8A 3T6XA 1GW0A 5EHFA 3PPSA 1AOZA 4GP4B 1BXVA 2XXGA 1QNIA 3TU6A 4A2GA 1BXUA 1GY2A 3WNIA 3QJVB 3PLYA 3WIAA 3N2JA 1AR1B 3WNJA 1E5ZA 3GYRA 1ZV2A 2JFCA 2YAQA 3X1BA 3IN2A 3SBQA 3FYEB 2IWFA 3FPYA 1KDJA 2XLLA 3CDZA 1R1CA 5I26A 3S3BB 5B3SB 1W6LA 3AG4B 1NZRA 2J56A 3WG7B 1AZCA 3NJIA 3SQRA 1KGYE 1SDDB 1PZBA 2YAHA 2PPFA 5B1BB 1I53A 3AG3B 2WO2B 1PLCA 2FTAA 4DP2X 3QPKA 3WKPA 2MRYA 2W8CA 1VLXA 1PZCA 2FQFA 2XUWA 3H4HA 2OV0A 2UXFA 2YAOA 3L45A 4YSPA 2XX0A 2DV6A 1SF3A 1NINA 1OCRB 1EHKB 1KDIA 1IUZA 8PAZA 1DZ0A 1NTDA 2VSKB 1NIFA 3IEAA 1WAEA 1E65A 3H56A 1NIDA 7PCYA 4WKXA 4DP1X 2GHZA 3UADA 3FT0A 2UXGA 3QJTB 4DPBX 1IC0A 4DP4X 2IDQA 2H3XC 1HFUA 2AFNA 3ZDWA 2PPAA 2X87A 4YSAA 3X1GA 3FU8A 2J5WA 4GYBA 3ASOB
chains in the Genus database with same CATH superfamily
1I1AD 2YWYA 3OXRA 3ZL4H 3G6DL 4FQQA 3HKZA 1V5JA 1UA6L 4E42B 5L2JB 4ZFGL 1T5WA 2R56H 3M86A 3O0RL 4F27A 5I30H 1FFNA 2VDNH 1PYWA 3EGDB 2GEQA 5L9DH 3NJJA 1QQDB 5HGDB 5FOBA 1R0AL 2XJLA 1YDPB 5L4FA 2DEWX 3E80A 3DRQB 4URKA 3FUNA 3HI5H 4PRIA 1MZZA 1A6TB 1KPUB 2X1QA 3F7PC 3LEXA 4L1BA 4TNWF 4Y1AA 2QADC 5SWSE 3RWCA 4AE0A 1F90L 3TYGL 3GMPB 3G6JE 5I8KL 5CN2A 1C16A 1BREA 1CFSB 2EACA 1DBJL 2Z31B 1BX2B 1JL8A 3ZZLA 1U8JB 4PRID 3WUWG 2BM3A 1JPSL 4Y1AD 1T83C 4Z3EA 3ABZA 3FU3A 5C6TL 3FN0H 4EN3C 2B4CL 1K8IA 5AYQA 4ZW3A 1WT5C 4Y4HC 1ZT4B 4F7PB 1TQCC 4TUUA 4ZYKB 3PL6A 1JFQL 5L4IA 3GEWB 3W11C 2P8LB 3RE0A 2CLVA 4POZC 1CO1A 3FFDA 3IMVA 3CVHH 3EYQD 1NCHA 3M6DA 2W59A 4OIBA 4X99B 2AMUA 3FU5A 2EADA 2FEJA 2P80D 3CFKB 4HU2A 4QCIB 5KBMA 1U8QB 2OR9L 3QDME 5I1CH 1NCUA 3ATDA 2XZQL 2WSKA 1E3XA 4FXKA 1I1FA 2DIJA 1XCXA 4DN4H 5I6NA 4BZ1A 3VW3H 3AADB 3K2UH 2CJUH 4RMSA 3BSZA 4Y9FA 5F96H 3ZKNC 4V33A 2NR6A 2IOMA 3I75A 1EBPA 3D50A 1UZ6E 3P9MA 2PABA 4P2RD 3C6SB 5HJ3B 1F4WL 5DR5H 1DN0B 5AKRA 1IAIH 4H26A 1PZDA 1QBLL 1FA4A 1D6VL 2EE9A 3VE0B 4G7VH 2NR6D 3GQFA 3CG8A 3GMLA 4ZSOB 3ULVF 5C86A 3QWOA 1IBGL 5EU7E 2Y7QA 1ZVSB 5J13C 5AENA 2QQLH 2J55A 5ALCL 1A3LH 4LLYA 5HYJB 1ZGLM 4PHZA 2WTOA 4Z7UE 4PM1A 5IBTH 3QHZH 1GYVA 4ATTA 2X3CA 1QD0A 1G0DA 4JFEA 2P26A 3MV8E 1PTZA 4YO0A 4PJAE 1HH9B 5IQ9B 2HJLA 1NOAA 1MFDH 3WJMB 3QXVA 2GFBA 2DQGH 2L7UA 5AW1B 2XX1A 4JFED 3OHXC 5IVZA 3D0AA 4M43L 1QUNB 4NGHL 1KNOA 3QI9A 4WEUD 2P43B 3CXHK 4K94H 4QXGL 5IQ7L 5DD0H 1YMMA 5INDB 3QI9D 4FNUA 4G80A 3O6MH 2JKRM 4G8IB 3OMNB 4QHNA 2ZONA 1CK0H 2ED7A 3DETC 3NGBB 2C9QA 4TPRL 1FFPB 1E9OB 3UCRA 4K94C 5D4HA 4GW1A 3DX9A 4WU5B 3LH8A 3AFLA 1FJ1B 5F44A 2PW1A 1H3PL 1MFBL 1G9HA 1XF1A 4Z7WF 5IHUL 1HCYA 1KBBA 5HHVH 5AG8A 4XWOD 3F12B 1VFAB 4MB5A 1D5BB 5EU5B 3OKNA 5E99H 3ELQA 2BH0A 1J9SA 4J8RB 4K9EH 4RQQA 5HHOD 5I76B 2ZYIA 2FDBP 4OLEA 4YXKL 1P1ZA 1IAOB 3FQ1A 1DZBA 3QEHA 1I8LC 4I2XB 4DVRL 1RIVL 3PP3K 4KRMB 4Y2DD 3B2UC 4OV6F 4E2OA 4E0RB 1G5GA 2OTUB 4P46D 2OJEA 3OR6A 4X5RA 1TJXA 4YGVB 5GJSH 2A83B 1VB9A 1IAKB 1IC7L 2BZ7A 1U3HD 4GINA 4K9EC 4M3HA 4O02L 1WQVT 4OZ4B 4KUZL 3FO1B 5GGVL 5L0QC 4HF5H 3PHAA 2J44A 2OKMA 2K8MA 2IBGA 1CDGA 2HKFL 2J6EA 1RUKH 3CSPA 2H32H 4JO4H 3WI9A 4P4RB 3DX8A 1RHFA 1JGEA 1SMOA 4R90L 3FFCE 5B8CB 5CBEB 4O4YH 3ARGC 1Z9NA 4Y5YA 2PWDA 2IPKA 4PGEA 1A4BA 3MLTA 2OXGB 4GBXA 1I9RL 4J39A 5DK0B 5J7CC 2K78A 1KLFB 4JQIA 1MIEH 2VC2H 4LPCA 2E7CA 3ZE2F 4R5TA 1OSPH 3IJSA 4JKNA 4KPHH 2X4OB 3TCLA 4TVUA 4BSWA 4JM2C 3K2IA 3GTVA 1HCFX 3DX7A 1QRNA 3RGVB 4Z0BH 3Q43A 4YLBA 5GQBA 3KPRE 4UV7L 1Q0YH 1Q1JH 3LQMA 4F9PC 1QTPA 3RWHB 3MREA 3R06B 4M3KB 4B3VA 3FF7A 3RZCB 3T1FA 2L04A 4C4UA 4GUQA 1JNLL 3SIKA 4XPBH 3NJXA 3VRJB 4KK9D 4XP5L 4YX2H 2F53B 3LS4L 4PJ9A 5BVPH 3VM7A 2EICA 4PEEA 2Y7SA 4PTTA 1TTFA 2P7TB 3EJTA 1Q72H 4N2FA 5FK9B 5KSBB 4LHJB 1K3IA 2X09A 5CS7A 1HXYB 3WEBA 5DZPA 3GBNH 4PJ9D 3WELA 2HPTA 2VZ1A 3DVNA 5IB5B 1T0MB 3EYUH 3L3OC 25C8L 4HWNA 1M05B 5JHDA 2ZXCA 5HGHA 1T4KB 4QGTA 5FO7B 5IV2A 1IGIH 4P07A 4PU2A 1NDMA 1QPKA 1NGZA 3OLEA 2WZAA 4D0CA 5JHDD 2N0KA 1KCRH 1MY5A 1KPVB 2B2XH 3B9KB 5HI5D 1A6ZA 2Q8BH 5ICUA 2BHYA 1H15A 4Z7OF 4I3SL 3TCTA 4BA8A 2EUWA 2AQ3A 1X4ZA 3CSTA 4ODUB 1GC1C 4UQ3B 1KGCD 2R29L 4FYTA 4PJDF 4KMTH 4AKQA 3HAEG 5C0GA 3ZUNC 3OLDA 2XQBH 3HUJA 3WNKA 4FOMA 2R1YB 3WEXA 1ZT1B 3DJ9A 2AXHA 3RWFA 4NZUL 3SDXE 5KANI 2VZVA 4HH8A 2OPCA 4KITB 2WQAA 4PJCA 3EZJB 3BUDA 4XMZA 4U0RB 5J3HC 3QDGA 4I4WA 2H2SC 3LYRA 3U6XS 1AGBB 2IALA 5F93C 1WGOA 3BGAA 4IMKC 4X5WB 4YSTA 2EO1A 2Z4TA 3N43F 5JXEA 2X4PA 2A9DA 4X50A 1VSCA 1P7HL 2JCCA 4I89A 3UPRB 4Z5RA 1G6RH 3BDYH 4F1ZA 2C3XA 4Y0GA 5F21B 3X1FA 1INEH 2KLRA 4HIJA 4NWUH 4H2CA 1B90A 3V0HA 1HSBA 5JXED 4YC2C 4DUVA 5I71B 3IBOA 2CO4A 4XP1H 1EEQA 2VWEE 3VXQB 1NCBH 2KZ1B 3BZ4B 1EZVX 4X4XA 4G6FB 1VESA 1HHHA 2JTYA 5IUCA 1DLHB 5MHSE 3QIWB 2FJFA 1ERNA 5IOPB 2NCEA 4QRFA 2AITA 2JI3A 4MMYB 1U8KB 1XH2A 3NZ8A 1L9NA 3FK3A 4QRQA 1J9RA 1OCCB 5D7KD 1KIRB 1TPXB 3MNZB 4GKOA 4PJ5A 3SD2A 4ZUTA 1TVDA 3OKLB 1XF4B 3H3PL 3EHBB 4XBGA 2J71A 4LDOB 1G1OA 4JRXA 4LLUA 2FHCA 3NZHH 3OZ9H 4QYAA 5GRXG 3WE1A 1IBBA 3RVTD 4MNQA 1X9RA 4PJ5D 4OV5B 2YA1A 4HCRH 1CGTA 2Z31C 4NO5B 1KB5A 1XSJA 1MG3C 3KYMB 2V7HB 4AOFA 1FG2A 2ERJC 4KK6D 2OL3A 3V6OC 4Z76B 1J11A 4MNQD 3VFPB 4HJ1A 2UYLA 4P9ML 5DFWH 1MAKA 3D33A 5IK3A 1U4EA 1W2KT 3JSSA 1AAJA 3MRPB 1P4LA 1SLUA 1KYAA 3CHQA 2BDNH 4JHWL 5EU3B 2A73B 5ALBL 3QIBD 4CL7A 3QJSB 4YGAB 3HMXL 1FCGA 1T5XA 2E76C 2KI6A 2XVKA 3QFJB 3V5DA 2YPKA 3L1EA 4GMTL 3GT6A 1NC2A 4PJGA 3UZEA 4A2LA 1HYSD 1OAZL 4G8EA 5FIEA 5JW4N 4R4BA 1D5XA 4FMFA 4BUQA 4ZQKB 1B0RB 4XCFL 43C9B 3MLVH 5DUBA 3FUMA 5BRQA 3BIKB 4GIOA 3L95A 4HBCL 3WKMH 1U95B 5EEZA 2K7PA 3NIDF 1FYHB 3KEHA 5FYLL 2QSCL 2XYCA 2JKJA 2IJ0C 3GXDA 1Z0MA 1K8DB 4P3DA 4XXCA 4YN3A 5HHPA 1HEJC 4F3FB 5TDOB 3LNEA 1IVTA 3HR5A 3DHJA 1JZ2A 1A4JA 1DQJA 5D72H 3QZOA 1FP5A 1CFQA 1HWWA 2VITB 3KWVA 4I77L 4M6NH 4OIIL 4PLKD 4EDWH 5IJVB 1X5FA 4ZUUA 3AS1A 5DJCA 4N3UA 5J9PA 3V4VB 1TT6A 2E7HA 4NQDA 1ZWIA 3O3AB 1E6OL 4NT6B 1FVEB 1RV6X 3IFPB 3RGHA 5FUZH 5D1XA 5TFSL 3RTQA 4TNVK 3D30A 3CLEH 3F7YA 4H8WC 3K80A 4NQDD 1OLZA 1AD9B 4A6YA 3X14A 2CKBB 2HG0A 4NPYB 4QRSB 3IDIA 1ANUA 3PWJB 4KKLC 2ORBL 3AMLA 1PZBA 1LE9A 5C6WH 4OLVH 4DTGH 5BZDB 3TZVD 5ISZE 2FTAA 4PJIE 2F7IA 1EAOA 1B9KA 2OMYA 4HC1H 4CW1A 4IIZA 3R7QA 2ZWLT 3AXHA 4L1TA 2E4FA 5DURD 1S9VB 1LQBC 4W4OA 3V6OE 3A6BH 2YWZA 1Y0LA 4UV4H 4AYFB 4NQCB 2ZXGA 3I84A 3IEAA 2ZUYA 1CLCA 1GZQB 2E6PA 4UQAA 5ACZB 5JOFB 2AAVA 5ICYA 3FBKA 2DQCL 3NGBC 1H8OA 4I3RH 3CLWA 2BSSB 3STZA 4B5EA 2H45A 5A2JH 1AI1L 3GSQB 5SWSD 3TPUB 1BHGA 4IHOB 4U6HA 1J1XH 2EYTB 2JB6A 5LXGL 12E8L 2VR8A 2XWBB 2XVLA 3F84A 2CDEB 4GYBA 1MCJA 4NJ9L 3F65A 4X42A 1MCKA 3FTUA 2C9AA 3L3HB 3PHOA 4PRPA 1HK6A 3I6KA 2G9HB 2GY5A 3GI9H 2X2YA 3NACL 1NBVL 3KW8A 2NSQA 2KZWA 4MSWA 4B0MB 2HKHH 2Z34A 4S1QH 3ZZSA 4Q4IA 5HHMD 1B6DA 1DQDH 3SODB 1NFKA 3ZBMA 4MHHI 3BQUC 4JN2B 2WYTA 2PP7A 3GJFH 3HI6L 3NJNA 4IDJL 5HYJE 3BP7A 4P2QB 3T0BA 1NEZA 1R5WA 1IEAB 2HUEA 5D4JA 4KQ4H 4W9EC 3VSVA 2A9AA 3FXIC 3PDDA 3WAKA 4JB9L 4X0KB 3QR1A 4DP0X 1IM3B 3ENEA 4UMGA 2DQJL 1ZRUA 4YE4H 1VGKB 3B7UX 3WS3A 1AMYA 3DNKA 4JFHE 4TMPA 5LBSA 4X0NA 3AVEA 5C0CE 3RGVC 3VU1A 2K8QA 4FYQA 1AXSB 3VGDA 1EGJA 4J6RH 5AOJA 3ZHNA 3TJEL 4CU6A 4FHBD 1AACA 2V2TB 5KJ7E 4N26A 2V17H 2MHAB 3RZCC 2XXCB 2KC0A 4PSRA 1IC4H 2X7LA 4BXSV 5JHLL 1BM3L 1I8AA 3F8UB 3E3QC 4YDIH 4OZGA 4RZCB 4Z0XA 1FWXA 4KRPB 3MV8D 3ZTNL 4PCSA 1LE5B 3K72A 2BRQA 2Y7LA 3LEVL 2ZX9A 1T83A 1RSYA 2QADD 2APFA 4PV8A 4BUGA 4ZX6A 3H54A 3X12A 4Y4HA 4F2FA 1JJUA 4AKPA 5T1KA 2EC9T 4LPTA 4MS8C 4PVLA 5E4IA 1UVQA 5AAWC 4KROB 2Z7WA 3IDUA 1E67A 1FRGL 1UATA 4DEPC 4Q6IB 1JYNA 4Y4HD 3EDEA 4NAMA 4K23L 3PV7A 4IGBA 5HYSG 2UWEB 1KEGH 5CCHE 2O5YH 3W11D 4POZD 3VXUA 3AB0B 3B9KC 3CDGB 5ENWA 3EH1A 3MYJB 4YHIB 4NN5B 4IGBD 3GMMA 4NCC2 4KQ3H 3VXUD 2VL5B 3NQKA 2RB8A 5DQ9A 1FH5L 3ECUA 2CBTA 5F1NA 2DICA 2WCSA 1DJZA 1MI5A 3BRFA 2O4EA 2LQRA 3IFNL 3ZYIA 4PRAB 4A2DA 1UM6L 1YN6B 3RQ3A 4IRZA 3GO1L 4AEIH 5BQDA 1INQA 3TT1L 2AJYL 4QLWA 1NAMB 2C1OA 1KCVL 1MI5D 4KY2A 1BEYH 3CC5A 1A4CA 1MOEA 4JQXC 4S1SL 1RUAH 3ZKND 4JZNB 3AGVA 4L0YA 3DO3A 3PNWA 4AG4H 3SE4A 4BGDA 5J4MA 4TUOA 1FZJA 1O9WA 4YHLL 4DO5A 5D9SA 4S2SA 3CFJA 4U1JB 3RWIB 3BKYH 4RAUB 3VXMB 3W39A 2D7MA 5IKCB 1URIA 2FJSA 2VXQA 3QUZB 4NO0A 4BSVB 1AHKA 2YUVA 3CDCA 2QHLA 5IHWA 2WTPA 2ZUWA 5I71C 3C2AH 3FFCD 1UCBH 2CO6B 2AJUL 3CFEB 3FUJA 4YBQC 2XKUA 3VG9B 4G9FE 5ICZB 3D1MC 3CVIH 4L4VB 3QIWC 2A6KA 3TIEA 3E3QE 5EC1B 4L1SA 4L8DB 3Q8EA 4F7EA 3DYOA 1EO7A 3EH3B 1BECA 4KTDH 3BPOB 1TPXC 2WP3O 1CDHA 4LOUC 5D1ZI 4DKEL 1CN4A 4QPEA 4M8QA 4KTGA 3EHBC 4LNRB 1CQYA 4XOCA 4BHUA 4OLXL 2YAPA 3AWGA 3C9NA 3X3GL 3TV3L 4YSUA 2WQSA 4WI6A 2ENYA 4IJ3B 4YHPB 3WAJA 3DOSA 4NQEA 3LHPH 4BH7A 2I9LB 5CZRA 3ZYZA 3ARRA 4JHAL 3GZPA 4YUEL 2ARJA 2HLAB 1AGEA 1YNKH 4M7LH 1M7IA 3V6ZA 2JJUA 4MDRA 1KXVC 1A4KA 4B9KC 1HOCB 2R39A 2LAGB 3QNXA 3DETD 2R7EA 3VFTB 5CN3A 3C5ZB 4F2MA 4QXWA 5F8RC 1J10A 1KWKA 2KZBA 2ZOLA 1T2XA 1PZSA 3APDA 4XAKE 2EIEA 3FC8A 4BRJA 3VWKA 4XC3H 2NNFA 3HLAA 4JDVA 1QACA 3BH8A 3BYYA 1W0WA 4NRZA 4X5XB 1MCOL 5EZJB 1F4XL 4OI7A 3QUKB 4JJ5B 5IFAL 3NP3A 1AZVA 4A38A 3B2UD 4BHUI 2ZUUA 5KW9H 3HRZB 3F5WA 3SE6A 1CPUA 3QUXA 1THAA 4U1HB 3CFDA 4JY5H 1IFGA 4OTXL 2WXRA 4PS4H 3H9HA 4HJEA 4Z3JA 1F6AA 4W9ZA 1G7MA 2KMWA 5JLZA 4LPUA 3W2DL 1H6UA 1NGXA 1Z6JT 1O9ZA 2X0WA 5L6YL 2CGZA 5F7DB 3VD0A 3ARGD 3U83A 2EUVA 2CKBH 2DW5A 3G5YA 2BY0A 5DF0A 4DAGL 5EZOH 3U9UA 5K33A 1IARB 3N0PB 1YCSA 2XTJB 3L3KB 3O4LE 1YEFH 1Q8MA 2NXYB 3VGEA 3D0VA 5IQMA 1S8DB 2V8MA 1KENL 3GXTA 1P7QD 2Z93A 4MAYB 4C4KO 3ZPDA 4OFYA 5LDUA 3DURA 4KNQA 3VI3E 3CX2A 5FO8B 3IFOA 2NNCA 4G42A 5FHBL 5FF6A 4G8GA 4JZJA 3NFNA 5E1IA 3TBVA 1NLDL 3UZQA 3GSOA 1PEZA 4AYEC 1WFIA 4U3SA 5F7YC 3AAZA 2DQEL 3QEUA 4GT0A 5DD1L 3LSOB 4MA1B 4KH9A 1ES0A 1UJ3A 4PWEA 4M8RA 4AZ8A 4QRUA 1ZGLB 1KB9J 1T1YB 3D7PA 2F74B 2V9TA 4WW1A 5MHSD 2I5YL 4V11A 1OE2A 3S35L 4QHPA 4LGPB 4OJYA 3TLRA 2D7TH 3L3OA 3DOHA 1WP6A 3DXAB 3G6JF 2MSPA 1ZV5A 1JRHL 3E1ZA 1RPQA 2D4DA 3QW9A 3HN5A 2BRRL 1IQDA 4ABVA 5JXAH 3B5GA 4TM9A 4KKCC 5DRWB 3T8XA 1QEXA 3UMTA 1DBKH 1HDMB 2GIYA 2CK0L 2R8SH 1I9JH 1H3GA 5EFIA 5AVUB 1KZYA 3TBWA 5A16B 1WJ3A 2GJZB 4LDCA 2ITCA 4YOKA 1CLOH 1ZEAH 2R1XA 2FX8H 3HC0B 4ZFFB 2YARA 3OAWA 2R2CA 4HFUL 3DK2A 4MA8H 3UTTB 2DF3A 4PQXA 4R0LB 4Z9KB 1JHTB 4X8XA 4LLVB 1BZ9B 4Q7DA 1S7QB 3KYKH 5MEQB 3TNMB 4GKZB 2JJSA 2NW2A 2ICCA 4QIRA 4GG6A 4IMKA 1YAIA 5IEHA 1LD9B 4I1RA 4ZNCD 1ZAGA 2V2WB 2PPEA 2MWCA 5IMMA 4LARL 2H2SD 1JXGA 1S3RA 5AW6B 3T4YA 1RPUA 4JRYE 1S7SB 1O6SB 4JVWA 2LFEA 4YFEA 2P24A 4QR7A 1OAQH 3MNWB 2AI0L 2RAMA 5DHVA 4R26L 1MLCA 5ECGA 5TE6L 1I7TB 1YNTB 1JK9A 2X0VA 1C7TA 3AS3A 1NEZG 5F0LB 5KVGL 2CGRL 1A1NB 1FAKT 2Q0ZX 1MCNA 1FC1A 5CM1A 2HJKB 4CC4A 4WNSA 4M48L 4BQ9A 1JPEA 3JYBA 2YGVA 3EGDA 4YHKL 1INDH 5HGDA 4Y19B 3QBTB 5TQ2H 1FNEA 3CD4A 3KH4A 3R7RA 4YQXL 4H2AA 5C97A 1A6TA 1KPUA 2ED8A 4PJAF 2PPCA 4G8FA 2JI2A 5JW3H 3GMPA 1BJMA 3EUUA 1AS8A 4KRPC 2P1YA 4HZLA 3UXFA 1BX2A 3Q5OA 4MNGE 1U8JA 3TN0B 4NQVB 1TZHB 4GAGL 4WFGE 3VFMA 2APSA 1NBZA 1RJYA 2YN5A 2NY5H 2Z31D 3PLYA 3UJIH 4ZYKA 5DQDH 5L88H 1PSKH 4KROC 2DTML 2OTPA 4OZHB 1UWYA 1A22B 3SBQA 1O7DC 1DL7H 2W9EH 1ETB1 1URLA 3MTXA 3S3BB 4DZBB 1W6LA 3B2MA 5DLMH 2HFTA 4F80A 4HQQH 3SY6A 3BIBX 4X99A 2R0WL 3UTPE 3AB0C 2NY5C 1A7QL 2DYPB 4AEFA 4YBLB 1L3NA 4MZ3A 3MNDA 1T1XB 1YPZE 3AG3B 3PYCA 4NN5C 4QCIA 4Q56A 1NAMH 5SWZA 1F4AA 5CKGA 3FTWA 2CUIA 4PJ7E 1ACXA 1AP2A 1EEYB 1NFIA 2R69H 1GZHA 4LIQH 5JOEA 1NCNA 4H4NA 2EH7L 2YSSB 4PVNA 3A67L 4AVIA 4LEXH 5HJ3A 4D9RD 2DBJA 1DN0A 3SGEI 5IR1B 3AREB 3V0FA 3VE0A 1WGVA 4X4YA 1DANT 2EEAA 1XF5B 5E2VH 5CEZH 4DGIL 4NENB 4XNBA 4Y9BA 2AGJH 1PDKA 4PFEA 4F92B 3PF2A 3QUZC 5E6IA 4HUVB 3QUYB 1U0QA 3ROOB 2XKNB 1UJTA 3IAQA 2Q20A 4UBDC 2FO8A 4HUXA 3WFEH 3WNLA 4ZW6A 5TDNA 4AVHA 1S4IA 3Q7JA 5EIVA 3V0WH 3ASOB 5I17A 4MCZA 5BRZE 3UEZA 2DM7A 4UTBH 4XNAA 4CA4A 1W72L 4M6OH 5HYJD 3QXUA 1GOGA 4NC1E 2Y2WA 5KAQF 5EIIB 3KWXA 5HVHB 1AYOA 1DQLH 1ZHLA 2YBRB 2Y36L 3HBZA 2DRUA 5AW0B 5FGBC 4JW3A 5IMLB 1KB9K 2VMFA 3FZUD 4J4PC 4KKLD 5TDPA 1ZSDA 4DKFH 2XPGB 2QL1A 1QNZL 1QUNA 2DKSA 3EG9B 2VRKA 4J12A 3GSXA 4UMSA 3BPOC 1I4FB 4W6WB 3V5KB 1A8JH 1T22B 3D69A 3GRWA 2DWDB 4JFXA 4QRRA 1RK1B 2QVFB 3LPFA 1GTFA 1HQRB 5INDA 3V4UH 3IF1A 1D5IH 3IT8D 1BQSA 2IWKA 4LLWB 4XVTH 4AC2A 4IJ3C 4ERSH 1MCLA 1JZ7A 1UZGA 4FKEA 5GGUB 1JS4A 1SXBA 1MEXL 1O7DE 2EDRA 2XNAB 4WU5A 2OZ4A 4WWKB 4WUUA 1Z9SB 1FJ1A 3V0JA 5ADPL 4TULH 3ESUF 5IB2B 4KJPC 1XD0A 5FM5M 3UAAA 3C5ZC 5IROA 1VFAA 1IE4A 1D5BA 3DUHA 3NA4A 5EU5A 4ZX4A 4QRPE 3WD5H 1ND0B 1YZZA 3QQ9C 1EJFA 2NYYC 3D9AH 4J8RA 5I76A 4YAQA 1B2YA 3RHWK 3FS9A 3B3IB 2VISA 4TVPD 1ZS8A 1ET8A 1M56B 1X6LA 3GMOA 4ZMXA 1PNCA 4LDEB 2HH0L 3WIHH 3QXAA 3SDAB 3N85L 4PWGA 3BPNB 3FRUA 1I7RB 2WLIB 2Y1VA 2FECL 2ICEC 2QVMA 3ABGA 4BD4A 4TSCL 3FO1A 4E41E 1EK3A 3JTTB 2VXTH 3AY4A 4NXSA 1QLEH 3HRZC 1AHWC 1UB6A 4LIQE 2B0SH 2V4LA 2XN9B 4GAYB 5HJGA 1BZ7B 5F9WB 3TBTA 2XPYA 1PGRB 3FUFA 4XO3A 5B8CA 4LESA 1GGTA 2GIMA 3OB0H 1SUJA 2Y4SA 2OXGA 5LG1A 4EIBA 3FSAA 1EDHA 4MXWL 5D7SL 4HP5A 3QNZB 3CBJB 1KLFA 5LGYA 5CEZE 3NFPB 4D9LL 3DARA 4DJMA 2IANA 3DV6B 1V27A 2DEYX 1KN2H 5DD3H 5ID0B 1UKQA 5CJBA 4RRPM 1H5BB 3ZKQD 4JFQB 2Q6WB 2VJXA 5GRJH 2XTJC 3UC2A 2NXYC 4KXCA 5DJAA 4JM2F 1K85A 3DVIA 1X5HA 1S7RB 2C3GA 1DSYA 4MAYC 2R4SH 4FEIA 3WFBL 1GJIA 5DRZA 1FZKB 1N6UA 3EOTL 5I6MA 4PRHB 3RGVD 4OM1H 4MAUL 4I0PB 2XPZA 1YEIL 2LTQB 2M1KA 4TLSA 3OKKB 3VRJA 1E7VA 5I2IA 3QC5X 1TYEB 1LO2L 2VAAB 1HAUA 1DJGA 2F53A 2FIKB 1ZDQA 4MA1C 4Q9RL 3RZCD 4XNYL 1QFWL 3B37A 3SOTA 3EKCA 4H1LB 2P7TA 4JG0H 1KBPA 1OP4A 5KSBA 2HP4A 2BIIA 4U1LA 1JMXA 2F53D 2ZQKA 1HXYA 2CZNA 1XGZA 4IOFC 5C3LD 1TVBB 2OYPA 2G2PA 5E9DB 5IB5A 4CU8A 3VTAA 1GIGH 4EZLA 1XB8A 1MCEA 1WAAE 3K1DA 3CFBB 3ULUH 1ASOA 3RL1A 5DJYA 4MS8D 1C08B 4ZS6C 5F7BA 1MFCL 1TQWA 5I1IL 1C5CL 3QCVL 3B9KA 1ZD6A 1KPVA 5C08B 3H42H 2TAAA 3ZOAA 4DGWC 2H5UA 5FECB 3ULUC 1OF2A 3B7TA 2YD0A 3P9WB 2MMXA 3ZYOA 2H0JA 1ZHNA 4HWEL 5CR1A 4UQ3A 4GAAA 5D1QB 3B9KD 4HS3B 2LE9A 4KDTA 1ZTXH 3F7KA 3D2UA 4PS7A 3MBEB 3U7YL 1EEZB 3M46A 1QW9A 5FOJA 3GK8L 4B6ZA 3U46B 2QDWA 3WL9B 2WLZA 3RNQB 1NMBH 5DD6A 4R0LC 3V8CA 5F9JA 2HUHA 3CAFA 2WW8A 3FO9A 2AAAA 4WW2B 5T1DH 1FO0B 2J1YA 3GI8H 1L6PA 3TVMB 1U91B 2ICWB 2FCBA 3BWUC 3KPOA 4UTCA 5KBPA 1LM8V 3EDKA 2XTJE 3FQXB 5HHNA 4BWUA 4YXLL 5I5JA 1T4WA 5C3TA 3C5XA 3O81A 2GAZB 4BFGA 2C3WA 4MXVE 5LVEA 3MXVL 4ZMPA 3C09B 1YEEH 4LKCA 5DRNB 2VCOA 3RVXD 5FW6A 5CJXA 1EV2E 4PN6A 4PV9B 3JV4B 1YSOA 4G6JL 1T1WB 5JNYB 1FQ9C 3GZOA 1IC1A 1RK0B 4DO6A 3SGKC 3C2SA 4FQLH 3BZ4A 2NXZB 3H9SE 3QZMA 4GKSB 4OQ1A 2GITA 4BGLA 1HTYA 1DLHA 5HYQB 5CD3A 3QIWA 4L8CB 3KWUA 4TUKH 5IHZB 5IOPA 3DMMB 1U8KA 2YJQA 3CBRA 3O11B 2JIXB 5H37A 4YBQD 2AK1H 4G6FD 5FDYA 3ZZ1A 1X7QB 3PGFL 1KIRA 5DJXB 2WGXA 4BZ2H 1F11B 3KLKA 1FNLA 4B7IA 2PW2A 3QIWD 1IGFL 1MQKH 3NEEA 3OKLA 3I6GB 1XF4A 4D9QD 1YEHH 1TQUA 1A7RH 2ZG2A 2YD2A 3BW9B 4RESB 2V3FA 2WINB 1OK8A 1TQVA 5IQOA 4WDIA 4ADIA 3SE9H 5D6CB 4LOUD 1S7TB 2ADJA 4OV5A 1NKGA 3E2HB 1A7NH 5DZ9A 3EHBD 2RA1A 1XH3B 3KYMA 1NMCB 5I1AB 4G59C 2W92A 2B1AL 3VFVB 3TN0C 1KXVA 3TBBA 4P8QA 1AQMA 4FMVA 5DUJA 3NCJH 3W9EB 5F89A 3BKJH 2E27L 2JXMB 5IWLC 3ULUE 3MRPA 4BWTA 1A4AA 2IFFH 1A47A 4IIQB 5EU3A 2A73A 4TLUA 3T8VA 2CK2A 4L23A 4U4BA 4UF7C 5D2NB 3QFJA 4GQ9L 4YL4A 1JZ3A 2IOOA 2G5BB 4N0RA 3KYOA 6PCYA 4YBLC 1EPFA 1M1XB 3UTTE 5C8JB 3PGDA 3BLPX 1B0RA 1T04B 3QFJD 3QZWB 2IMMA 3A0OA 1ZTXE 2FH6A 3BIKA 5DJZB 4CN1A 3TA4D 4EUPB 2Z7YA 3P3TA 5MI0B 3OAUL 5KYUB 3MCKA 1K8DA 2L0DA 1MJJB 4APQC 1AXIB 3UPCA 1JTTA 4F3FA 4NP4H 5TDOA 2O5XL 3LCYA 1D9KB 3FJTA 2NUPB 1F1AA 2M8XA 4U6XA 4HPHA 3GSUA 2DKMA 2C7FA 4N2EA 4LSPH 2X1WL 1JZ4A 1OD9A 3CZJA 2QV2A 4WUKL 4XB8A 3V4VA 3O3AA 2BNRA 3K6NA 3ILPA 1NGQL 1ZMYA 2EDNA 2OMVB 3AM8A 5I16B 3EFOA 5F9AC 3V0VB 4CSTA 1HH6B 1MCCA 3QCTL 4KKNA 2AQSA 1WFTA 3VFNB 3PWUB 2OJZH 3PWJA 1QSFA 4Y19E 3BXNB 1AGFA 1MVUA 4X80H 4EOWL 2AEPH 2CA3A 1AQDA 1UADC 1WZMA 2ATPA 4QHMB 4FQXC 1FNGA 2ITFA 4OCSL 4UINL 4HK3N 1MNUH 1WS7A 3ZRCC 2AHIA 4HFWB 4N8UA 4W9IC 2OMZB 1BG9A 5C0EB 3FONB 3NJLA 4FQIH 2HFFA 1S9VA 3WJJA 3VSUA 4QJ4B 5LKNA 5EF2A 3T0EB 1GS6X 1LYQA 4AYFA 1YY8B 4HS6A 4PB0L 4CDHA 2PWEA 4JMXA 1CFVH 3HCVA 1DVFB 5BUPA 4AM0A 1E9QA 4NQCD 4XOEA 4XNXH 1L7IL 2X4NA 4PJXB 4XBMA 3FQWA 4S1RL 2YXMA 4AYDC 3TPUA 5EOCL 1NUGA 4CNIB 2HT4C 5IVNA 1RK7A 4YMPA 1J0YA 1XO8A 3HIZA 2EYTA 3X1NA 4KTEH 2XWBA 3B2VL 4DPRA 1P2CB 3LZQA 4YLCA 3VFRB 2XACC 4YHZH 1SEQL 3L3HA 4WFGD 5IUSA 4L1LA 2B9AA 3HVDA 2QT6A 4OLZH 2JELL 3KJ6H 3WLWC 1A66A 4KKCD 3SDAC 3DIVA 3BPNC 1TEFA 3S2AA 3ILEA 4LK4A 1B9ZA 2R4RH 4NX0A 2N1KA 4NKQB 5GS2D 5D5MF 5FYKH 4KO9A 1P0SE 4OY9A 3SGDH 3UTPD 4HA1A 3HS0B 3WY2A 3IFLH 2A4EA 5F9WC 1KC5H 4O9HH 4O51A 2HT2D 4JN2A 1RY7B 1A1MA 2XXGA 3ESNA 1LNUB 1J48A 2LT9A 2XZCH 3SBWA 6FABH 1GGUA 5LAXA 1LDSA 3P4LA 5DS8B 4P2QA 2WZ0A 3F85A 2W9DH 2QQQA 4NUJA 1IEAA 2VLKE 4N2AA 3IN2A 4Y1TA 3QRGL 4ZMWA 4ODTL 3FPYA 4X0KA 1H5BC 1AXTH 2ZG3A 2J7LA 3BUYA 4P2QD 3M8OL 4HWZA 2JQZA 4PJ8A 5CEXB 4K3DL 2VT0A 1SXZA 2WHVA 4X6FA 4IJTA 4CMMA 1CJYA 4RISL 4XB7A 1LTXA 4L9LA 4TRPL 2H9GB 2FEEL 5D2LB 5GSRB 1IM3D 1DLFL 3KLAB 4MCMA 3ISYA 1HC1A 1HZHL 5BMFL 2V2TA 1X7SA 4H1LH 1TETH 2F19H 3MRRA 2ATKA 4I0PC 2P5WB 3CFNA 2LTQC 1NFAA 3DA0A 3MV9A 1MCRA 4XMLL 5ES4B 1OPGH 2MOVA 2VDKB 5I66B 2NNXA 2J8UF 4GXUN 5DHEA 1BZ8A 4RZCA 2HG5A 3KEDA 1TNNA 1ECZA 4I8DA 2V7NB 3MLRL 3MV9D 3T65B 5CWSB 4OLYH 3QHTC 4XRCB 3FB6A 3BE1L 3KDMB 4OD1L 2WUCL 3ARDB 1C9SA 2XA8L 3MKKA 4L8BA 4P9HL 1ZA6B 3P2TA 5C0BB 2AFNA 1WV7T 3L1OL 4HLZH 4KRPD 1FH2A 4X7CC 1FIGH 2GJ6B 4FHKA 1CT8B 1KIQB 2C1PB 1QR1B 4OD3L 4YWGH 3T3ME 4Y4KB 2QEJA 3LH2H 3V79C 3I3DA 4Q6IA 1N4XL 3IGUA 2J5WA 1S7WB 2P3YA 1H9DA 2JNZA 1SDDA 2VDML 3MFFA 5ANMB 3O6FB 3N41F 2UWEA 2H1XA 3BVDB 4KROD 4PBXA 3TJPA 1Q38A 1X5XA 2AJXL 4AY0A 1TZIB 1X4YA 3IDGB 3MYJA 4YHIA 2K6WA 2VLJB 2R2EA 1AKJB 2BCKB 2JE8A 1ZY9A 1K2DA 1T0PB 3Q8AA 4LQFH 5D1QC 1SXCA 3BFWA 4AUYA 1COBA 4ONFL 4XVOA 3UGXA 4PRAA 1YN6A 4UDTA 5FYKE 2AV7B 1TVHB 2NRDA 2YQGA 1NAMA 5CJOH 2E9WA 2VDOH 1MJ8H 1YJDL 4JFOA 1JGUL 4WW2C 3L5XL 4ZG1A 1Q90A 1WUZA 4LBEA 2AJVL 4GT7A 1MVFA 3HC3L 1LLAA 2GW5A 3Q2LA 4Y9CA 2EXTA 3T6QC 3TVMC 1UA6H 3O0RH 4PY7A 3VX1A 4PGCB 1UD6A 3RWIA 1WE5A 4RAUA 3VXMA 5T5NG 2A4CA 1R0AH 4BSVA 3VWJB 4YHML 2HVBA 2W5PA 2EVHA 3SKMA 3C09C 4U3CA 3WHE1 2H3NB 5LNGA 3VXMD 3QJOA 3U0PB 3MV7E 4ECNA 1IVLA 3PABB 3QUZD 4JE0A 3KPSA 2GK0B 2MPVA 3CFEA 4K73A 1IJNA 2NW3A 3TIDA 4UBDD 3TYGH 4PRHE 3TO4C 5F1KC 2NXZC 5GGTA 4ZAKB 5ICZA 1JPSH 2VO5A 3PP4L 4X8CA 3MJ6A 2YD8A 1SVCP 2B4CH 2NZ1A 4KKBC 2JLLA 1U8LB 4IBTA 5EC1A 3WNNA 3DMMC 1LILA 3AXIA 2AQNA 4J1UB 4NS0A 3V52L 1JFQH 1SYVA 4UTBA 4MA3B 2YEQA 3MRQB 4PW4A 2DM3A 2JI1A 4R7LA 4L4VD 4N0YL 2YD9A 4JK0D 1PKQE 2VZSA 4J4PD 3JWDL 3UL4A 1QSZA 3EJUA 4LNRA 2B4CC 2YD5A 4EVNA 2VZOA 3I2CL 4B60A 2H4EA 3B8YA 3H9YA 1Q9KB 5H37G 1CF8L 4UIMB 1NFDF 3E2HC 3ESVF 4WY7H 5J1AB 1NMCC 4LKXA 2HLAA 2BP0B 4AL8L 3QUMB 1GPOL 2BSEA 2EEXA 3BIAX 3TV8A 5IB3B 3WTWA 4P59L 2OL3L 1HOCA 3QQDA 4WFHD 1QZNA 4PWIA 3FQUA 3VFTA 1MFEL 2P42B 4BE6A 4FS0A 5D93B 4J3TA 4E5XB 1JD7A 4B9JA 5IHLB 4N8VB 2AV1B 2XG5B 4FTVE 4W9JC 3D12B 4KJPD 1LO0L 3C5ZD 1NC4A 5E5RB 5D2NC 4EUPH 1KSRA 5EF1A 4QOKA 1B6UA 1TEYA 1UFGA 3EO0B 2NYYD 3S3DB 5EZJA 9CGTA 3P30L 3ARVA 4R9HA 3LIZH 4H7VA 2I32A 2WYHA 4D8PB 4JGJA 4UTAA 4JO5A 3HRZA 5F7MC 4C58B 5JOPD 5MI0C 4ANVA 4U1HA 3MU3A 4FQCH 4JO8A 4KVNL 4B27A 3NESA 4P5TB 4ETQB 1OSEA 4UOZA 3KHQA 1K9TA 1D9KC 2ARJQ 3P69A 3MJ9A 5EA0H 3EJYC 5FKPA 1BQUA 4JFYB 1G7HB 5CF3A 1E5UI 1N10A 2SEBB 4XVJL 3ZKXB 5DGRA 4ZS7L 4KV5E 4GFTB 4PJFB 4E9YA 4H40A 2AJ3A 2ILLA 3QJFB 4WFFD 1XH1A 2D4FA 1ETA1 1K4DA 3KDPB 5DJ6B 3B43A 2YPLB 1I7ZB 1SY6A 1JERA 3R19A 3V55A 43CAA 4MS6A 1U93A 1DE4B 4H0IA 4P2CG 2BVEA 5HHXH 3IKKA 4MAYA 5F9OL 5BZZA 5JQHC 1GW6A 3BP6A 1UYWH 4A6YL 3EJQA 2XTJD 5FO8A 2NXYD 5H94B 1OGAE 4G6MH 1HVXA 4MAYD 2VSDA 1B2WH 1SHMA 1NCWH 1DBBL 4XMPL 4YHYB 4LCWB 5IHUH 1E4KC 4OB5H 4YZFE 3DPDA 3TBSA 1SPDA 4IHBA 3T0EC 4AEHL 4FC3E 2F74A 5K5YA 4JPWL 5CEYA 4BFNA 1RIVH 4MDJB 5J1TC 1AH1A 3VG0H 4ZPTB 3FQNB 3DSNB 3I02B 3FT9A 2BZCA 4KK5C 1DVFC 2GBTA 3QPXH 2QHRH 1F6LL 2X53A 3IMWA 1J5OL 4U49A 1IC7H 4L37B 3DXAA 5IOKA 4KUZH 2Z0BA 4N8CH 1VCAA 4NO3A 1GS8A 3PQYE 1CL7L 3BWZA 5TGBB 3C6LB 1BWMA 2OP4H 2OA9A 2YUXA 4M62H 4U1GB 4XCYA 1OZUA 1FN4B 3N42B 3RWDB 1R3JA 4XWGL 3DXAD 5B21A 2NLJB 2RMNA 3P73B 4PJEB 1UH2A 5CBAB 1TCMA 5DRWA 2IPUG 1HDMA 4ZS6D 3PXJA 2WVUA 2WQWA 1HIML 4ONGH 3L1GA 4I9XA 4MCNA 2IH3A 5AVVB 1OHZA 2ESVE 1MSPA 2FO4B 1ZTMA 1XH0A 3ULUD 2D3NA 4XZUA 3W82A 2RIKA 2N01B 3QQ3B 4U33A 4KKZA 3TGXA 3DO7B 1FGVL 1YPZF 2FATL 3L7FB 4LLVA 4BQBA 3HS0C 2IDSA 1S7QA 1OAXL 2CD0A 1E8XA 3OXSA 2WXQA 3TNMA 5MEQA 1F8TH 4PJ7F 3KXFE 4GKZA 3UTTD 4PWKA 2DMGA 4FP8L 3H7BB 3IDNA 4UV7H 4JE4B 3P4OA 2PTUA 5HVGB 1A6PA 1KXQE 3D85A 5JMRA 3FB5A 1SN5A 3QNYB 3QEQB 4XPGL 4XCNB 3KPMB 5F7UA 2XOTA 5D7JA 2PWHA 4AYID 3NEOA 4P3WA 3OZKA 3UP6A 1JV5A 1S7SA 3C6EA 2NTSP 1ZHKA 3LKOB 3QP3A 4U1MB 5E6SB 5DMKB 1XF3B 1X9QA 3LS4H 2VE6B 5EMYA 4Y88A 4JBSA 2WUBL 2X3BA 2ICES 4WK0B 2FWOB 2X1OA 3CZSA 1I7TA 3Q8CA 3O2DA 3RDTB 1UXSA 4ZFOA 5IY5B 3LRGA 3RP1A 2XWZA 4ZFZB 5LBSL 1A1NA 5EBLB 5DJ8B 2HJKA 3PXHA 1YEKH 3T0EE 3LS5L 2C9XA 4UT9L 1D7DA 1EGJL 3DWTA 2HTLC 1CGUA 3P2BA 2G75B 4F7MB 2JVUA 5EH1A 4ELME 2J5LB 5C2UB 1JF5A 3ZL4L 1JNHB 3IMBA 4Y19D 1D5ZA 1X5KA 4EXKA 1BJ1J 1SBSL 4WO4B 2R56L 5I30L 1TDQA 3NCYS 2D0HA 2VDNL 2YRZA 4PJXE 5DEGA 3FU6A 2GIXA 4Z7NB 3RNKB 5L9DL 2JQAA 5FV1L 4D0BB 3ARDC 3B7SA 4NQVA 5EBMB 1TZHA 1SQMA 4MD4B 4YDMA 5JTWA 4PI2A 3T6ZA 3HI5L 3UGEA 2X41A 4HEME 4LB8A 4Z7VF 4Y4KC 3TN0D 3MR9A 1UOVA 2LABA 4KI1A 4FFWD 1ZLSL 3REWA 3V9EA 1LO5B 3PHQA 2VYRE 3O6FC 2YGPA 3LY6A 4GOSA 1TU2A 1A9EA 1BSIA 3ZIYA 2J43A 5K59E 4AWJC 1V3KA 4FQPA 4AE1A 2CALA 1Z9PA 3Q6FA 3ME0A 2PYFB 4H0GA 3VXTB 4BQ6A 5F3BB 4OD2B 5F6HI 2DYPD 3L4TA 2R2BA 2GSIB 3CVHL 4HOMA 5SWQB 1R3IH 5BVJB 4Z78A 4A1RA 3RJOA 3U25A 3TPKA 3FSVA 2DS4A 1IKNC 4PAZA 4IOSA 3H6JA 4IRZL 4MKTA 1NEUA 2X1PA 3HNVH 3ZK0A 3DPBB 2WBKA 5IR1A 2CJ3A 3AREA 3RPBA 3V7MA 2H8PB 2RJMA 2PUQT 5F71A 4WI9A 3VW3L 1HXMB 3DBXA 3K2UL 1P84J 2ZXQA 4JFFB 4ZMQA 1DBAH 1E5YA 4NAJA 4F93B 3ARED 3NDZE 3T2QA 4HUVA 3QUYA 3ROOA 4ZOCA 3D39B 2XKNA 4JQVC 5DR5L 3DO4A 3RX5A 1IAIL 4A37A 3ARXA 1X9UA 1KTRL 1XAKA 2WWNA 4G7VL 1TJGH 1KBWA 4FF9A 5EO1A 3QUYD 4EI6B 4XNMB 4RBPK 3NVQA 1ACYL 1RJLB 2CDFB 5EIIA 3FQTA 2YBRA 1SEBA 4LLQB 1BVLA 2P5WE 3JQOB 3DX3A 3VMNA 4P9MH 4X8JB 3RAJH 4ZXBB 5J6HB 2AK4E 4HMEA 5IBTL 2LOEA 1QI3A 3QHZL 3EG9A 4FQHB 4QJ3B 4HIPA 3DJSA 4WSKA 3V5KA 1KBGL 3TEXA 4JHWH 1KJ2B 5ALBH 1PF3A 1T22A 3EFDH 3NCMA 1GW0A 3QUMH 1RK1A 1S7UB 4G3YL 3QGVA 5C0BE 4LMQE 1HQRA 2PNDA 1YN7B 3Q2CA 1T7VA 1MFDL 1C1EH 2CHWA 3R4RA 2DQGL 4TNEA 1OAZH 2XWJB 4WZ9A 4XCFH 5ANME 1J8HB 2P44B 4K94L 2BMKB 2JFCA 4NHUB 4WWKA 4TNGA 3RVUC 5BW7A 1KDJA 2B59B 3H3KA 32C2B 2J56A 3O6ML 1OCWH 4LSTH 5D93C 4ZTOL 3ULSA 4N9GB 4WWKD 2Q7YA 1CK0L 1OAYH 1LDPH 1CDYA 2ADGB 2YAHA 4ZPVA 2DQTH 2WO2B 3B3IA 1WAAF 1CBVH 2HT4D 4OIIH 2Y5QA 3WNMA 1PLGH 5E2TL 1EERB 2DWEB 3ZGIA 1CXFA 1I7RA 1N19A 3CQFA 4W6YB 5HHVL 3TO2B 2DQ6A 5E99L 2MQ0A 4K9EL 4MYPA 1AY1H 3WLWD 4XPHH 4HYTB 5H35B 1OCRB 3SDAD 5ERWB 2XN9A 3Q5YA 1E65A 1BZ7A 1ZLWH 2X44D 4P5TC 1I8UA 4UAOC 3UADA 4BFFA 4DCQB 2D8KA 2UXGA 3EGSB 4DPBX 5KS9F 1KLUB 5E8OB 3H8NA 1LQSR 4FNPA 2XN9D 1HSAA 4HF5L 3QJHB 3QNZA 4FL4B 2K9FB 3NFPA 4JO4L 4X9YA 1UD4A 5FGCB 3DV6A 4QF1B 1LK3H 4UQ9A 4NZRL 1U8NA 4NC0B 3LQZB 1ITCA 1S9WA 4JFPB 4EIZC 1H5BA 4JFQA 2DQFB 2C5DC 2MOGA 3O3BB 2QR0B 3T4AA 3EO9H 5DWPA 3ETTA 2X6MA 2GSMB 1B0GB 3LZRA 5EO9A 1MIEL 2VC2L 3SQBA 1J1OH 1U36A 1NGWB 4JFWA 2VLME 4KPHL 3Q05A 1S78C 4Q2ZB 1U8PB 4LO9A 2QVTA 3FRPA 5F88A 1AI1H 1CIDA 2BY3A 5KG9A 1BMGA 5GZOC 2WQRA 2NOYA 1XXFC 4YHYC 1PG7H 2O72A 4A7VA 4E9QA 5BOZG 4HWBA 4P23A 4WTQA 2VAAA 4Z0BL 3P3SA 4EPSA 2FIKA 3FKUS 4PRHD 12E8H 3CBKB 4RMUA 5LXGH 1Q1JL 3S97C 4ICWA 3P54A 3IGAB 4I0PD 2EE2A 4H1LA 1ADQA 5AL0A 5IG7B 1LEGB 2FQEA 4L8SA 3DC0A 3P9LB 2DJMA 1CZ8L 1IGYA 4K3EH 4OVUA 3ALPA 2ED9A 2BXYA 1NBVH 4YX2L 1AO7B 1FSKB 1CGVA 3VAEA 3ES6A 5BVPL 3MVSA 4TYUA 4KGJA 3C6LC 5F7WC 5E9DD 1C08A 1Q72L 2PYEA 3LJ3A 4U1GC 4GRMB 1UXLA 4D94A 1G4RA 2RHEA 4X6DB 5B7MA 4ABWA 1GH7A 1HWHB 3QXDA 5C08A 3EYUL 4IDJH 3NH7H 2AXFA 1WEJH 2NNAB 4CMHB 4PIBA 1GC1L 4I13B 5C08D 1IGIL 2Y7MA 4KJWD 3MBEA 3WMQA 4M03A 4DPAX 2I24N 2V5SA 4UOQA 2L3BA 2HLEB 1KCRL 1M7UA 2B2XL 3QAQA 4ZO8A 3L4YA 5D1QD 5E03A 4WNQB 3WL9A 2EIMB 3HG1E 1P84K 3TTSA 1QRKA 4TSAH 3H2QA 4O2EB 3MBED 1RIHH 1T89C 3D51A 2BVYA 4HJGB 4K71C 4YDJA 5HDBB 1GL4B 4PJFE 2PPDA 1FO0A 4G1MA 2WWKT 4KMTL 3UG5A 3U30B 4AJYV 5KJRL 4X7DC 4TL4A 5K39B 2RTTA 2VR9A 3TVMA 2XQBL 3GJEA 1U91A 2V5YA 3D06A 4JO2L 3JVGC 1CLZH 5CIPH 3CIQA 2HVJB 5HXMA 1H6EA 4TXVB 5AOMA 1KN4L 5I1JH 3JWNH 3TVMD 4ZOEA 4MJ2A 3AWFA 5JHLH 5DRNA 1KJMA 3VFOB 3KNBA 4PV9A 5JNYA 4BIKA 1D6EA 3OM3B 3F7RA 3B1TA 1MELA 3JWNC 3M17A 2BOCA 3LEVH 1QI4A 5CSBA 3RDTC 4WI4A 3BDYL 3P11H 3ZX1A 3WKQA 1INEL 4LHQB 5E23A 4L8CA 5IHZA 1T3FA 3O11A 1SXSA 2NXZD 4JKPH 1F2QA 1X7QA 2D31A 4XP1L 5LAPA 1G7LA 1F11A 3WDIA 4KKBD 4PR5A 3IXAB 3DMMD 4K23H 1RZIB 3OAZH 2JIXD 4S10A 1HI6A 1GJUA 1PFOA 2J5LC 4JMNA 3RL2A 5DHYA 5I8OH 4XN7A 3K8LA 5D6CA 2PTTB 3CZUB 4TNWK 4JKLA 4HU8A 2NQCA 1XH3A 3GB7B 4HJ0C 3D25B 2EC8A 3KHOA 1X4XA 1FH5H 1EFXB 3SKOA 1TSRA 2VLRB 3VACA 4PJEE 4GUCA 2IV8A 3OZ9L 1M71B 1UM6H 1UEYA 4G70B 4WHTB 2VDPB 2XXFA 4IS6B 2X42A 4HHWA 2Q7NA 4IIQA 3TT1H 2JCWA 3FTZA 3VA6A 1L7TL 4OFDA 1UZ8A 1W0VA 5FFGA 2FQGA 5HY9B 2IGFH 3DGGB 1U42A 1F1DA 3SCMB 3UBXB 3V4PA 3TASA 4YHLH 3THML 2AVGA 5AUMA 5C07A 1ML0A 1T04A 3IGFA 3NBNA 1GHFH 2BDNL 1E4HA 3U2IA 2NX5B 3L3IA 5C07D 3US0A 5DC2A 5TQ0H 3HJEA 5KYUA 3V0IA 1MJJA 4U6TA 4KRLB 4AENB 3UBGA 2O6CA 5T3XD 3QEQE 2EO7A 3DIFB 1D9KA 1L0QA 2NUPA 2QTEA 4N0CD 5KVEH 1BYPA 3CSFA 3B6SB 3MLVL 3UYPB 3W56A 2YD4A 3FTSA 3WKML 1X3DA 3VVWA 4MTMA 1JF1A 1HL5A 1D9KD 3EJYD 4MLIA 3F7VB 4ZMYA 3JWNE 3MRNA 2IBBA 1RH8A 2E56A 5D72L 1KT2B 3V0VA 4DKEH 1G1KA 4H8WL 3ZSTA 3BAYA 4M6NL 5CZVH 3MLWL 3GUTB 3X3GH 4KX7A 5H2BA 1DQMH 3UAEA 4MA7H 5J8OA 1LGVA 1MHHB 3GRGA 1A64A 1MWAB 5FUZL 5FEBA 3GKWH 4UM9A 3CLEL 4FEMA 5E56A 1G9EA 1ORQB 1R47A 4CAGA 1RZ8B 5DK2B 1JXJA 3MRCB 4DVBA 1E4KA 4JZOA 4HFWA 4K3HA 4ZXBC 2OMZA 3NSXA 4MQXC 3FONA 2I9TA 4Z7NE 3QE5A 1D2PA 3NPSC 1UD2A 5EIIG 4I1PA 2FYYB 3I3BA 4EQ3A 1FL5B 3GRWL 4OLVL 1YY8A 1QLRB 5FC9A 4DTGL 1JNNH 5BUGA 4OFQA 3EBAA 1XZ0B 3IJYB 1EH9A 1G7PB 4ETYA 4HC1L 4KK8C 4F57L 1JN6A 3T0ED 4X6CB 3II3A 2W88A 2DQDH 3BMVA 2WWMC 4G5AA 1F56A 3RHWF 1JDCA 1LP9F 3RY6C 4OZIF 2YRBA 4NDMB 2VMEA 5IFAH 3PE9A 5B1CA 4KK5D 4GKNB 2OZ4L 1DVFD 3QXWA 3TOPA 3O6LH 2MNUA 2WLNA 3O2VH 3DX1A 2P46B 4ZTPH 1QHOA 1QSEE 4TVPL 1ITBB 5C09E 3JTBA 4UIKH 3ZGHA 4Y89A 2ZAGA 3VXOB 4I3RL 2P8PB 4WV1B 3AT8A 5JIHA 2GBVA 2X1XR 1UOKA 4N22A 4P48A 1BFTA 5L6YH 3KBEA 4Z3GA 5E94A 4XE0A 2C4FU 3S0PA 5DJ2A 3K6DA 1BD2E 1J1XL 4DAGH 2E6QA 1GKOA 3TEWA 5AVYB 1M6OB 2BVQA 4HIIA 2LLLA 2CPUA 2BP5M 2VQ1B 4ANXA 4NQQA 4RLDA 1PPIA 3BAKA 2OULB 4MMZB 4JFFE 3G08A 1YA5A 4IMLB 3ZTEA 2WYIA 4HETA 4PJBB 5KYXB 2Z4QB 1LNUA 2P47B 3D39E 1GZPB 2FL5B 2VZUA 1D3CA 2OS7A 1BYOA 3KLDA 4S1QL 5DS8A 1SFDA 2K4WA 3UTQB 4M8VA 1E4XI 1SFHA 1DQDL 4FL4C 4XMXA 2BSTB 1BF8A 2FH8A 2DQEH 3PV6B 4PP2A 3FT1A 4KZDH 3FU9A 3MMEA 5E9AA 1AIZA 3RA7L 3UG3A 1YUHB 3QJQB 2HLFC 4KXDA 4J28A 4WQOA 5GSRA 3SKNB 4KQ4L 3NPZB 2YEVB 1NM4A 5D7LE 4BK5A 1AZRA 5IQLA 1A8ZA 1MLBA 2XVGA 4OIAA 3ARUA 4M02A 3K8MA 5I6LA 4YE4L 3BN9C 3EDFA 2CXKA 3CSYB 5HJDA 3D0LA 2HTLD 5EUOF 5JIDA 4KI5C 4ODWA 3KBPA 3W81A 1J8HE 3IJEA 5JQ6H 4J6RL 5AW8B 2D0FA 2P5WD 1H0DA 1RD6A 1TOXA 3T65A 5L8JB 3FRPG 4XRCA 4PVBA 3I50H 3PWVB 5F7FA 8CGTA 2V17L 4IKKA 4JO1L 1BAWA 1IC4L 1ZA6A 4XR8C 4Z1PA 3CFMA 5LGJA 4JL1A 2GJ6A 1KIQA 4RGOL 3GS7A 1NANI 5GRVK 2CKNA 4BJLA 1FSKC 4YDIL 3ARDD 5GGRA 4OQTH 5D5MA 1L9TA 4H1LG 5C0BD 2GJ6D 2LVCA 3WTYA 4M29A 1U58B 1PQZB 4Y4KD 2EO9A 3BKML 3FHQA 3FU7B 1IBZA 4GSQA 2OMXA 3IDGA 5T5FA 4ABQA 2VLJA 1P6AB 3O6FD 2DQMA 4JDEA 3VFUA 1K72A 3CPLB 3EYVB 1A21A 2BP8B 4G7QB 4CMHC 3W1ZA 3BVNB 3VB9A 3ZMEA 1CR9L 2Q5BA 5KTEH 4DGUA 2VLJD 2F2HA 1VFBA 1AKJD 2O5YL 2IAAC 3DOIA 4G43B 4QKTA 4RFEA 3TBCA 4X7SH 4Y8AA 3LXAA 2XWTA 4AGLA 2AV7A 4RMBA 5BS0B 1CFBA 1P7KB 2PWGA 4L5FH 3M7FB 1Q94A 4HIXL 4A2GA 4KQ3L 5TE6H 1HQ4B 4J3OF 1JMZA 3U30C 4ABUA 4N5EC 4LLAA 4KUCF 1N3NB 5CP3A 4HGMA 4WTZA 1MDTA 1E5ZA 2P52A 2GYSA 4PGCA 4R83A 4AEIL 3D09A 3FYEB 1KJVB 3VWJA 3OX8B 5B3SB 1WTLA 2F54E 5HI4D 4JGUA 5GZNC 4G9FA 4HUUA 1LK2B 4AG4L 2J8UA 4FQQB 3G7TA 4U0QB 3VWJD 1T5WB 3JYCA 3UAJC 1FFNB 4E9LA 4HJJL 4WSGA 3BKYL 3JV6A 4ZAKA 5FOBB 3LRMA 2GCYA 4GAGH 1U8LA 1UD3A 3LEXB 3A23A 4KI5E 1EJ6A 4D7BA 3C2AL 4ZAKD 1FCCA 3MODH 4M1CC 1UCBL 4MA3A 3MRQA 8PAZA 2XXMB 3GLEA 4OCMC 1IGML 2ZP0T 4P2OB 2AEQL 3N1QC 1W9XA 3WNPA 3BYTA 1K8IB 3T04D 1A7QH 1CXIA 5JHMA 2VDPH 1SLXA 3PL6B 4YZFF 3L4ZA 4QO1B 4B9GA 1HHJA 2CLVB 4BFBD 4KTDL 4ODXA 1N6VA 3QUMA 3FFDB 4QUOA 5IB3A 4X6DE 1BIIA 2H41A 3IJ9A 5JA8B 3H55A 2EP6A 5BZWA 1OP5H 3ATBA 5J11B 3LHPL 4E5XA 4WK4B 3NABH 2XG5A 4PP1C 4DW2L 3UBHA 5KN5B 4W9LC 4RWYH 1YNKL 4M7LL 2FEDC 3SCMC 1Z9MA 3RY5A 1WBXA 3EO0A 3HEIB 3NP4A 3QIUC 3QFGA 2CHNA 1JAEA 5TTRA 3I75B 3SJVE 3P9MB 5ANHA 3FCSA 5HYIA 5ELIA 4H26B 4D8PA 5D96C 4LAJH 2A74B 4K7PH 4UYQA 2W80C 4GP8B 3GMLB 3ARTA 4AIZA 3IE4A 2VR5A 3QWOB 2WXGA 2X2JA 4K7FA 1MCPH 2QTVA 2Y7QB 3QZWG 5KVGE 1G7HA 4R3SA 2SEBA 2HKAA 5I23A 2KH2B 3O4LA 4QWWC 4EUPG 1XAUA 5KW9L 1W91A 5MENB 3HRPA 1EJ8A 3B2XA 3UG4A 3V4VL 4JY5L 1S9KC 1RZFH 1Q9OA 2PCFA 3EYFB 2GHWB 4PS4L 1MWAH 4UNTA 4A67A 4C57C 5DJ6A 3ZYJA 4HPYH 2YPLA 1I7ZA 3H2PA 2C9SA 1RUQH 4E36A 4A7UA 5JO5A 1R5VA 3VI4F 4YO0B 1DE4A 3N5AA 2W9LA 3V0AC 4NKDB 2CMRH 3VXNA 2YPLD 1UD5A 1NFDA 4MJJA 2CKBL 2IXQA 1MEXH 4IQHA 5EZOL 1AG0A 5F3FA 4LOEA 1ZCRA 3RBSA 1OTSC 1YEFL 2C8NA 3BC9A 1YMMB 4LCWA 5DTFA 1MFVA 4G80B 4DPCX 3TBYB 1S78D 4TOYH 5I74B 5CGBA 2MQGA 2ZNWA 1IJ9A 4PYHA 5GZOD 3W5MA 3OJ2C 3IBEA 3NJFA 4LCWD 1T7ZA 4BFKA 2VLRE 3DX9B 4GW1B 2NDFA 3FOLA 3FQNA 2PW1B 3DSNA 3I02A 3MNVA 5T1LB 4QTFA 3UGUA 1Z1WA 4BA0A 4ELMF 2UXTA 1U8MA 4L37A 4OLWH 4R5XA 4DGVH 3EXJA 2GTZB 3QEHB 3RUGB 2WXJA 5GISL 4ES8A 1N64H 4ICXA 3RWDA 2XZZA 5LCVH 3P73A 3AABA 5IEKA 3C6LD 2OJEB 3OR6B 5CBAA 4WV1C 2EKJA 3ZE1B 1D2OA 3A24A 5AWNH 4GAJL 2VKWA 3ATAA 4NC2B 1XGTB 2QKIB 2XC8A 4D9LH 3MA9H 3DX8B 3QQ3A 5JXAL 3C8KA 3OSVA 3CWGA 4FFZA 4GRWF 2V9RA 5K59F 1DBKL 1USQA 4Y5YB 2XQYG 3VXSB 2IPKB 4HXAH 3MLTB 3BKCH 4GBXB 3GMRB 4MMZC 2QELA 1U6AL 2X05A 4IU3A 1CLOL 3H7BA 5DU7A 2YA0A 1N70A 3MRKB 3IJSB 1DFXA 3WFBH 4AJ0A 2BY2A 4E68A 4ESKA 2YAEA 1B0IA 3QNYA 4QY8B 4HCGA 2W0FA 4RWHA 3EOTH 4XCNA 1ORSA 4UOJA 4CVXB 3TCLB 1SJHA 2Y06H 5D7HA 3S8GB 4A66A 2HB0A 1YEIH 2UZPA 2VDLB 3KYKL 4LPWA 5J0BA 5DMKA 4UT6H 5EOTA 2FWSA 1QRNB 3QEQD 1F4YH 1XF3A 2VE6A 3UACA 2FWOA 3MREB 1F3DJ 3BJ91 2OMUA 1AMXA 3AXLB 3LRHA 2D3JA 3T1FB 3B9VA 2COVD 1MHPH 3KS0J 2E8ZA 5B7FA 1IGJB 5EBLA 3S3SA 2X6UA 2ZSWA 3L13A 3WNOA 2MPAH 3RDTD 4OCXH 5C2BH 1ETJA 4TUJA 1CVSC 1OAQL 2OYKA 4YH6A 1MUJA 1LXMA 2G75A 4PTTB 4MNGA 4DH2A 4F7MA 3GM0A 4ZO9A 1QLFA 4X6CE 3HAEH 4YSCA 3WIIH 4WO4A 3DVNB 1Q4NX 4HX1B 4FNLL 5BNXD 5JA9A 3F2LA 3I9GH 3EJCA 3MHZA 5HGHB 1INDL 4NZFA 4HWEH 4MMXB 5TJWK 2P8MB 1LO3H 4MD4A 4WO4D 4ZD3L 4J6IA 3U7YH 5L8LB 1B4JL 1JXKA 1AS7A 1JHKH 4D0CB 3ZO0A 3OV6A 4HJ0D 3BUBA 3EGXA 2O6PA 1GYAA 1IKFH 5C7ZA 1H15B 2L8AA 4RFNB 1KY7A 1OCZB 2VXVH 4L3EA 1LO5A 1JZJA 2R0ZH 3HNTH 2HX8A 4CKVX 5C0GB 1SF5A 3HUJB 5DQDL 1YECL 5L88L 1PSKL 3HPJB 3QJXA 2WC7A 5CSGA 2CLZA 4OCNC 1GYWA 1SXAA 3RWFB 1UXWA 3IPFA 4U1NB 3LKPA 2W9EL 1FFRA 4YXLH 2GSIA 4PJCB 4YDZA 5DYOA 3ESPA 5F6HJ 5AVQB 3QDGB 1EBAA 4I4WB 4MKMA 1FYTE 2IALB 5DWUL 1OY3B 3TNNA 1NAML 2DJSA 1T1ZA 2JCCB 4AQ8C 4Z5RB 4BUHA 4HIJB 4X4ME 1P6WA 2R69L 4KY1H 3I3EA 5GS1B 4E9SA 1XR9B 1YEGL 2JJVA 4DKDC 1LEKA 2ZE0A 1IGFH 4LEXL 1WA0X 1A14L 1VCBC 4JFFD 1HHHB 3LTVA 4G11A 3VMOA 1AYRA 2FJFB 2YLHA 2F5AH 4P4KA 2HYMA 3V9FA 2EH8H 3D39D 4WTZG 2A9BA 4P2YA 4IBVA 3WDHA 2BP3A 3GHEH 1RJLA 2CDFA 3MPCA 4QRQB 4W9FC 1ICTA 5DZAA 4LLQA 1BZQK 3QWQB 2BOBA 2IBZY 3WFEL 1OB1B 3IRCA 1RULH 4C56A 2D03L 3ERXA 1RURH 3E6HA 4JRXB 3ZL1A 4Z7VA 3V0WL 3D08A 2E27H 4KQ0A 2NTFA 4FQHA 3UDWA 4XPAH 4UTBL 3OVUB 1KJ2A 1PG7X 2E5EA 5FUCE 1KB5B 5DVKA 3D52A 5AKSA 1GVIA 4XTRC 4ZXBD 1FG2B 2YC1A 3V0GA 4AV4A 5G4NA 4GQ9H 2BW5A 1YN7A 2WO4A 2IADA 2UYLB 4NQXB 3REVA 5CUSH 3T71A 4KZ0A 1RI8A 4HG4J 2XWJA 3PL6C 3RWGA 3RY6A 1P4LB 4YJZL 4RIRB 3Q1SL 1ZKAA 5I0YA 5E8NB 1ASQA 3ZLQC 2BMKA 4KK8D 4UILH 2ZCKH 2LU4A 1T5XB 2A7BA 2B59A 2WWMD 2DZEA 5CHNB 3S5LA 3V4UL 32C2A 1D5IL 2YPKB 3LZLA 3V5DB 3ZJAA 4AGQA 3OKOB 4XVTL 4RMTA 1NC2B 3T6VA 4N9OB 1J8HD 1D7BA 3BSZH 4NUGH 4PJGB 1UGNA 3BH9A 4BM7A 4ERSL 4G8EB 5HDOA 2O5XH 2ADGA 1D5XB 4R4BB 2G3ZA 1ZANL 4H44C 5DUBB 1A7OL 5KEZA 5K9KB 1Z7JA 1MJUH 1TJIL 4TULL 3WENA 1BDYA 5A40E 4WUKH 3GSWA 3MNMA 2DWEA 4P3DB 4NPJA 5HJBA 1OARL 4AW7A 5BS0E 1NWPA 5HHPB 1MCFA 3WD5L 4E5XG 4N8VG 1ZXQA 5H35A 1R3LB 3EJSA 4RFOL 3CVDA 1CFQB 3HZKA 1G7QA 2A74C 3OB8A 5ERWA 5CAYB 3WIHL 5DJCB 1R4XA 4HOXA 5J9PB 2DWYA 4L4JA 2R23A 3GSNB 1ZWIB 3EGSA 3U9PH 2O61B 4AEEA 3WTUA 5D1XB 4EOWH 3RTQB 3MJ9L 1QOKA 1UASA 4JY4A 3F7YB 2VXTL 4QNPE 3V6BR 5FO9B 2VDQB 3HE6B 2WP3T 5LJYH 2B0SL 1GJWA 2G4EA 2L7JA 1OT2A 1FZOA 5TD4A 4PIRF 3X14B 4F20A 4NUPA 3VX0A 2DQFA 2SODB 3GD1C 3VQMA 2XG4B 3VGAB 3US1A 4OI8A 1SY6L 4MFHA 3ZE0B 4JDTH 1CCZA 1MZYA 3G04A 1B0GA 4PRIE 1CD1B 4JX0A 3QWRA 4Y1AE 1ILUA 3TL5A 3L3GA 2OMYB 1DEEB 4CW1B 2FHBA 4TQHA 5E8PB 2CH8A 1R5IA 1GR7A 4BCYA 5DD3L 5DO8A 4JFDA 2NDGA 4Q2ZA 1JGIA 1U8PA 1ROWA 2HLFD 3DTXB 1L9OA 2NY3B 4S1RH 1F1GA 5GRJL 1ZLUK 4KX8A 5HGAA 5HI3C 4PCKA 1JHLL 3UFIA 5I74C 4RVBA 5ICYB 1BXVA 1CXKA 3CCHB 3BWSA 3A4AA 3B2VH 3FO2A 3BN9D 5IP4A 2H7WA 2CCLA 4XH2A 3STZB 5IG7A 1SEQH 2X9YA 3FCTB 4KI5D 4JFUA 2EDLA 2YAQA 3P9LA 4U6HB 3QPQC 1C5BH 4EN2A 3AG4B 2N56A 1AO7A 2JB6B 3ZQWA 1V7MH 4LAQH 1N5YH 2WAQA 2J2ZB 2TRYA 5GRYA 3SQRA 1KGYE 4JG0L 1N9PA 1I8IA 2X2UA 2J6EH 4PRPB 1YEDB 1AO7D 2WLLA 3BPCA 3I6KB 3CUPA 4OR1A 5KS9A 1R3KA 4TLKA 4OJCA 1GIGL 3ZT6A 2HAZA 4MD0A 1NOFA 3ULUL 5IJKA 4OZFA 2NNAA 5KZCB 3HZYA 2E59A 4LVEA 4Z3IA 4ISVA 4JQIH 5DVPA 3GLZA 1HEZA 4DP1X 2UY7A 2NY4B 1QWNA 3M8OH 1E5AA 4C4KT 4O2EA 4Y5YC 2KQMA 3KPLB 2Y23A 2EDJA 3WIFB 3I74A 2E7BA 3BP7B 4GBXC 4IBWA 1JUFB 2OLDA 1PIGA 3ZN6A 1NEZB 4RISH 1ZTXL 2VDLH 3KVQA 5EV7A 5K39A 1DUZB 1I7UB 4JFEE 5E8DL 1HZHH 2HVJA 3FU8A 5BMFH 1M7DA 1NMBL 2BHZA 3O0LA 2BZDA 4N5ED 4NM4H 2Q3AA 5GZNA 3WS3B 4PJHB 1RZQA 3TWCL 2BVOA 3CN3A 4OJDH 4XMLH 3ML8A 1YC8A 3VFOA 2OSXA 3KVPA 1CYXA 1JPGB 4YPGB 1RQ5A 3D3VA 1DDHB 1OQXA 2F6AA 5GZND 3WTXA 1E8YA 4CADA 3N55A 4XPFL 4PGZA 5BXFB 2FT8A 3CZLA 4OD1H 3W57A 2WUCH 1YMME 2E7LA 4YR6A 2BFVL 2G30A 2GTWB 2X7LB 1S7XA 4YK4B 1YEEL 5C9JA 3N3EA 4AJWA 3E6FA 1PJ9A 3VXRA 4FE9A 2QQKH 4Z0XB 4PJ9C 3PWNA 3JWNG 4HG4K 1BBDH 1CICA 3IXAA 1Y18B 2KBGA 3CLFH 1NCAL 4YL9A 4M1CD 3HBGA 1KOAA 3CU1A 2AJXH 2I07A 1BP3B 2MH4A 4JPVH 3SZ6A 5T1KB 2PTTA 1TZOA 4Y8DC 2AK1L 4XN1A 2E75C 5DZOA 2KLSA 4E9RA 5EUKB 4ELDA 3BEVB 3D25A 2IDTA 4MMXC 4NO2A 2WZPD 4W1TA 1MQKL 1NIAA 2APWA 1B3JA 1YEHL 2ZKXA 4RRPG 1A7RL 2JKTM 3MRGB 3RVVC 2BJMH 5A6LA 1A02N 1URZA 3V95A 1M71A 4ZUWA 2V33A 4X5PA 2AZAA 1MW1A 4LHUB 4WHTA 5ENWB 3SPGA 4IS6A 5HVWA 3ZU8A 3O3DA 5GRUH 1A7NL 1EFXD 4RFNC 4K3JH 3TF4A 2VLRD 3PWLB 3GMMB 1C7SA 1NEPA 3FH8A 5HY9A 5KWYC 2FWUA 5F97E 3OWRA 3SCMA 3UBXA 5DQ9B 1WO2A 4OCWH 5EN2A 4JPQA 3HC3H 2N0MA 3G5XA 4M7ZB 1JPST 2HX9A 4KHXH 5C0NC 4DZ8A 1E6JH 2OW6A 3QZNA 3BKJL 3PDGA 4PP1D 2ZAHA 2FEDD 3SCMD 4PREB 5BRPA 1M1SA 3L5JA 3SKJL 2NX5A 4HIEA 4WWID 1RHHA 4OBSA 1OAJA 3CC5B 5D1ZB 3IGLA 1FZJB 5KSUB 3QO1A 1E9PA 4N0UE 4S2SB 2NX5D 5JW5B 4WI5A 4GO6B 1A1OA 3BWAB 3B6SA 3UYPA 1D5RA 1XGQB 4NO0B 2I7OA 3PP4H 1R3HA 4DP7X 3UJTH 1QRNE 4UT7L 1JXDA 2YGOA 4YHNA 4P5KB 1WWWX 2YK1H 4C59B 4N4YB 5GS1C 2BX5A 4QWWD 2PN5A 1KT2A 5ABZA 5AW5B 2WQXA 3JWDH 1RUPH 2NT0A 4HJSA 3GUTA 2J8HA 3S37H 4LSPL 2MIZA 3Q2VA 2Z92A 5CMAA 2D3LA 4F7EB 1CF8H 5FCSH 4BFOA 3CQQA 3MA7B 1FHGA 1KB5H 4JS7A 2XY2A 1ORQA 2VO8A 2OL3H 1RZ8A 4M8QB 1Y6MR 4JHBA 5DK2A 4A7GF 4Y2NA 1J05B 5I0WA 1DQVA 3C9NB 1MFEH 3HS8A 2W65A 1I85A 5JHDE 5CGYC 3NRFA 3DOSB 4NQEB 4BH7B 1OTSD 2OJZL 3GPSA 2XCMC 2FYYA 2IQ9H 2ARJB 4X80L 5ECJE 2AEPL 1FL5A 2X70A 1QLRA 4XO8A 4ZMLA 2B8OT 1Y1UA 3CE1A 3IKCB 3V6ZB 3OMAB 4HUMB 1XZ0A 1A4KB 4BKLB 4DK6A 1MNUL 1GY1A 2EIDA 3QNXB 4W9KC 4Z7QB 2R7EB 1YQ2A 5E00A 3FO0H 4ATWA 4NDMA 4FQIL 5C0RH 4NWTH 3IJ7A 4OCLC 3F3HA 4GKNA 5I6XB 2KKQA 1YEJH 3VWKB 3O45A 1DO5A 2C3HA 2AJSH 3E8UL 3HLAB 3HUJE 3BH8B 3RYMA 2E9IA 4KVNH 2DLTA 4FXLA 2ZNXA 3VFSA 4YDVB 3VXOA 4K5LA 1XSKA 4PJCE 4TQIA 4XNXL 5E9NA 5T3ZD 1G1CA 1U3NA 3QDGE 4XVJH 2XRAL 4ZS7H 3S5LG 3TT3H 3F5WB 5FX3A 3FB7B 3QUXB 5EEVA 3MJGX 3GSNH 4XXCC 3CFDB 4KTEL 2XA3A 4OKVA 1IM9A 1M6OA 3A4EA 2W07A 3KLSA 1F6AB 1G7MB 4O2FB 4YHZL 2N7SA 5JLZB 1UB5B 4ODSH 1NGXB 4XPTH 2WN3A 4HPOL 4OLZL 3KJ6L 3DJZA 3P77A 2VLKA