1IM9D

Crystal structure of the human natural killer cell inhibitory receptor kir2dl1 bound to its mhc ligand hla-cw4
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
195
structure length
195
Chain Sequence
RKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human natural killer cell inhibitory receptor KIR2DL1-HLA-Cw4 complex.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, CW-4 CW*0401 ALPHA C
total genus 40
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2001-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1im9D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1im9D01
2UV3A 1QLEH 4YHZH 2UUDK 2WZPD 4BJLA 3KJ4B 3KPQB 3EO9H 3RY6A 5GGRA 2IQ9L 3MBEB 5ANME 3RX7A 3P77A 1QRKA 4TUKL 2J8OA 3REVB 3RFZC 3LEVH 3TBVA 3GJFA 1PG7H 5MEOA 1U3ZA 1RZIA 2YUVA 3LN4B 2P48B 3NTCH 3JTSB 5JHLL 3S37X 4H0GA 2WBJD 5HI5C 3EW3B 1AD0A 1T89C 5CBAA 4KUZL 2OJZL 1RFDH 4ISVA 1MCOL 5DK2A 2R23B 4NZUH 1U8LA 3VXUD 1HZHH 4XNUL 4Z8FL 1NSNL 4LEXL 1Q94B 4V1DB 1HN1A 1XGRA 2ICCA 1JWUA 1Q9OB 5D2LB 2H2PC 1OP5K 4IMLA 1BD2A 1NJ9A 4YAQB 1S9YA 2XN9B 2NW2A 3EBAA 4EVNB 1OAUH 2XQYK 5FYKU 2RGSA 4K3JH 4WFHD 3BYTA 2AXGA 5L8JB 2IANE 4UIKH 2VC2L 3BUYA 3QDMB 1RZFL 3ZKNC 3C2SA 3BAEH 4NHCL 5E00B 3RVXC 3GJFH 3EYSL 4ZS7L 2BXZA 4EI5B 5M95B 5FGBA 3ARGC 4OFVA 5I17A 1M7IB 3RQ3A 4DFHA 4EIZC 5CGTA 2NY7L 1O7VA 4G8IB 3FQUB 1ONQA 2H3NA 5CEYB 1UWGL 4TTDC 1NUGA 4UB0L 1CD1B 4R4ND 2P8LA 1KN2H 4R8WH 1QLRA 4YHIB 4KTEH 4MJ6A 2Q7YA 4OZFA 1M7DA 4X6BA 1HXMA 2OX5A 1DFBL 1G7QA 4JHZA 1C12A 2DYPB 4PR5A 1S7RB 3GSQB 4NQEB 4M7KH 5SWZA 4DZBA 1IKFH 1LMKA 4G3YH 4MNGE 4QOKE 4DVBA 2FL5A 4OD1L 3B2VH 4OD1H 5FKAA 3L3JB 1MFDH 1UWEL 1YYLH 5HHPB 3RWEA 1UZ8B 1QR4A 1DBJH 2RQ8A 2VWEE 3NGBC 5E2UL 1IAOB 4QEGA 5SWSA 5FYKH 1AI1L 1B6DA 1UVQA 3JSSA 5FGSA 3MNZB 3HA0A 4PJCE 4PJCF 2AJZA 4WI7A 4F7CB 4Y1AE 1E4KC 3UAJC 3UCRA 4A6YL 4Q2ZA 3P3YA 4KDVA 3GMLB 4MD5B 4U6XA 3WUWA 1LE9A 3WN5B 1F4HA 3VXMB 1BZ7B 3BKJH 2CIIA 5I8OL 2F8VA 3I3BA 1QYGH 1R6VA 1Q94A 5I18L 4HLZG 1V5JA 4CDHA 2IFGA 5I6XB 3LKRB 5CD5D 1DQTA 4M4RA 5SWSD 4YFLF 2RR3A 3KPOA 4QHUA 4LRIA 4Y4KC 3LV3B 3FQWB 1ACYH 1P7QB 4JQXC 5HHNA 1JHKL 1OGAE 2NW3B 15C8L 4LVHC 3QIBB 3KXFA 1IQWH 3HE7A 2APXA 4N8CH 5E9DD 4WEBH 1RULH 4W6WB 3CLFL 5DFVD 1H15A 4YIQB 2F8XC 2A6KB 2GFBA 3CXHJ 5GRJL 1KCRH 1JI1A 4Q9RH 3WFDL 1J8HE 4G8EB 4EQ2A 2I9TA 1R5VA 3PHSA 4ERSL 2P7TB 4OKVB 4OTXH 3KPSB 1TPXC 1HHJA 5H94B 3UZEA 5B3JE 2NY5C 3FHAA 1BVKB 2F54A 2ID5A 4JFZH 4AEFA 5EBMA 1MVFA 3DRQA 32C2A 1NKOA 3UPAA 4X5LA 3RGVD 1OSPH 3O2VL 4ZFZB 4P23A 1T22A 3PWNB 5AWNH 5KVEL 4ODTL 5FUZH 3SGJA 5BOPA 2FO4B 4KHTL 4U1LB 5J9PB 1H3WM 1S78D 3VE0A 3C5ZC 4LKXB 4ELKB 3PDOA 1A9BA 5TE7L 1GC1C 2AEPL 2AQ1A 1E6JH 3BGMB 4YE4L 1WZKA 4X9GA 5BOZG 2VITA 2CUHA 3QSKB 3HI5H 5SX4I 3TM6A 4X7SL 2A6KA 1P9MC 2DLHA 3MFFB 1HKLH 4YHKH 4YHKL 4Z77B 1JJUA 2X05A 1JPGA 2DQEH 4NO5A 3N9GL 5E9DA 4EN3D 1YNTB 4EI6A 1C08A 1N59A 2YN3A 3H0TB 3OJVC 1HHIB 3MCLH 5GJTL 4JR9L 4MB4A 1BGXH 4BQBA 2WBKA 5F3HA 1V3MA 1WZ1H 1EAJA 2DLTA 5JXAH 1Q1JH 4GKNA 3BQUB 4FFZH 4Z7UB 3HRPA 3H9SD 2YD2A 3HFMH 3QZWG 1I85C 3IKCA 4LPXA 4M6AA 3PWNA 3QNZA 3F7YB 5I66A 1FJ1B 5L2KD 4X8JA 4X6CA 3QFDA 4NKDA 1GXEA 1ZLWK 4PB0H 1EXUA 5IB5B 4LCWB 4U1JB 1L0QA 2R1WB 3WKML 5JR1L 5EO0A 2B0SL 1MHCA 2GYSA 2JELL 1S9KC 5CSZB 5C0CE 2Q6WB 2E5EA 3S88H 2BNRB 2QHLA 2P7TA 2PW2B 1I8IA 1FN4B 1QR1A 4XBEL 4ZFOB 1FFPB 5D9SB 2D9QB 4F37F 1QBLH 5C07E 3MV9E 5GJSH 4X80H 3VXNA 3PWPB 1JVKA 5IB1B 3GSQA 4Y2DB 4N0FA 4FG6D 1R3KA 1ZE3C 1VACB 3CFKB 2AJVL 2OR7A 1XZ0B 1S9VB 1EO8L 3L5WA 3V5KB 4TQEH 3MZTA 2YS4A 4P3CH 4I3GA 2YR3A 4F3FB 2PO6B 4IS6B 3O11A 1I7TA 3RZCB 5A16B 3Q6GH 4NM8H 2IWGA 2D03H 4FQ1H 4NQCB 4RGNE 1CE6B 3LN5B 4GRMA 5SWQA 1DLFH 3BKYL 1RD6A 3KPNA 3IGAB 2QV2A 1EHNA 2JB6B 4D9RE 1S7VB 4OLYL 3VG0L 2XWTA 1CN4A 5K9JH 3AVEA 1RJYA 3DARA 3HI1B 4LP5A 4JLRB 1MF2H 2XFXB 3OR6B 1CICB 5GRZA 3V95A 3DO7B 4YDKL 4NZUL 1YNKL 4HKXB 3TIDA 2ZKHH 3BVNB 3MYJA 5DJZB 3TCLB 2E8YA 3GK8L 4LF3B 3WKNA 1CTNA 1ZVSB 4OIAA 2R15A 1VEPA 3SBWA 1ZTXL 1JV5B 2NQCA 4NYLB 2YEZA 1X7QA 1TZHB 4DW2H 3QEGH 1U8LB 4JR9H 5D93C 4DK6A 5DJCB 1NFKA 3MRKB 1WGOA 3H7BB 1XCQB 3VFNB 3DMMD 4ZUUB 5I1DB 4JFXA 5F6HI 1IBGL 3BZ4A 4OQ1A 4KJWD 2CKBA 4JY4B 4H20H 2UY6A 4QY8A 5I8EA 5DD5H 3TPUB 1J5OL 3UTQA 1CGXA 1P5UA 5DJYA 2X6MA 1C1EL 2YZ1A 1RK1A 5BS0E 3HZYA 4QXGL 4P2OB 4WU5B 4YLQT 4IRZH 1F97A 4OF5A 3UAJD 3IGAA 3VA6A 1NMBH 1OAZL 4U3XA 5FOJA 5ABDE 4MAUH 2VNCA 3O9WD 3C87A 4NN6B 1KN2L 4HK3J 4NFCA 4W68A 1T5XB 3Q6FB 3PP4L 4JN1L 4PTTB 1M7IA 1A7RH 3FO0L 2J8UA 1N8ZA 3T4AA 4N68A 3F8UB 1AGBA 4UV7H 4QRPE 4Y2DA 1RUPH 2GSIB 3HNVH 1WT5C 1MCCA 1FZOB 1CDJA 2QJDA 1RZFH 1UKQA 1NGWB 5ISZE 4U1NB 4JPKH 4OD2B 5FF6A 2IEPA 3BZFB 1JF1A 1G7LB 1H0DA 1P53A 3MRBB 1Y6MR 5L0QC 5GZNC 1NEUA 3QA3B 2V9QA 4CVWA 4NOBA 2A9MH 3W0WD 2NX5B 3LZFL 5GS0D 2ARJQ 2IC2A 4JN2B 2R23A 3ZLQC 2DDQL 5E8NA 1MSPA 5FGCE 1YPZB 4I77H 3RTQC 1JF1B 3UTOA 2X41A 3CVHL 1K4DB 1N0XL 2R39A 3IJYA 1QFUH 5BMFL 3RZCC 2EYTA 2NNAA 5D70H 5I18H 3O3EB 4ZFOL 4O4YL 3ZHKA 1YEFH 4PG2C 4OQTH 5JHDB 3ZKSD 2MJWA 3E8UH 3MRNB 3QIUB 4FQJH 2NY5L 1G7JA 1MCIA 5E03A 3QO1A 4JFXB 3BT2H 2JELH 4NO5B 5E9DB 5C09A 3JTSA 4UQ3B 2A38A 2FZ3B 4Y4FC 4CNIA 1J18A 5ICXB 1MHPL 4Z7OE 4F58H 3BRGC 4PJHA 1U8HB 5DK3A 5BXFB 2MPAL 5T1MA 4LLDA 2IMNA 1TNNA 4M61B 5DI8A 4KI1A 1W72L 4EUPH 3KLHD 3MLVH 1LO0L 3MLVL 4BFIA 1NGQH 4OLXL 3OR6A 1U58A 3ZYOA 4GT7A 3SGKC 3VI4E 4X6CF 4NKIL 5DMIL 3UBXG 1YEDB 5EZJA 1FL6A 4HIXH 3BP5A 4BSVA 3VW3H 2XWBA 1EVUA 4UILL 3ILPA 1T0MB 4JQIH 4J3TA 3RHWF 1UH3A 1U91A 1VGKB 1C5CL 1VA9A 1L4IA 3C2AL 4HH8A 1XGYL 4RZCB 3WUZA 5K9KB 1JF6A 1RJCA 3U46B 2A6JA 3T08A 5DMKB 4UV7L 1S9XB 3D25A 3IETB 4MAYB 4GSDL 1KT2B 3KYMB 4OT1L 1FQ9C 1H3PH 3C08L 5IEHA 4JJ5A 1T66C 3GMRB 5IQ7L 3LDBB 5GS0C 1R5IA 4XNQA 4PJEE 3KG5A 4FOMA 3EJYC 1X5YA 2L7UA 3VXNB 5LXGL 1S7UA 1Q38A 5D1QB 4X6FA 5A16A 2GITA 1I7TB 4X4XA 2XZCL 5DJ6B 4IHOA 2PYEB 2SEBA 4JG1H 3PWLA 3BRDA 3QI9D 5FYKL 2MKWA 2Q6WA 1A1OB 1MFBL 4I77L 5HVWA 4KGLA 3BEWA 4IDJL 1BM3H 1DQDL 2IPKB 3X12B 2APBA 1GH7A 3LDBC 5DHYB 2CO6B 3L3DB 3V7MA 5IR1B 4OF7A 1MLCB 4XH2B 1MF2L 4QTHB 3SCMB 5TF0A 4KK6C 4RRPG 3VFUB 3CVIH 2EE9A 1K5NB 4KUZH 5ID1B 1IAKB 1G9NL 4HMDA 4HJ0C 1DBKH 3C6SA 1N26A 2I5YL 3VD9A 2XFXA 4M43L 1AJ7L 4FQXD 4KK8C 5DRNA 4LBEA 4D9LH 2IBZX 3D39E 5DUML 1GGBL 1DVFC 3SN6N 3H42L 2AJYL 4HS8L 4TSAL 1VPOL 5FYLL 3SE8L 5H37G 1BJ8A 4GKZB 4UAOC 5HHVL 1HOCB 1RSFA 2EDEA 4G8GD 5EOCJ 2C1OB 1HCFX 4OZHF 3RVXD 5JPMB 2AK4D 4ZQKA 4W6XB 1EK3A 2V7NB 3AS1A 1R3LB 5GGSY 1URLA 1GAFL 5T33H 1MFNA 4LCWE 4IRZL 3UTTD 4QXUH 4A6YB 1QKZH 3V5DB 4DCQA 3TBTA 1VEMA 3L95A 2WM0A 2YC1B 3T8XA 4WO4D 2GK0B 4UOW0 3G6DL 4N0FB 1I8LC 1U0QA 3SDXA 2CUMA 1NFDB 5C71A 4JFDE 3AS3A 2NCMA 2OL3L 4R0LC 1WEJL 4HUXA 2N7BA 1SY6L 3M1BA 5AZ2H 2MFNA 3SKUD 4F8QA 4JPWH 3S35X 1AGEB 1A6ZA 5JQ6H 3O3BB 1CFQB 2V9TA 3PP3H 2DQCL 3T0EC 2C7UA 3NCFB 3FB8B 4JG0L 2YMXL 4ZFZA 5CD3A 3WCYA 3U1SL 3CH1B 3WDIA 3HNTL 4Y7MA 3B5TA 5IW3A 3CSYA 3BHBB 5E2VH 4MDJB 1MREH 1OAQL 3I6KA 4XXDA 3QWRA 1OB1B 2ZPKL 5EOQL 5GS2H 5I66B 4HIHA 4XPGH 1H15B 4KMTL 2X1XR 4F9PA 2BFVL 1NCUA 4C58B 2VZ3A 1MWAH 3MMEA 1WCQA 2R56L 3EO0A 4CNIB 4XC3L 3FN3A 3KWWA 2CKBH 4YQXL 1A1MB 1SBSL 3ZDXE 4I18B 4JO2L 2F5AH 3TBTB 3TEUA 1JBJA 3V6BR 4RBPK 3GSRB 3LSOB 4G8EA 4PJGE 1DL7H 2P4AB 5HGAA 4PP1C 1KPRB 3G5ZA 4Q58C 4R7DB 2FATL 1AIFB 5K59F 4G7VL 1KTDB 1T4KA 4FXKA 3R0NA 3O6FB 3KYOB 4WU7B 5DK0B 4NRZA 3CFEA 4HIJA 2VKXA 2GK0A 5ICZA 5SWSE 3RBGA 4Q6IA 4BH8B 4HHAA 4K55A 2NYYD 5ESVB 2G5BA 4QRQA 1ZLSL 3VDCA 4U1HB 3LKQA 2HVKB 1KLFA 4YHNB 3D39B 4FXGA 3IXAB 5GSRB 4ELMB 1E4XL 4M5ZH 3RUGA 5JIIA 4JRWA 3HMXH 1C7SA 3QXDA 2H32H 1A6AB 2W9EL 2XG4A 5DO2D 2AP2A 2N4IA 1I1YB 2AJ3B 2Q1EA 3K81A 1PFCA 1JTTA 4OJFL 2OTWB 4HZLB 4XPBH 3DROA 3L3JA 3V4VL 5DA0B 1V7ML 2NZIA 3QQ4B 4JO4H 5EC1A 1WWWX 4Y5VC 4OF8A 2DAVA 4D9QD 2FR4A 5L2KA 3V9FA 4Z0XA 1UQSA 1MHEA 1OOAA 1G7HB 3LQAH 3QZWB 1A22B 1P2CB 3S37L 1FZMB 4QRUA 5GGVL 2R4RH 3PWLB 4KRPB 5F3BB 1QLEL 2X89D 3EGSA 4CVUA 5J8OA 4R4BB 1T7XA 5F9JA 5MENA 1AGFA 3OKMB 3CDYA 1DBBL 1EJ6A 4DVBB 4L9LB 1QFUL 3HAEG 4NJAL 1JZ7A 3O45B 2Z8RA 3SJVE 3QPXH 4KY1H 5CZXC 3SQOH 3TNNA 4F7EA 5CCKH 3O2DA 1B0GA 2E8ZA 1C5BL 1UZ6E 3D25B 1BIHA 5DD6A 2VXTL 3QEUA 2NY2B 5J13C 5DS8A 4YGAB 4YE4H 2QEJA 4KH2A 1TTUA 5IEKA 3FB7A 3WO3B 1MEXL 1MCWM 1P5VA 2LAGB 2FLBT 4PD4J 5EUOF 5F7DB 4QYOA 4G6FD 3S98A 4MB5A 4PJ7F 3MJ8A 2FEDC 3SDYH 4XWOD 4UDUB 5I74B 4NJ9L 2HT3D 2W9EH 4GW4A 4KKAD 2NY4D 3O6ML 1NL0L 3P9WB 3WFDH 4UT6L 3UTSD 3QIWC 3J8F7 3SDDB 3T2NL 4ERSH 4ZUVB 4O51A 1S5HA 4XCFH 1A1NA 3DGGA 5FYJU 4DGIL 3U0PA 1F4WL 4FTVB 4G7YL 3VGDA 3KPRB 3BDYL 3VH8B 5D1ZA 1G1YA 2ZCLL 4RMSA 4GRWE 3ZTJG 3MRDB 2JCCF 4L4TE 3GSRA 3LSOA 3SDDC 4YWGL 5JNYB 3M17B 3T0BA 3L9RB 4NQED 1NCNA 3OKLA 1OTSC 5L2JA 1W2KT 5MI0C 1J1OL 2V7HB 3QG7H 5LCVL 3GSVA 4R2GC 1A02N 2G60H 5HTSA 1F2QA 2OJEB 1XF2A 5DD1L 2ZPKH 2HJKA 1LP9F 1OSZB 1R0AH 3OKOB 5MERB 1PJ9A 3GMOB 4OCRH 5GGVH 2BC4A 2CMRH 5CKAA 5L88H 5C0ND 1A5FL 1C5CH 3NIGE 4WO4B 3MBXH 4EBQL 2YRPA 4LVOC 1RURL 4P99A 1A3LH 1Y0LA 3QNXA 4JM2C 3UBXA 3MV9A 2BVQA 4NQXA 4WUKH 3UTTB 4K7PL 3SDCD 2NW2B 3BP7A 3QNZB 1FL5A 3NOIA 3WDHA 2OK0H 3WFEL 1C5BH 1HDMB 2NTFB 3BJ91 3BPCB 1ADQL 1WWBX 1UQSB 3S36L 3K0WA 2VXVL 2EH7H 1LO5A 3IU4L 2K7QA 5A3IC 5TGBB 1PGRB 3VXQA 1WBYB 4S1SH 1MJ7H 4WCYL 2A0LD 3ZYIA 2APTA 3E6FA 1V3LA 4HS3A 4LLQB 4LRNL 4MQ7B 3NN8A 2HN7B 1CXKA 4LSTH 2DMKA 3MV8A 1VKXA 3UJJH 4U1NA 2GAZA 3VWKB 1N0LA 5J89A 1QA9B 2XIDA 5CEZL 3O6FA 4IOSD 4J6RH 3WD5L 1XR8A 1PVHA 4OLVL 4FMFA 4BUHA 3IDMA 3GSNB 2ATPA 4M6NL 1F58L 5CJXC 5KANG 5D93B 2IPUK 2CR3A 1ULVA 4L8CA 3H8NA 3IDGB 4N9GB 1O7SA 4HHAB 1KLUB 3MRDA 2D31B 3PUCA 3H9SB 1RUAH 4R90L 2AI0H 3IVKB 1OW0A 1CFSA 1RU9H 3HS0B 3MLXH 3QIWB 2PF6A 3ARTA 3C2AH 4NUGL 4D9LL 3GIVA 2G75A 5GRUH 3BP6A 4F7MA 3SO5A 4DKEL 2QR0A 2CUIA 3U48A 1PX4A 3VGFA 3FB5B 1FVDB 4CVZA 3FFCB 4ZAKB 1WC7B 5J3HC 3VFSB 3L5XH 1L7IH 5DVOA 4YXHL 4M9PA 4P2QA 3V0VB 3WNLA 3U4BL 3P11L 3WO4B 1Q9LB 2FSEB 3QPQC 5JHLH 1PKQE 2YXMA 3QJHB 3PL6C 5DEZA 2OBGA 5C70A 1UYWL 3ME0A 4LF3A 3GMMA 1F6LL 3VRLE 3OPZL 2A74A 2PO6C 4LASL 2YD9A 3FB8A 4NNXB 1UM4H 3RVWC 3ZKQD 4O5LH 4MSWB 1HXYA 1AQKH 5CJQL 3DV4B 4UI2A 4KZDL 3BH8B 3HR5B 3KPMA 4UDTB 4JKWA 4BQ6A 3MRIA 3WS3A 2FX7L 3GM8A 3TYFB 3TBSB 3RRQA 1J9CT 3F5WB 4PG9B 5BO1L 3H9HB 5IMOB 4WFFE 5FCUL 4HJ0D 2EIZB 1CD9B 1BZ7A 1KEGL 3AB0C 3QR2A 1H3VA 5C86A 4IIQB 5CJOL 5EZOH 4D3CH 5E8DL 4KROD 3TWCL 3EKCA 4R4FL 1K8DB 3FB5A 4ONGH 4I4WB 2X1PA 3VXRE 1CDGA 2I5YH 3N85L 4L3EE 5C0DA 3PG2A 1MHHA 2P1YA 1FG2B 1DP0A 1NAMH 2JB5H 2ZNWA 2VDLH 1MRFH 3ZHLA 1UZ8A 1CVRA 1JIBA 1T5WA 43CAA 5KS9B 4PG2A 1KFAL 1LVEA 2NZ9D 3VFWA 4HV8A 3G6JA 3RIFF 2VXQH 4Y19E 4LEOA 4LCUA 2J88H 5D72L 3V5HB 2RFXB 3AAZA 2GIYA 3DETD 4PJ7A 3GMPB 2CMRL 3U2SB 1K4CB 2NY6B 3DLQR 4PJXE 4WFGE 3TH2T 4PRIB 4GAGH 4WUUD 4PG9A 3WBDA 4HIJB 1YN7B 5D1QA 3WEXB 3TF7C 1FHGA 5FM4A 3QRGL 3EDFA 4XNQB 5SWZB 4DZBB 4JKLA 5JW3H 2P5ED 4U1GB 1CT8B 2D7MA 3AB0B 3CFDA 4RBPH 4NQCD 3RA7H 3KYNA 5ACZA 5F7MC 3MUGB 4ZD3L 2SEBB 1FL3B 3QUZB 2HWZL 1BQSA 4U3HA 2OP4H 4X5WB 2Q76A 4MNHA 2HT2D 3KR3L 4YDIH 3SE4C 2O93L 2JCCB 5CUSH 4ZS6C 1SJHB 2XA8H 4JZJC 3MV7B 3BXNA 3GKWL 4J3VA 4S1DC 4WRLA 1NDMA 1OGAA 1KT2A 3KYMA 5IEHB 5CLWA 3QIUC 4H5SB 3TH3T 4ZXBC 4EDWL 3P9LB 5KZCB 3EOBA 1WAAE 6FABL 2FJFB 5B4MD 1MAMH 5ELIA 4G6AD 4WNQB 3KJ6H 1C8PA 1I3UA 5F88A 3QHTC 2O5XH 2AV1B 2VMFA 1F90H 3HFML 4LGRB 2PNDA 1GGYA 3LKNB 5BO1H 3MGAA 4LVHB 3O41A 4HX1A 5KVFL 2JF1A 2DQFB 2RB8A 4P5MA 4NWUH 5K33A 3IVKA 2C7UB 1LEKA 4N5ED 2X9WA 4POYA 1MCSA 1WIOA 4GAGL 1OLLA 3B83A 5TE4H 4Y89A 4U7SA 3VXRB 5C6TH 4PUBL 1OSPL 3EO1A 3O2VH 3P0YH 5HDQL 2J6EL 3K74B 3WNMA 1FFOA 2AXFA 3ARPA 1GGUA 3RDTA 4CGTA 4HS8H 1EEYB 2F53E 3SDXB 1AO7D 1FO0B 2XN9E 4ODUA 3IDJA 2DI8A 2FD6H 2D31A 3D3VD 4PRIA 4J1UA 3MRMA 4OZHB 5DWUL 3QDME 4M9OA 3STZB 4ODWA 1JZ6A 3BOVA 5L6YL 4I0PB 4M6OL 4KJPD 3WSQH 4OCXH 5E1HB 4IRSB 3NCMA 2QKIA 4QT5A 3CSBA 2GUOA 2VOTA 4NUGH 4L29B 8FABA 3L7EB 5HYFA 1WFTA 4PJEB 4JDTL 5T3ZD 5C3LD 2XRAL 3ULVF 1U6AH 1PG7L 3EJYD 3EYFB 4XVSL 1MJJA 4D0BB 4IDLA 4YC2C 1X4ZA 1CBVH 3O6KH 2Z35A 4AH2A 4GBXD 3MNZA 2YD4A 5E95B 3WIIL 2P5WD 1D5IH 4QTHA 3SCMA 2CGRL 2NY4C 4IIQA 5FUCC 1T1ZB 1FL5B 3V6OA 3L3GA 4LIQE 1M7DB 3C5SB 1N6QH 3OJDB 1W0VB 1QLRB 2R0LH 1YY9C 3LEYL 4GKSB 1G9EA 1F2XK 4AL8H 3CK0H 4W70A 5ISZB 3S4SA 3N9GH 1P4IH 4JFEB 4YPJA 3P0VL 1XF4A 2HFFA 4K07A 2R4SL 2ZCHH 2Y07H 3RGVC 3PGFL 1QSEA 3C8DA 1QTYT 3PABB 4PGJA 2ZNXA 3GJFK 2NX5E 4PRBB 3M17A 5FV2A 4H20L 3GHBL 3BISA 2EC8A 1A7NH 1AFVH 5CGYD 1UKTA 5HVHC 3MRKA 4X6FB 3V52L 4XCFL 1FYTD 3NA4A 1T83C 4RIRB 4JGJA 1XGUA 3FQUA 2C1PA 1J7VR 1NCWH 1FORL 5DJYB 3BQUA 3LKSB 3PWJB 2FNBA 4XBGA 5E4EC 5DMYA 1EUUA 1S3KH 4H88L 4MQSB 4PJBE 2HFGH 2EZ0C 1NMAL 4G43B 1MCRA 1TCRA 4YPGA 4KQ4L 2NXYB 3TESA 2R2HB 4WI8A 4FTVD 3W9EA 5CWSB 4PRNB 4TUJB 3WIHL 2F53B 4DTGH 1CI5A 4GFTB 3UYRL 5F6IC 4DFIA 3GMNB 5LCVH 1MRDH 2X4PA 3QXTA 4ACPA 4YXKL 2AEQL 1G0YR 5IJKC 1I8KB 2P45B 2R2CA 3W11C 5ESAA 1GGIL 3DYPA 3PWUB 3OKDA 2HKFH 4PJFE 3HAEH 3WLWD 3EO1B 1A1MA 4UINH 1I1FB 3P0VH 2ESVD 3C6LB 3PWVB 4R3SB 1LDPL 3KYKL 1JMZA 3DRTA 5DMGD 5BXFA 3QNYB 2Z8WC 4JO2H 4KK5D 5TPWL 5BZWA 1WBZA 3ULVC 1F5WA 1QFOA 2JIXB 3SOBH 4M8QA 5IEKB 2NY2D 2PTTB 1K8IB 3ALPA 3ROOA 4AIXA 1ZHLA 5EOCH 3GUTA 4KKNA 4LNRB 1PYWA 2EDQA 4BFGA 4IRJA 5D5MA 5CSGA 2AJXL 5EFIA 1CL7H 1YY9D 1S9WA 3T77A 1A64A 4Y5XB 5IB4A 5B8CB 3CDGA 1QSFE 5GSVB 5KSBA 3MSPA 5DEFA 2I24N 3F58L 3P9LA 3DYMA 4PBWD 3HI6H 3OZ9H 2B0SH 4V2BA 4JDVB 2V5RA 4LAQL 5EU6E 4QXTA 4XC1L 2BVUA 4KRPD 1N7MH 2DQJH 4KK9D 4KDTA 3R4DA 1KCRL 3VXUA 5L8KB 2W60B 1KBGL 4P4KD 4CU7A 1KCUH 3MUGA 4PY7A 4UT9H 1SY6A 3T3PE 1TVBA 5FHAH 3TIEB 4XVJH 1C5DB 5BMFH 5JW4M 1PSKL 4KI5F 4NGHH 3LQZB 3WSQL 3JV4B 1EO8H 4X6CB 4QXUL 2BOBA 5D2NC 1T1YA 4XNXL 4MNGB 4JFFB 3X11A 1D5XB 1B4JH 2NTSP 3O4LD 5JW5B 1UZ6F 1JRHH 3FONB 4OZ4A 3WNKA 5FUCE 2DDQH 1MCJA 2PXYA 4WWID 4OCYL 1DUYA 2LVCA 3MJ9A 4P2OA 4GRWF 3RUGB 3TH4T 4X6DF 1I1AC 4BQ9A 5LBSH 5IW6A 2FO1A 3S4SG 3SDAD 2BNQE 1U8KA 5BW7C 2DI9A 4XGZA 4Y1AB 5CP7B 3Q6FA 4P4RA 2EDXA 4GO6B 4YXKH 2E9BA 4M62H 1SEQH 1LP9A 2R0KH 4M3KB 3FO2B 3QUZD 2DLFL 1F4AA 3DX6A 1QFHA 4OJFH 4U6YA 4CDGC 5IWLA 4L8BA 5JIHA 1QFWM 5H35B 4CL7A 1MREL 3G5YB 4QTIH 1DSFL 5C2BL 4KJYA 3VFOA 1AHWC 1GC1H 4MMZC 3MLTB 1LILA 2XTJC 3MLUH 3QUML 3UP1A 5JIPA 4DZ8A 5DJ6A 1DN0A 1GPOH 3MROB 5TPWH 5CAYB 5IB2B 3SY0B 3BGFC 5CKGA 5DR5H 3KPPB 1OGAB 5DVMA 1LO0H 3IDUA 4PGDA 2Y25A 5TFSH 1KXTB 4PV9A 4D8PB 5IG7A 3GJEA 1W8NA 4W6YB 5F8RC 1MFAL 3O81A 2IAMD 1WUNT 3HG1A 4PV8B 2GQHA 3UJIL 5T1DH 3FMGH 4XNXH 2GI7A 4X7SH 1UEYA 3O11B 4K8RD 1N6QL 2LTQC 3HCVB 2AEIT 5E4EB 3HMWH 4AL8L 2J6EH 5CMAA 1U92A 4XPGL 5DC0A 4DKDC 2FBOJ 5K59E 3KPNB 1FV1B 3BPOB 1NC2B 2BMKA 4EQ3A 4XBEH 5JLZB 1A4KA 4BQ8A 1CXFA 1A7OH 3OB8A 3TN0B 4HF5H 2B1AH 2X2YA 2GHWB 4HJGA 3U36B 1LO3H 3QCUH 2WQRA 5KVMC 4PJFB 3MR9B 1W72A 5JOPE 2X7LA 5ITBL 1KFAH 1R3KB 1FVDA 4CVZB 3O2DL 1E27A 5IK3A 2V7NA 1IC1A 1XH3B 1D5ZA 1FIEA 1R0AL 3WUWG 1T2QH 1U3HA 4Y0GA 3AREC 5D9SA 4G6KH 2DF3A 5E6IC 2FHCA 4GAJL 4HC1A 4M7JH 1QRNE 3VFPA 5T1LD 2GJ6D 1E4XH 4NC0B 2E9WA 1KIPA 4QCIA 5BJTA 4O2CB 2H8PA 1T6WA 2X4QB 2YUWA 2PYFB 4HT1H 4D94A 1QSFB 4HXAH 5E5UB 1YEIL 3BEVA 5JW3L 1RZJL 2OP4L 3PWUA 1E28A 1MNUL 5CEXA 3IS0X 4ZXBB 3E8UL 2Z8SA 2WIIB 3WL9A 1BREA 1GGIH 1LGVA 4Q6IB 2VZOA 2PXYB 4WEMB 4QRRE 3RWFA 5FK9B 2ATKA 1JHLH 3VWKA 1YEJL 3NN8B 4JZJB 2VLLA 4IRSC 1NDGB 3QQNA 4A6YH 4NQDD 5T3ZL 2AERT 3TPKA 1FIGL 4DN3H 2OZ4H 4YPGB 1KNOB 4LRIC 4Y4KA 4X4ZA 4YDLC 4YZFF 5CJQH 3MRGB 3LQAC 4U2ZA 3B5GA 4OAWB 3QCVL 2BVPA 2OTPA 3BP7B 5BV7H 1NUFA 2J3SA 5JQ6L 4JHBA 1P9MA 1GGCH 4KKCD 1QNZH 3KLAA 5I76B 4P9HH 1S7SB 1QRNA 1T7VA 4JDVA 4MAYD 2D7TH 3RWJB 1BD2D 3ARVA 4HK0A 4FZ8L 3RAJL 1L9MA 2NY6C 2VLRD 4CU8A 1MH5A 3CDGB 4LSRL 4O2FA 4DJMA 4PJ5D 4P2QB 2AXGB 4R8WL 4Q0XH 5ANMB 3HZVA 3CLFH 3MOQA 2P5WB 1BEYL 4AEIL 1WIPA 4EEEA 3UYPA 4L5FL 4YHYC 2ZG2A 3SDYL 5DJ2A 2PTTA 2W9DL 1OARH 3R1GL 1J10A 4K71C 3RTQA 5L2JB 5GXBB 3WJJC 2FX9H 2X09A 3EJJX 2BJMH 3UTQB 5T33L 3GMQA 4P59H 4DUWA 2ADFH 2FZ3A 2ZSVA 4RMRA 1L9NA 1A0QL 1WITA 1RK0A 2ICWB 2WK2A 4O2CA 1B2WL 3LQAL 2V5YA 4IRSD 5D72H 5E2TL 4LARH 4D0DB 3U6RB 3RL2B 1AXSA 4QF1A 5AG8A 5IF0B 1U36A 2UVEA 1FBIH 3Q3GA 4JGUA 5M7QA 4OLWH 1VFBB 5KG9A 2YPLE 4XX1E 1IGJB 2A77L 2GT9A 3FTGA 1NBZA 4HT1L 3C60D 4KUCD 3RVUD 4YXHH 2AJXH 4ODSH 4O58H 1QACA 1VSCA 4Z95L 3OF6A 5C7XH 3ESUF 2D2OA 2OK0L 1EO5A 5E1AB 5IQ9A 1BVZA 3O8XA 3QQ9D 5ENWA 3K8MA 4PY8J 4UQ2B 1IJ9A 1SYVA 1XGUB 2MCG1 4YH6A 3RTQB 3UJTH 3KHQA 1F3DJ 2O5YH 5D7LA 3CDCA 1MOEA 1FV1A 2EKSA 1TETL 3NCYS 2PYEE 2BVQB 3FB7B 3LRSB 1RIVH 4PGCA 5FO8A 1RK0B 2QADC 4JN2A 3U7WH 1WSST 1CIDA 3QCVH 4XNYL 1F4YH 4ORGA 3WD5H 2W0FA 4GW5B 3K4AA 3CH8A 4KHXL 2PR4H 1Q0YH 4NWTL 3SO3B 2V2XB 1WZLA 2HT3C 2HT4D 2KUTA 2HFFB 4MAUL 4K23H 1A14L 5TF1H 4X0KB 4L9LA 2VH5H 1CD1A 1ZA6A 3RVVC 3N06B 5B4MC 5C9KA 1YEEH 2V2WA 1D6EB 5JOFA 3ISWA 1T1ZA 1I9IH 4MB3A 2W07A 2HLFD 2W0FB 5C0RL 3MRGA 4Q0XL 5FYLD 5BVPL 2ZJSL 4L1DA 5DMKA 3L3OA 4HXAL 1CU4H 4DUXA 2OMBA 2BNUB 1CFNA 4QRRB 1NLBL 2EKSB 2DI7A 1QP1A 2DQGL 3MV8E 4X5WA 3VXTB 2YPKA 1I75A 4MJ4A 2AV7B 2K7PA 3O2DH 4X6DB 4H1LH 3EFDL 3PQYB 5CJ8A 2PXYC 5DVKA 5E7BA 3PXJA 4FQLL 3E3QC 3UDWA 3QUXA 1KGCE 1TCMA 5AZEL 2Z92B 1IGCL 3H3BC 2V9RA 4H1LA 2QSVA 5DQ9B 4E9LA 3MXVH 1OWWA 2DQDH 4XVTL 1YN7A 5GS0H 4M61A 1YJDL 2DWDA 4HUVB 2GKIA 3PJSA 5GJTH 2ITDA 3QRGH 4XZUB 4ZXBA 5IBUB 5KVDL 3RBSA 1EV2E 2JLLA 3BKYH 2EDKA 2YKLL 2FX7H 1ZHNA 3HLAB 4AEHH 4PLOB 2IF7A 1VERA 4E41A 4JCLA 4OZIB 2YA2A 4TVPH 3I75B 3JBG7 4P2QE 2DQUL 3GSWB 4U1LA 2I27N 4WTWA 4PPTA 4Z7NF 3ZO0A 1PEWA 1UACH 3MMEB 5LQBL 3DX8A 3T1WA 4OF3A 2CPCA 4PRAA 1SVZA 3QWOB 4C54A 5B39B 5AYQA 3CFCL 4JRYB 2X70A 2APVA 2DM7A 4HPYL 2CRZA 4PRDA 2D4FA 4U7KA 2PCPA 4DGYL 3ORJA 1T20A 4KZEL 3ARQA 3MRFA 4X4ME 4ZUWA 4ZYKA 2F15A 1IAII 1MCFA 4OGZA 2EIZA 3BO8A 4TN9A 5BRZE 4NM4H 1BQLH 4OFIA 2IH1B 4Z7VE 2DWEA 1D6VH 2VDRL 5I30H 3CJJA 3DV6A 5D2NB 1S7SA 4RAUA 2E7BA 1GHFL 5L88L 4XAWL 1XF5A 2WP3T 3QG6A 2XA3A 3RWDA 1Q72L 2WW8A 5TE4L 1OTTC 2AXJA 4JN1H 1JWMA 5DUBB 1VFMA 4XP5H 5EUOA 2X4OA 3QHZL 4OT1H 1CVSC 1JZ4A 3GRWH 5KSAD 2I07A 2W9DH 1H3GA 1IAIH 4F2MA 4TPRL 4U1SA 2VO5A 5E6ID 4HQQL 5IMKA 1ES0B 3LKQB 4M7ZB 3SGJC 4ZQKB 1AHWB 1QBLL 4JB9L 1F6AB 1SM3H 3HC0B 4P5TB 1M71A 1OF2A 1FC1A 3BQUC 1BAFL 3C5ZA 1KJMB 1AQDA 1WWCA 3QPQD 4X7FC 5C07A 3V0AC 4S1SL 4CMHC 1M05B 4X9BA 3MJGX 4OZGE 5HHMD 1A9EA 5SV4A 4Q9CA 1BBJB 4GUPA 4XAKE 2QLVB 5DJ8A 1GVIA 4LEOB 2R0LL 4JE4B 3T2OA 3G9VA 1GCFA 1ZS8A 1KCKA 2BY0A 4XC3H 3C5JA 5JIKA 3MV7D 5TQ2H 1UXSA 2BNRE 4HGWB 3LB6D 5JOEA 1F42A 5GRUL 1OAXH 4HSQA 3ARBD 4TRPL 1X6LA 5IW1A 1DQJA 4M7ZC 4HWZA 4OCWL 1SJXA 4DGVL 4RIRA 1GOFA 2AQ2A 5TE6L 1CDBA 2OS7A 3BPLB 4PJDF 3NZHL 3C8HA 4NKMA 1X5FA 1J1PL 2RCSL 1ZVYA 2DYPA 4PR5B 3VG0H 3ES6A 4F80A 3HNTH 5HXMA 4TNWK 1FLRL 1KACB 4OKVA 2V2WB 2XNAA 5DURB 4OQTA 1VENA 5FO8B 1KJMA 2Y36H 1YMMB 1OP9A 1Y6KR 3JTTA 4JFFA 3CPLA 2DQEL 4UTBL 1IQWL 5CEYA 4K3EH 4JVWA 1ES0A 3ARSA 4X98A 4BZ1H 5E6IA 1V3KA 3U79A 5FUOL 4HKJA 1NEZG 1GIGH 1YECH 3KXFD 3M8OL 3DXAD 5IHZA 5BRZB 1IQDB 1MIMH 3SO3C 3U9PH 4I9WD 4E41E 3QHFH 4RGOL 5FEBA 3QDGB 4NRYA 3QG6B 3RWDB 2J8HA 1FCCA 3MGTB 1PLGH 3G6AA 3HG1E 4FQHB 5CJ5A 1HHKA 4KRLB 3OGOE 2R1YA 1IZKA 3PF2A 5JUEL 3IJHA 2OMNA 4NSKB 5GGQL 4O2EB 1U8NA 2DQDL 3BESR 3MNWB 4XVTH 3RX5A 1A3LL 1MI5A 3W5MA 1FL6B 1WBZB 1IEBB 5F44A 5C6PB 3GDBA 1DUZB 1B6UA 5F9AC 4PJAF 3AU1A 3CMGA 3MUY1 1Z9OA 4K7PY 1ZT1B 4PREB 4XVSH 4G9FD 1NLDH 4X4MA 3MOAH 5T3XH 4UUJA 4JG0H 2ITCB 4ODHH 4XCNA 1CTOA 2IPTH 4K8RC 4NQDA 2GT9B 3FTGB 4Z7VF 2O26U 2A83B 1V7NH 1AGDA 3DVNB 5E94A 1QFWL 3GMQB 3IDJB 2O61B 1QBMH 1U8HA 4JRYE 3MLWH 2CIIB 4DEPB 2HRLA 5JO5A 4RQQA 4OCXL 3PJSB 4JRXB 3GBML 4I0KA 4TVSa 1NCCL 3TA3A 2DIJA 3AY4A 5EPMB 2ADJA 2DLGA 3SPVA 4NZJA 3LKOA 3QDJE 4JG1L 4E42A 2AJZB 4F7CA 5F6IB 2R4SH 1KSRA 3T0EB 3HLAA 3ZMRA 5GHWH 2CK0H 2XTJD 5GHWL 1JPSL 4N0CC 2BSRB 4DN4L 4TVPD 3C9NA 2GJ6A 5IWLC 3MX0A 5FYJD 1YQ2A 5D2NE 4YHIA 1QSEE 3JWOC 1RJZA 4PS4L 3C8KA 4MJ5A 1PSKH 3EOTH 4K71B 4P9ML 1I3RB 4N0YH 1BBDH 3IFNH 1RZ8A 3MOBH 1D5IL 4EUPA 5HHQA 3NVQA 1N6VA 1UWGH 2VQTA 5AUMA 4ETYA 4PJ8B 4GMTH 3CAFA 4PB0L 3Q5YA 1Q72H 2ZKHL 2C3VA 4RGNC 3IETA 3S9DB 5E8OB 3PWJA 3O4OB 1KV3A 4HKBB 4HWBH 1A6VH 5D7IA 3U0WH 5EZIL 3WFBH 1CLOH 4YHOH 3KJ6L 1FYTA 2ATKB 1WZ1L 4YAQA 3FQXA 4ZO7A 1KIQB 1DQML 2J4WL 3DXAB 4LHUG 4TNVF 3SJVB 4P48A 3P40A 1UFUA 3IFLH 4ORGB 2VTFA 3LY6A 3D18A 4P3CL 5I1IL 2PYFA 2XQYG 1T0PB 5EZLA 1RU9L 1QO3A 1U8QB 4OFYD 4GBXB 5EOTA 1FGNH 1G1CA 3O8XC 3FZUD 3NAAL 4KTEL 5EC2B 1J05B 4NJAH 4H26A 1KTLB 5E99L 2VAJA 5EWIH 1MCHA 1WWAX 3FT4A 3QHZH 2J5LC 3UROR 4OFPA 5CINH 8FABB 3L9RA 4L29A 3FFCE 5J6HA 1QYGL 2IANA 4QRSB 3PIQB 2VR5A 1K3IA 4J23A 1EGJH 1G7JB 3S34H 2CDGA 2WUCH 3QUXC 2PKDA 2ZUVA 4LCCB 4ONOA 3VXME 1FLRH 4MCZB 4TULL 3B9KA 4LQFL 1ZHNB 2LU3A 5EO1B 1G9NH 1LK2A 4PJHE 4LSTL 4LEXH 4HXBL 4GG6B 3RWCB 4ODUB 5EOQH 1CFTB 4PJGA 2G9HA 1R24A 1NAML 3VWJB 4BFEA 6FABH 4S11A 4ODWB 2XI9A 4N0UB 4L4TB 2R2HA 3K8KA 2X9YA 5DGRA 1GPOL 4U1HA 3C60A 3J7HA 3OR7B 3QULB 2FB4L 3O6LL 4P2OD 5F7WC 4HCRA 1M1SA 1MCKA 2AABH 3PXHA 1MJUL 2X4UB 4WHDA 3VFGH 1G7LA 4FHBD 3BN9D 3GKZA 1Z0NA 5HI3D 3HE7D 4DUVA 3G08B 3AM8A 1E4JA 4WW2B 2GK2A 2P44B 2GTZA 1L7TL 4QGTA 3P0YL 5HDQH 1MIEH 3GI8L 1ZLUK 5IOPB 3OXRB 3CZJA 5FDWB 5I2IB 3VFMB 4RWYH 2AJUL 1BQHB 3SKNA 5SX4H 2AAVA 3RY6C 4ORZC 4PLKC 5KZCD 4I2XA 5FM5O 5GS3A 1P4BL 2C3HA 4LIQH 1FE8L 4GBXA 4NBXB 4YFEA 4GKSA 1BLNA 4ZFOA 4ZNCD 4XB8A 4JRXE 5C0CA 3OPZH 1RHHB 2ARJA 1LP9B 1YN6A 4KJPC 1JNHA 1CGTA 7FABL 3Q5TA 1AI1H 4JZOA 3P4MB 1MI5D 3BGFB 1FNLA 1NCCH 2DLIA 2VLRA 3T3ME 2VDPH 4MHHI 3V4UH 4RAVA 3E2HB 5HYSG 5IFHH 1JNLH 3VW3L 1P7KA 1U9KA 5IESH 3PNWA 4Y4HB 1TZIB 2D3VA 2GCYB 2I60L 4PRHB 1NUNB 3U4BH 1JZ5A 4W4NA 3TBYB 4MAYC 4H8WL 3IDGA 4N9GA 4Y2DD 5BV7L 4DKFH 4MMXC 3G6JE 4PRID 3PWPD 5GRXG 5MEQA 3IXAA 1JTOA 4APQA 5KAQF 2ICEB 1A47A 3ARDB 3X14B 2VLKE 5F9DC 1FAIL 1JRHI 1IM3B 4EI6B 3ROLB 4L4JA 2NY5H 3TA3B 2YK1L 1EFQA 5GGTL 4NRZB 5JA8B 3VXSB 1F6AA 4LCYB 4NPYB 3ARZA 3IDYB 5L0QB 4JFOB 2B1HL 2X40A 1FNSH 3U0TA 5BVJA 4GJTB 4HIIB 5E6ZA 3W39B 5D7LD 4WJ5A 3ZHDA 3BGMA 3PHQB 4XCEA 4PLJC 3V6ZB 4YDLB 4GOSA 3ZT5A 4MQTB 3I9GH 5IR1A 3LVEA 5C0BE 4F9PC 2X1QA 3BQUD 4XMLL 3BD3A 5EUKB 3UJIH 1T22B 4UV4H 4LSDA 5EU5A 1IT9H 2VDNH 7CGTA 4K3DL 1JNLL 4NUJB 3ULUE 5LKNA 5IJVB 1F4WH 3KDMB 3P4NB 4JFYA 2F74B 3O3AB 3ULUD 1UEMA 3L5XL 4P46D 4WHYG 3NIDE 3RU8L 4FMKA 2XT1B 1FNHA 1YN6B 4FZEH 4LVEA 1FYHB 1BOGB 1OVZA 1A2YA 4KV5F 1RHHA 1CLOL 4HG4J 1R5VB 2E7LA 4J8RA 5ITFA 4OZIA 2VABB 3VGAB 4HF5L 5EO0B 4LU5L 1WFUA 4HKZB 4Z7WF 3FCTA 1F4XH 2VZVA 2WIMA 3HG1B 1SEQL 3QWOA 4LSPL 3D0LA 1MCPL 3NFSL 2YPVH 4XWGH 2D7QA 2YC1A 3VXSA 3V4PH 3VA2C 5IMMB 4KKLD 5KTEL 1KCVL 3X17A 3PHQA 1F45A 4MA3B 4N0UE 3R06B 3HC4H 3S6CA 1OAXL 1CICC 5B38B 1LDPH 3QXVA 4GRLA 3PDDA 5GRYA 5ESAB 4FQQA 5A2LH 3ZE2F 4MXVE 4GAFB 5IM7A 4JAMA 3BP6B 1L6ZA 4B7LA 4ZTOL 1JWSB 1S5HB 4CAGA 4S1DD 1EEQA 5E8EB 2VE6B 1CK0L 3QQ3B 4U6VL 2KQNA 3BIAX 1LQSR 1E6JL 1KCSH 4NBYB 4L4VB 3L3KB 1PZ5B 1R3HA 4PJ7B 3DUSA 4RFEB 5HVFB 1QBML 4WHTB 4YDJA 3C6SB 4RAVB 1EAPB 4XMKL 3GB7A 4XPFL 4EOWL 4PJGB 1ZTXH 1HH9B 4LDLB 1IC4L 4EXKA 2HMID 4P5TC 5IV2B 4NC1C 1BOYA 4XC1H 3DX6B 5F7KC 4F58L 3UEZA 2DJSA 2NY0C 3HZMB 4ZPVB 5KSVA 5ALCH 2DQJL 4DWHA 4IJ3C 5JW5A 3UTPE 1KYOK 2KZWA 4PBVC 1U8OA 2QQNH 4M62L 4JRXD 3SE9L 1I1RA 4KZEH 1E4WL 4U2YA 5IW6B 5I15H 5I73C 2X4OB 3EOTL 3TO2B 2VL5B 1D6EA 5JOFB 1PW3A 1JWMB 5DURD 3SGDH 3AUVA 2AK1L 5JUEH 3QHFL 1BFTA 5ECJE 1OP3K 5BZDA 4MS8C 5BV7C 1NPUA 3A6BH 2X44D 4YHML 3LRHA 1NEZA 1BQHA 5CGYC 5E99H 2X10A 2ZCKL 2CQVA 3CVHH 4X7EC 3TA3C 1FH5H 3AY4C 1CF8L 2A6JB 5T5FH 4RAHA 2HVJA 1MFAH 1BFOA 5B8CA 3ARDC 5IB4B 3D69A 3UMTA 4LCIH 5EU6A 3GSUB 2XXCB 2XACC 5F9WC 4FQIH 3QIBC 4YXLL 1OTTD 3RL1A 4D8PA 3MJ7A 3V4PL 3B9KD 3MCG1 1IRAY 3U7YH 4GRWB 3RUGF 4I0CC 4TUOB 3ZDYE 2FJHA 1J0YA 3DX9B 2DKSA 1RHFA 1Y18A 3JZ7A 5ICYA 5EUOE 1RIUH 2EICA 3L3IB 4PP2A 4OIIL 4Q2ZB 4ZDHA 1A5FH 3IKKA 1KYOJ 3JUZA 2P5EA 1HHHA 3DIFA 4KJYB 4P49A 1CZ8L 5F72S 2VR9A 3KYOA 3FRUB 1TTFA 4N0YL 3HS0A 2BVOA 2D0FA 3GO1H 4JPIA 4X8XA 3S5LG 4H26B 1EIBA 2CDFB 2BY3A 3JWDC 4OUUA 3T4YB 1CE1L 4LSQL 5ICXA 3KPQA 3I75A 3FJTA 5C0JB 3ULVD 1HNGA 1O0VA 1JZ8A 2CJUH 2BY1A 1SEBA 5DJCA 1FFQA 2ZCKH 1TQCB 1TZHA 3ZE2E 3ULVL 3UZVB 1UM6H 4N8VG 4YQXH 1P7HL 2R9HD 5GGSA 3RPIB 5D1XB 3GMNA 2B2XH 1X4YA 4XP4L 1WCBA 2P8LB 2A83A 3DVNA 4BSJA 2DYPD 3SDAB 3P11H 5C9JB 1LE5B 3BVNA 3PV7A 1MCPH 3NFSH 3UTSA 3DO3A 4NT6B 3BGAA 1T03H 3NCEB 1ZT1A 3QUZA 5EU7E 1NAKH 4Y4KB 1NCWL 4N90E 2VDOL 4R7NA 4KVCL 4UILH 3ZDZE 3MBED 4JFFE 4H88H 4LPWA 4EUPB 5HHQB 3MV7A 4DQOL 4XNMB 1NKRA 1AC6A 4XNZC 2CLZB 4Y2DC 2V2TB 1IZJA 2X1WL 4M7LT 4MNHB 4WW2F 4OSUH 3MFGB 4OD2A 4XCYA 3FL7A 3ULUF 2WIIA 3WL9B 1GJIA 5I1JH 3RTQD 3ZE1E 5IKCA 4GW5A 4O58L 4ETQA 2VL5A 4Z7WB 1QSED 5DFWH 4ZNEA 2EYSA 1R5WB 5C7XL 2N7AA 3QG7L 5FKPA 4MA8H 2HJKB 1U8JB 1RVFL 3QJFA 3MACL 4HZLA 3FT2B 1QEWA 5FA3B 5C0GA 2Z31B 1M6OB 3C5SA 2XZCH 4L8DB 3LAFA 9CGTA 1BZQK 1KN4L 3S37H 4WFED 3THML 3O8XB 1QFPA 4PJXA 2XPGA 3SE3C 1KELL 1NFDF 2YD3A 3NFPB 3C6LA 3TPUA 3PQYE 4H25A 4HUNB 4I1NB 1DL7L 4JRYD 4N0RA 1U8OB 2J12B 1UJ3B 3NA9H 4M48H 3RDTC 4FQCL 2GW5A 4P3DB 3HR6A 3JWOH 3ARBB 4NDMA 1VFBA 4NM4L 4G9FE 2V6HA 3FMGL 1L6XA 1A1NB 1FAIH 1HINH 1KJ3H 4O2EA 4MGXA 2A9NL 1HHGA 2Q7NA 5I0ZA 3TIDB 1P69B 4XXCC 1DBKL 5J12C 12E8H 2HFGL 3TCLA 4HULB 4MCZA 3W2DL 1JZ2A 4RMTA 1SJEB 3ARFD 4JPVL 4YHNA 2XWJB 1B9ZA 4G9DB 5B39G 4K9EL 4Z8FH 1WEJH 4HLJA 1INEL 2XICA 3CFCH 2ZJSH 3H9HA 5IMOA 4JO1L 4RDQG 3U36A 3NZ8B 1S7VA 1NFDE 3WFHA 3EAKA 3MJ9H 1QUNA 4JPKL 2ICWJ 4OUOA 5C0BB 3MYZA 4E41D 4HQQH 2VZSA 3JWDL 1S5IL 2DTML 3GEWB 3ZKMD 1U92B 2UZIH 4JB9H 4LIQL 1H3XA 4M1GL 1QPPA 3GSNH 2FCBA 5IBUG 5HGHB 4LKXA 4F3FA 1HYRC 1W0WA 4LQ1A 3SCMC 1UT9A 5EIVA 5MEND 4DGIH 3O3BA 1W0YT 3OKEA 2NY1B 5MHSD 1AGEA 3KPSD 1U95B 2NR6C 1SBSH 3OAZK 3NH7H 2QR0B 4Z0BH 5LBSL 5DRXB 2P8PA 1CYGA 1HHGB 3K8LA 2RJMA 2EDWA 4QO1A 4NC1E 3CZFA 1I9EA 1NUDA 3KPPA 3LKPB 5EU5B 4P2RE 5KS9E 3P73B 4DN4H 4HBCH 3OJDA 4J7RA 2PW2A 5GIRB 5MP6L 2DQCH 3ARGA 1YYMH 3ZDZF 3IDNB 1U58B 2AJSL 5F96L 1NGYB 3GHEH 4ZNEE 4EKXA 3SDXF 1F3JB 4BSWB 4MA8L 4XCCL 3M1BB 3DSFL 4XT1C 2XTJB 4ZOBA 4IMKA 5JXED 1I85A 4OI8A 4K2UH 2FHFA 4OCNC 3WDJA 5I75C 3I6LE 1HZHL 1JUFB 2YD6A 1RUML 3QEQE 4XNUH 5ADOH 3WFHB 4XVUD 1BX2A 1ZLVH 4KVNH 1ZHKA 2W65A 5CP7A 3TFKC 2FJGB 3UC0H 1U3HC 3ROLA 2F5BH 3MUZ1 2BSRA 5I1AA 2UVFA 2CKNA 4PJHF 4PJEF 4JGMA 4LCUB 4RSVA 5B38A 2FYYA 1RIHL 2BSED 3SE4A 5FB8B 5AD0B 2ADIA 4JZJA 3AREB 3EFFA 1ZGLA 4JFOA 1NAKL 3WIHA 2JE8A 1LEIA 3HC0A 1ZEAH 3B9AA 3WN5A 1T1YB 3TYGL 4ODVH 3F7RA 5HPMB 2DBJA 5BQ7B 2WUBL 1MFCH 5AYUL 4XNMA 2VZTA 3TN0D 3NH7L 2Z31C 1YJDH 5HI4D 1N5AB 2BVEA 4UTAL 3DUUA 4DTGL 3AXLA 1CDUA 2D4DA 5EWIL 2VIRB 5I73B 1MIEL 3GI8H 1SVCP 3OKKA 4CADB 1DQQA 3AU1B 3QUYA 1MRFL 1T1WA 3K1DA 4U33A 1LEKB 4RMWA 3UBXI 4JVUA 4NQXB 3SDAA 1LE5A 1N3NB 5EBMB 2N1KA 5C0IB 1QBBA 32C2B 1YC7A 4HBQA 1X5IA 2QADD 4MA1C 2VISB 1FVEA 2XA8L 4J3OC 4EN3B 1A4JB 4NBZB 5I2IA 1IAIM 3LMJL 1T2QL 7FABH 1IILE 4POUB 3B9KC 1J87A 3ARGB 2MCPL 5I19L 3ZE0E 4IEFB 4OZFB 2G5RA 2H2SC 4EBQH 3T65B 4XCYB 1FBIL 5GZND 3CXHK 1I9RL 3IF1B 1BLNB 4YK4C 3N1GC 4NQSA 5B8CC 1YA5A 4TUKH 2YZ8A 2OTUA 4KROC 4I3RH 3RP1A 3NA9L 2PR4L 4JM2D 4NWTH 4NPYA 3GRWL 3ESVF 4JFDB 1BVLB 4UBDD 4RWHA 4KK8D 4WI9A 4R2GB 1P7QA 3QCTL 5D7KE 5EZJB 2YWYA 4ZAKC 5JNYA 2DD8L 2GJZB 2JJWA 4HZAA 3FQWA 4DCQB 1BBDL 3IFNL 3BT2L 3MNVB 4WW2A 4NO2A 3SGEH 2UYLB 5HI4C 2A6DA 4K8RH 5HBBA 4TSAH 2YK1H 4BSVB 3T3PF 4P9HC 2VAAB 3IAGC 1IGIH 1KJVB 3I02A 5HHMB 3MV11 1G7IA 2VXUH 1I1AA 5HYSB 5GJSL 2GY5A 5K93A 1EZVY 5F7EH 3DMMC 3HMXA 3PHOA 1KBGH 5DMIH 4PJIF 3MBEC 3C5JB 2LVEA 4JY6B 4WWKB 4J12A 1KB5A 3RX8A 1NANH 3M45A 2ATPB 1NGQL 4OLXH 3T4YA 3TC9A 4BM7A 3G5XB 3T0EE 2XQBL 4HCRH 5I30L 3RAJH 1JGEA 4PJCA 3VXPA 4NDMB 1YDPB 1KTKE 5EBWB 1KEML 4G6AC 3D0VB 5TH2B 3V4UL 2M1KA 2EIEA 4LHUA 4WUKL 4AY0A 4HH9A 5IMKB 1I3GH 3VD3A 4HFUL 5DD6B 5F9WB 4H25B 5C0AE 4P2RD 3JVGC 4XWOC 2H9GB 3GBNL 1A4JA 2Q7YB 3TO4B 4LLVB 2FR4B 4MNQB 5GRJH 2EXWC 4PTUB 2EEAA 2QQQA 3OKNA 1ZSDA 4QNPF 2ADFL 1DLHB 5MENE 2R0WH 1NCTA 3R0MA 4EIGB 4YGVB 4NQVA 1INQA 3WS3B 2AW2A 1H5BA 5DSCA 3RKDD 2EECA 1MCLA 4ZSOA 3L5JA 2RHEA 4G42B 1N64H 1TVBB 1KB5B 5CBEA 2NX5A 2NTFA 3BPCA 2EDYA 1EBAA 4BK4A 4DW2L 3GMOA 4KMQA 3MLRH 1X5KA 3FT3A 1MAML 3BPNB 2ZUTA 1GZQB 1UWXH 3MRBA 5E5MB 5HD8C 1U3JA 4X8JB 4RZCA 4X7CC 5I1JL 1ERNA 4P23D 4NQVB 2IH3B 3JV0A 1KB9J 2YOCA 4IDJH 2HT4C 4J2XA 3MV9B 5B39A 3NZHH 1QQDB 1TTGA 3VWKC 5AG9A 5HDLA 5KVFH 2F54D 4IRSA 1FC2D 1OLZA 2H9GA 1UA6L 1SMOA 3SE3A 4S1RL 4OD3H 1YNKH 1ORQB 3W82A 4FNLL 3MA7B 3MGOA 2P8MA 1N59B 4BFIB 1AD0B 4ZUUA 1ZHLB 2W65B 1UB6A 3IAQA 3GUTB 1IGJA 4RMQA 1ZMYA 3BSZH 3EO0B 4MNQD 2LAAA 4EI5D 4U1IA 3ILQD 2R69L 1BFVH 4X6EA 4B53A 5JO5B 4IRJC 4JFDA 4DGYH 4X83A 1KTLA 4WU5A 3CVHA 4PJHB 1A7OL 2W92A 4Q9RL 4OZGF 3B2UC 3ETBF 2VZ1A 3V8CA 5A2IH 4TSBH 3H6JA 4Z9KB 2L0DA 1MRCL 2EE3A 3INUL 1A9BB 1Z0MA 5I1LB 3I9GL 4Z78A 1TLKA 1JP5A 5D1ZB 2AABL 4PY8I 4G7YH 3WLBB 4TQEL 1QHOA 1QKZL 3SJVA 4KI5D 4GXVH 2ED7A 3NCJL 1AH1A 2DQHL 3HZKB 2O61A 3OKYA 2JB6A 1CD8A 3RWJA 4NZTH 1AP2A 5L7XH 1INEH 4G6KL 2HP4A 1CICA 4KQ4H 5I16B 4LVNB 1KPUA 1ORQA 4PB9L 5FA4A 3QEUB 2C5DC 4ODHL 3FN9A 3E6HA 5GGUA 2BNQA 5IMMA 4OBRA 2X42A 4XCCH 3FQNA 3QP3A 4XBPA 2D0GA 3WIIH 1NCAL 3CFKA 3KYNB 4QRTA 2B5IB 3VJ6B 4LHQB 4XVUC 4N90D 4Q9BA 4TULH 2D9CA 3OHXB 1A4KB 3BDXA 5INCA 4F57H 4NP4L 3F58H 3BZEA 4OV5B 3C8KB 4M5YL 2DQIH 4GQ9L 2Z91A 2F19L 1BFOB 4PJ7E 2BCKB 5DEGB 2CRYA 1CFBA 4JZNA 1BQUA 4TRPH 2Y07L 1ZGLM 2ZCHL 5C0AA 3OAZH 3EOAA 3VDBA 2EDFA 3L3HA 3B2UD 4JKPL 1NGXB 5F97E 4AEEA 5MEQB 5CP3A 3VGHA 2AJSH 2ZG1A 2A2QT 3EYFA 4BZ2L 1XT5A 3QFDB 2EC9T 2AS5M 4U0RC 4PJ5A 2AJ3A 3VU2A 3QEQA 1RPQA 4P4KA 1IEAB 3BDYH 4UBDC 1JGEB 4PJCB 4DZ8B 1A6TA 2FX8H 4UB0H 1VDGA 3O0RL 4YO0B 2GJ6E 4ONFL 1MHCB 2E6JA 4KC3B 4V2CB 1QRND 4B50A 5IFAH 5SX5H 1K5NA 4HV8B 5B3NA 5ID1A 4BSWA 1JYVA 1ITBB 2EDHA 3EDEA 2R69H 1OARL 4WTZA 1YPZE 4M93B 1ZA3A 5IVZA 3RNKB 1X3DA 2ESVB 3C6LD 5KG9B 1RUPL 5C08B 4L9LC 2OXHA 2NY3D 4R0LA 5JOPD 3STLA 1Q1JL 3BX7C 5C0DB 4NCC1 1JNJA 2AGJL 3RL2A 4PD4K 1RQ5A 2HRPL 1TNMA 2XKSA 3ARDA 1HHKB 1DEDA 5CLTA 4F7TB 4Y4FA 1OQXA 4PRPA 5DA4A 3DV4A 5JHDE 2WWKT 3HI1A 3IU3B 1Q9WB 1DUYB 2BSSB 1RZJC 2ZSVB 1RZGB 5GGQH 1C7TA 4EDWH 1JRHL 1YQVL 3Q6GL 4NM8L 3KYKH 3UO1H 3LH2L 5F7DA 5D8JL 1OB1A 1T04A 1FZJB 2BZDA 3NTCL 3SKOB 5F9OH 3KPTA 4JO3L 1FH5L 4ZD3H 4DK3A 5EUOB 3MRLB 5ACLA 4ELKA 3BO8B 1A2YB 2PUQT 3TV3H 3WNOA 2OR9H 3RI5F 2IALA 5K9KA 1MJ7L 4WCYH 4HUWA 1CFQA 4AT6B 2OXGA 3I3EA 4YBHA 3P73A 3QUMA 3FFCA 1VCAA 3OV6A 1H9VA 5EG6C 4HUXB 2HKFL 5TDPA 4NUJA 2R29L 4MQXD 1QRNB 4LLDB 1RIVL 4RGMB 1FZKB 5HGBB 2JJSC 5DHVB 2AXHA 2AKRA 3ARBA 1OAUL 2HJLA 5FYLH 3QH3B 5JXEC 4UIKL 4YHPB 3V0VA 5F6HJ 1ADQA 4H5SA 1LO3L 3QCUL 3MUHL 3TVMB 3KPOB 3ALWA 1U8KB 2CD0A 2FB4H 4QHUB 5TE6H 3RZWA 3DX7B 1XF3A 5T1KB 1NANI 4UAOB 4HIIA 4M6OH 1A9EB 4C56B 4GXVL 3F7YA 4LSUH 4O9HH 2YBRA 2JK5A 5H2BA 4UQ3A 1KC5L 1UB6B 4Y5VA 2UWEA 1I1FA 5KSAA 3V6OE 3N1PC 2HN7A 1EPFA 5D7JA 4HUUB 4RMUA 3GNML 4RA0C 3DGCR 3L3HB 3UTZB 2K3TA 3DMMA 2XY2A 1FDLL 2X89A 1FNSL 3D39A 5BVPH 3QUXB 1GOGA 1WISA 1HDMA 1P4BH 4LCYA 3ZKMC 4RISH 5LGHL 3ZL4H 4LPCA 4PIRF 4MX7B 3ECBB 2F58L 5IQ7H 5D2LE 4KI5C 2FX9L 3HUJF 1CFNB 3EYVA 1MHHB 4BKLA 3WFCL 1ZT4B 1A7BA 3OKNB 1KCVH 4RNRB 5KTEH 3N1MC 4Q97A 2IANB 5C08D 4MCYB 3PQYA 4O02L 3VRIB 4A2LA 5EU6D 3QFJE 4WV1B 3TBYA 2CK0L 1MVUA 4NO3B 1H5BB 2MCPH 1ORSA 4HH9B 1FG2A 3WJJA 1JGDA 1HH6B 3RU8H 1XGYH 5F1SA 4OBSA 1WK0A 5F7NC 5TH2A 1U8JA 5LWYL 1A7NL 1AFVL 1MQ8A 5HDOA 5CFHA 3BHBA 2YWZA 1NGXA 3D18B 3I2CL 3MUJA 3Q1SL 2YD8A 3RKPA 3GO1L 5JA9A 3HE6C 3B2VL 5F71A 1IGYA 2VYRE 4X4YB 5LJYH 1I8LA 4S0TD 4KWUA 2OQJA 3AMKA 4MD4B 3O4LA 2FRGP 3D48R 1BJ1H 2BCKA 5DEGA 2Z31D 2VXTH 2OI9B 1A6ZB 4E42B 5C0BD 4E41B 1F00I 1RFDL 4HXBH 3CK0L 2ZUUA 3IT8D 3TT1H 4QXWA 1MHPH 5K9QG 3EYQD 1N5YL 4ZTPH 5C08E 1NMCC 5CIPH 5T3ZH 2NLJA 2A73B 1A7QH 5SX5K 3U0PB 1KPVB 4HAFA 1H3TA 4IMLB 4O51B 2ZOLA 3VFTB 2MQ3A 4OLZL 2FECL 1BF8A 1TJIH 1VGEL 2VDMH 3E3QE 4YUEL 4MLIA 4XWGL 1M7XA 4CMMA 1MJUH 3G9AB 2VL4A 1RJZB 4YBLB 4HUKB 5BV7B 1CFTA 4FTVE 4XP9L 1EHAA 3N50A 1KJ2L 2XQBH 3MJ7B 4OF0A 3CIQA 5DJZA 4NSKA 3HTLX 3OR7A 2BNUA 4Q7DA 4ZO6A 4ZOAA 4G9DA 4JPVH 4M00A 1SEBB 4HWEL 4LSSH 4MA3A 2GJZA 2P42B 5EOCL 4Y5YC 5D6DA 5FYKE 1X6NA 4GQPH 4MDIA 5CHNA 1S7WA 4DOHB 1MFDL 1UWEH 4JPIB 5CD5C 2IADB 4LHJB 1NCDH 2HH0H 5I74C 4G6JH 4P4KB 4M7KL 4NQCA 4FQXB 4U31A 4P2RB 1MI5E 1VFAB 3F7PC 5DF0A 1CWVA 4W4OC 2Q3AA 4HJJL 4HGMA 2B4CC 1Q0XL 2P5WA 2NMSA 4HDIA 2IJ0C 1I8IB 4GAYB 4WUUA 1KB5L 1S9VA 3L5WB 2XNAB 5A2FA 3VXQB 5FIEA 1G7QB 2KKQA 1G6RL 3G5VB 1LO5B 2DBLL 4OLUL 5KJRH 1ZT7A 3T0VA 5KANI 4Z0BL 3TZVA 5I8OH 2R1WA 5EC2A 35C8H 2FWOB 1P1ZA 3OXSB 3MV8B 5D70L 4P9MH 4GSDH 1KCSL 2MHAA 4JEGB 1YDPA 1QD0A 4QRTB 5IV2A 4Z7WA 1GZPA 5GISH 3QXDB 4GG8A 4LLAA 1RVFH 3VMOA 4WJ5B 3ET9F 4ZFFA 1AD9A 4JQIL 4JREC 2WBJC 4Y5XA 5F3HB 5HI5D 3W0WA 3PHOB 3S88L 1FNGA 5GS1C 3WNNA 4EXPX 1LK3H 2YXFA 1R3HB 2NY3C 5FFLA 1A6VL 3DETC 3TJHD 1BPVA 5BZDB 1ZSDB 3ZE0F 4Y5YB 3RUGE 1LDSA 2J1KA 4OGAD 4WO4A 4FXKB 3U30C 1P6AB 4QHLB 2FYYB 4PYGA 5F1IA 1SYSB 2R2BA 4M48L 1F11B 5TQ0L 4R96A 4XI5D 3ZYJA 2BRRL 4N1EA 4JY4A 1HILA 4UU9A 1QSZA 4AZ8A 1QSFA 1C16B 2J6EA 4FFWC 5TF1L 4GMSH 3LIZL 4XP9H 3ZKND 3FO1A 2JJTC 4G8GA 4LARL 5KSBF 2B4CL 1KPVA 4OLUH 5ACMA 3FRUA 4MXQC 4G6FB 2B20A 1FAKT 5H8DA 4NZTL 1VPOH 3H7LA 2XG5A 3C09B 3HZVB 4Y16B 1RI8A 2F8OA 3SQOL 3M07A 4DOHE 3L3IA 4PP2B 1KIPB 4QCIB 1IM9B 1UB5B 3R1GH 5GIRA 4M03A 4IOIB 4C57C 5KS9A 43CAB 1D9KC 4OV6F 1IVLA 4JHAH 4K7FA 5IB3B 2CRIA 3IU4H 4BH7A 3ABZA 3GK8H 1QFWH 3SGEI 4NHUA 5E8PA 3RY4A 2UYLA 2XZZA 4RDQF 5DVNA 3KLAB 5CD3B 1RUMH 1HK6A 4AT6A 2Q8BL 4L4VD 4R26L 3ULSA 5IVXB 2L7JA 4CADA 4YFDB 1ZANH 2QQNL 4IOFD 3MLPA 3OAYH 4TUOA 1E4WH 4JFHE 1NL0H 5EO9A 1T2JA 5C1MB 2EE6A 4OFKA 4FFZL 4R0LB 5EH1A 3ALXA 1CGUA 3HHRB 3QB7C 3KPRD 1FZOA 4XMKH 4XPAL 3L3GB 5IROC 1IM3A 2FX8L 2R8SH 4QOKB 5FYJE 4M5ZL 5HHOA 3GGWA 2G2RB 4WFGD 2P47B 4QRPB 5AAMA 5HYJA 1EA9C 1UM6L 4TVPE 4YWGH 3V8OA 3S36X 2FDBP 4Z7VB 1A6TB 2XTJE 3OKMA 2EO1A 2EO9A 5ERWB 1ZHKB 1FFPA 1MNUH 4BZ1L 2M26A 4DAGH 4P46B 3WUWB 4F15C 1LE9B 3GSWA 3CD4A 2D0HA 5I15L 3CLEL 1G7HA 5LXGH 1G9MC 4N8PA 3SDCA 5HPOA 3B3IB 1NFIA 2QSQA 3JV5A 4QHKJ 4WTXA 3G6JB 3LIZH 1RMFL 5J6HB 4QHMB 1Z5LB 4MNQE 3P4MA 1DE4B 5CZVH 1W72B 2ARWA 1JPFA 3VXRD 5FO7A 4S10A 2IFFH 3WIFB 3RWEB 2IFFL 5I0DA 3FT2A 3KPLA 1DVFD 3HE6D 5HGBA 4YBQD 2IBBA 3QXAB 1JNNH 3MRCB 2QQLH 5INCB 2MSPA 2F54E 4K7PH 2BOBB 5FHBH 1DLFL 1JYXA 1YEKL 4FQCH 5DO2C 3VFMA 5I1AB 1KF9B 4WV1C 1RAMA 4QLRA 1PZ5A 3D6GA 2C4FU 2WINA 4FQJL 3TCXA 3VE0B 4YXLH 3HG1D 1QA9A 3RJDA 1S7XB 3K3QA 2P43B 2UY7A 3BH8A 4G8IA 4K9EC 3KXFE 1DANU 4JJ5B 4S2SB 3FQNB 3A0OA 4MAYA 4XRCB 1V8HA 3K46A 1KCUL 4I18A 2C3VB 3ZSTA 5KVDH 5DHVA 2FHBA 5CILH 5D6CB 1P6FA 3D0LB 2E7MA 4MZ3A 4LSQH 2PO6D 3GIVB 1OP3H 2RCSH 3KNBA 5C08A 3ZYZA 3C9NB 1WTLA 4NWUL 2CR6A 2XYCA 4HUWB 4M43H 1MUJA 1F8TH 1Q9LA 2FSEA 3PV6B 1CDYA 3P77B 5CS7A 4CRPA 2ORBL 4Y1AA 1LO2L 2NY6D 1BEYH 4N5UA 1PY9A 3S3PA 3VRJA 5EU7C 5JW4Q 5C0EA 5IUSA 2R2BB 5FDYA 1NQBA 1MCQA 3MV01 4XP4H 4QHLA 3PP3K 3F7QA 4LCIL 4X9FA 5BZWB 4BK5A 5ILTH 1RZKH 3CLEH 4LKCB 2G60L 1M6OA 3DSFH 3IKCB 5DJ2B 1J8HB 4L3CB 1MIML 1U93A 2CRMA 5HHME 4XCEB 1JMXA 3GSNL 2HMIC 2QTEA 4NFDA 2Q87A 1WVZA 2NY1C 3ILQC 4L8SA 4U4BA 1NBQA 1Y18B 5IMLB 2UZXB 5DRZA 4UZGA 1MJ8H 3BE1H 2LTQB 1QG3A 2O5ZL 1RUQH 1JFQL 5IT2H 4JZNB 2ED9A 2E7LC 3VFUA 1PAMA 4L3EB 4X99B 4I13B 3KNBB 4XH2A 4LFHG 4UTAH 1VFOA 2GAZB 4Z77A 1Z9SA 4OKDA 3BZFA 1H3PL 5E5MA 2HFEA 5D7KD 4PRNA 2CO7B 3OHXA 5CWSA 3HAEA 3T2NH 5I1HH 3EYUH 2OR8A 5D1XD 2HTKC 2IPTL 3TO4A 3NPZB 4LPUA 5DEFB 1KIUA 4OGYL 4IRJD 3NFNB 4S2SA 2VDQH 1OAQH 5F1KC 5MERA 3UJTL 2FO4A 2IBZY 3QAZC 4UT7L 3LMJH 4PJAA 3RWIB 5HYIA 2CLVA 4MXWH 5DFTA 3JTTB 1MCDA 1CDIA 4JO1H 5JQHC 4LMQI 1CU4L 1DZBA 3HZMA 4ZPVA 3KPMB 5SWZD 3V0WH 1ZT7B 5HDBE 5SWZE 2VDLL 3MCLL 3LD8C 4WUUB 5DZOA 3IFOA 1UWXK 2YN5A 4RGNB 3LPWA 1B4JL 2UWEF 3CNKA 4G6ML 2X4NA 1I1AB 4NQEE 1VGKA 2AI0L 4R90H 2DJ4A 5DMJB 2X4TB 1HH6A 5IVXF 2XN9A 1UENA 3D1MC 3E0GA 3I50H 2Y72A 1MFCL 5AYUH 3BP5B 2BVPB 3G5XA 4L4TD 1QVOA 5DYOA 3K2UL 2Q86A 4GS7C 5ETUB 4FQ1L 3SE8H 5E1AA 2BOCA 4HFUH 5KVEH 5CINL 3GBNH 1FDLH 2C3WA 3D9AL 1CBVL 4G6JL 4PJFA 2VC2H 5FK9A 5E8EA 3X3FH 3AM8C 2IGFH 5E2WL 1Z6JT 4GG6A 5DUPH 3L1OH 1KENL 3IAPA 2X4RB 4LASH 4QF1B 3H9SA 5E2UH 1XR9B 1OPGL 1I3VA 4MJIB 4D0DA 1DBAH 5I1LA 3VFRB 1XIWA 4R26H 5C92A 1XGPB 3MGTA 4LVOB 3GSXB 3VRJB 3D2UA 3QEQD 3S7GA 3I6LD 3UZQA 4LLWA 5IFHL 1UCTA 3NFPA 2VDKL 2NY0D 4OSUL 2VDKH 4BH8A 3V7AG 2WBJA 4Y5XC 3BN3B 25C8L 4X9IA 4TSCL 4LLUB 4EN3A 2FIKB 5DRWB 4LVNC 3I6GB 2EYTB 1YEKH 4P5MB 5DD0L 4NNYA 1ETZB 1QEWB 5IG7B 5FECA 4XMPH 4MD0A 4F8TA 1AKJA 5DQDH 3SCMD 4TOYL 3QYCA 1MVUB 1YEFL 2ZCLH 1WBYA 3A6OA 3O3EA 1T20B 1D5MB 4GLRI 1ED3B 3GSOB 3AXLB 1J0ZA 1F13A 2E6PA 2Y06L 5EC1B 4U0RB 4MJ6B 2DIBA 1HSBA 2V5MA 3HRZB 1NGPL 3MODL 3ULUL 5FO9A 5KSAC 3REWB 3EJZD 2B1HH 4J6RL 4JVPA 5D6CA 1G0DA 3BH9A 2W38A 1IGMH 1F4YL 1Z9MA 1X5GA 2R0ZL 2VXSH 3MRHB 1MY5A 4PJ8D 1IBGH 5KAQG 1UYWH 1OCWH 4P2YA 4Y16A 1BQLL 3P4OB 3T4AB 1N5AA 4RNRA 1J5OH 1DBJL 1ZT4A 1ZLWH 3GIZL 1NC4B 5FOBB 4F37K 4QWWD 1IC7L 4LSVL 2Z4QB 3QI9A 1HEZA 4Q74A 1S9YB 3GSVB 4IMKC 4WWKC 1HSAB 2FGZA 3BMWA 2A1WH 1CF8H 1EEYA 1F3RB 1AHWA 4AIZA 5E5RB 1C16A 1RK1B 1DFBH 1HYSD 3I3DA 5ACZB 3RA7L 4APQB 3CX2A 3SGKA 2EDJA 5GS2D 2NY2C 2JKXA 5J13B 2IBGA 3ARED 1R3JB 1XCQA 2GSGB 3OJMB 2WUCL 3ARDD 4L1HA 2Y9RT 2FEEI 4MHHG 4X5XB 5ICZB 3WFZA 3VXUB 3RWFB 2ARJB 4OQTL 4ZUTB 3QWQB 1PX3A 3GMPA 4YFLI 4P2CG 1Z5LA 4WFEE 2R29H 3O9WC 3UXFA 3SDCB 5EPMA 1GZPB 4C4KO 1RZ7H 2DL2A 5ICYB 3LQMA 1OTUC 5C0CB 4WY7L 5DVLA 4N8VA 3QO0A 3L3DA 3C5ZB 5FHAL 1YMHA 1ZV5A 4FFYH 4JO3H 4W4OA 3VGAC 4XMPL 3WFEH 3TYFA 4YHLL 2IPKA 2VZUA 3Q1SH 1A6PA 5EORH 3IS1X 1JPTH 5JLZA 1ZOXA 2LQRA 3T0WA 3KPRE 1B88A 3U9UA 3HR5A 4YNYB 3G5VA 1U2CA 3TWCH 4K2UL 2IALB 3KXFB 4NNPL 2Z9TA 2FBJL 1ZGLP 4OCLC 3FOLA 2GTZB 3WKMH 3WXVL 4LLWB 5INDB 3GKWH 1OP5H 3S5LA 2AK4A 4JFHD 1L7IL 2H1PL 3BW9A 1S7TB 4PV8A 5BVJB 2G9HB 4LCWD 5E6YA 3HE7B 2B1AL 3CPLB 1II4E 4ZS6D 2HLFC 4L4VE 1J12A 4HWBA 5F7LB 3KLHC 1OHQA 2F58H 2AK4E 2MKLC 2DJUA 4NOFA 1S9XA 3EFFB 1ZGLB 5DJAB 4ZMAT 4G8GE 5FAAA 5FA4B 5IVXA 2ADIB 5DQ9A 4QXGH 4QRRD 1FVEB 4FQ2L 5GS1A 1UADC 1AR2A 3GZKA 3TYGH 3OTTA 4M1CD 3BE1L 5F7HA 3MRJA 5ETUA 4ONFH 1FGNL 4WI2A 1KXVC 3TJEH 1G0XA 2WQ8A 3MRRA 1G6VK 3T2PA 2EKJA 3N1FC 3QPXL 3ULVE 5D8JH 4NRXA 4JKPH 2EEBA 3FO2A 4KUCF 4X5XA 3AGVA 4JY5L 1CXEA 3B9VA 5HYJB 1J86A 5ID0B 1ADQH 2APWA 3DBXA 1JCKA 3PIQA 3LCYA 5FHBL 3RDTD 5DI8B 3EOAB 5D71L 4PJXB 1NGYA 4L8SC 5A43C 3LRGA 5HPMA 4R97B 4HWNA 4YDIL 3ULUC 1EFXA 1B0RA 2VB5A 4S1RH 2CXGA 4F57L 3S35L 1OPGH 4KRNA 1XF4B 4Z7QF 3LS4H 1OM3L 3N85H 1GRWA 3MFFA 4OM1H 2ZUSA 5FGBC 2FL5B 4XP6L 3DTXB 1A3RL 3X3GH 1HCVA 3CFBB 4JAMB 5FYJL 5I1GL 4HWBL 4U1KA 4OZIF 1WAAF 1BGXL 4FQQB 4K3GA 5EULV 5HGAB 4GH7B 1DVFA 4IHOB 4WI3A 1FSKC 3GHBH 4URTB 2RAMA 4AENA 2H26A 5EBLB 3EYUL 5FM8A 1OF2B 4JM2F 1N6UA 2AJVH 3MLZL 3W81A 4XMLH 3MOBL 1LWRA 2P49B 3IRPX 2DM4A 1CDHA 3MRQA 3IDIB 3I50L 1HSBB 2WMPA 3HRZA 4UOJA 4AMKH 1Y0LB 3QNXB 1DVFB 3OGCB 1GSMA 3QAZB 5I71B 4ZFGL 5DJXB 5F70A 3LPFA 1D5MA 4NQTA 2XKNB 1I7RB 4K3EL 3FZUC 2HJFB 2VRAA 4M7LH 2VLLB 2YUZA 2PCPB 5TE7H 4MJ5B 2PW1B 1MRDL 3AS2A 2IAMC 1ETZA 3D5OF 4M8QB 4G5ZL 1U95A 2EDBA 2DQTL 1CFSB 2V7HA 3WLWC 3P4LA 4G8GB 3B5HA 2FLRT 1EHLL 2C26A 3T0EA 5DJDA 5DD3L 2HKHL 4QTIL 5MEPB 5GGRB 3KGRA 3MBXL 4MA1B 4JFZL 4XP6H 2QSTA 2Y5EA 4HUMB 1OTUD 2MWCA 5A1AA 1HKFA 5AZEH 4PREA 1MCBA 2D03L 2X4UA 3CVHB 3QUYC 1XR8B 2ZSWB 5FYKD 5MEOB 1MUJB 2NR6D 3BZDA 3DPBA 2ENSA 2APFA 4FA8A 1HI6A 3PL6A 2R1XB 5ENWB 2Y6SC 1BM3L 5JDSA 3IJYB 2ITDB 2DM3A 3CC5A 4S1QH 1FSKB 2CDEA 4NCC2 3QUZC 1CK0H 1QZ1A 3QJFB 4U6VH 2OYPA 2CK2A 1EJOL 2UUDH 4XHQA 4KQ3H 4KQ3L 3O4LE 5DRNB 5EBGA 1FNAA 2CXKA 3PV6A 1U8PA 4KXZH 3MLYH 4OZHA 4PGEB 2FJHB 2X4RA 1UXWA 2YEZB 3P9MB 4LP4A 3LEYH 1MFEH 3EHBC 4X6DA 3WJLC 1U8NB 4Q6IC 4PJBA 1K4DA 3FQXB 5D7IE 3TNMB 1P4IL 2OLDA 4LNVA 5DQJA 3BW9B 4GRWH 3W0WE 3D69B 2CKBL 1EH9A 4HLZH 5TDOB 4FG6C 2GSIA 4NHCH 2A6IA 4M02A 2M8XA 2XWTB 4LLVA 2ERJB 2O5XL 4Z5RA 3MJ8B 4AYFA 2IG2H 5HD8D 2H32A 2ZOLB 3VFTA 5ISZD 2HTKD 1X44A 2LV4A 1KLGA 1J05A 4QRPD 4JHWL 5I1KL 3EYOB 1QSFD 3DTXA 1PKOA 3LN9A 1U8MB 1RMFH 2DKMA 5KS9F 4Z76B 4I2XB 4KKBC 4OM0L 5EBWA 3W9DB 1D3CA 3WIFA 2GJ6B 4WNQA 2WANA 4OZFG 3ZTNL 1XIWC 4N8CL 2H32B 2WP3O 3QZWA 3O2WH 4MCYA 2E7CA 1A6WL 4PJ9C 3BZ4B 5HJ3B 2BDNH 5BS0D 3BXNB 3QFJD 3LEXA 1YEGL 2ESVE 1MLBA 5IHUL 4RQQB 1T7ZA 1T0MA 3D9AH 3OBAA 5GGTA 1HNFA 2BVOB 3UYOD 4EZMA 1EFXB 1QR1B 5D7LE 2LU7A 4WV1A 3EZ8A 4KAQH 4V1DA 3SDDA 1T89A 4YHZL 4JY6A 4KPHH 4CVXA 3HB3D 3MYJB 3C60B 1OAKL 2I9LA 4PJDB 4B0MM 2IQ9H 3CFDB 5KSUB 2HG5A 2PTVA 3QUMH 3MLUL 5C8JB 1G6RH 2OTWA 1RJLA 2F5AL 4HIEB 1CD0A 4DGVH 3DWTA 3S96B 5GS0L 4L3CA 2F5BL 2VLKD 1DCLA 2GTWB 4HEPG 4P57B 1JZ3A 1RZIB 4QYOB 1JNNL 4HJGB 4H8WH 3F12B 1TDQA 3PWPE 5IM7B 4PRIE 5SWQB 5EO1A 4QT5B 5BS0A 2RFXA 2I07B 5I1EL 4D9RD 2R0KL 4L9DA 1I4FA 4I3SL 1P4LA 3ZE1F 2FBJH 4HIXL 1EBPA 2YMXH 1VFUA