1IMCA

Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
266
structure length
266
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL MONOPHOSPHATASE
publication title Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 83
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1imcA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1imcA02
3LV0A 2QVRA 5LDZA 1NV5A 3QMFA 1KA1A 4H46A 1RDZA 2DDKA 1QGXA 1NI9A 4GBVA 3RYDA 2PCRA 4KXPA 2HHMA 4AS4A 5EQ9A 1FPKA 2F3BA 2GQ1A 1FBPA 1NV0A 1IMCA 1JP4A 4QXDA 1LBWA 2WBDA 4IR8A 1G0IA 1NV2A 1FBEA 4G61A 5ET7A 1FSAA 4O7IA 4PTKA 4GX6A 1FPLA 1FBGA 5EYGA 4HE2A 2OWZA 5I3SA 4AS5A 1KZ8A 2P3VA 4I3YA 2JJKA 1XI6A 5T3JA 2CZHA 4GWZA 1IMEA 1YXIA 2CZIA 4I40A 5J16A 4H45A 4GWWA 4GWXA 5EYHA 4GX3A 1IMDA 1LBVA 4GX4A 1BK4A 1NV6A 4FBPA 1LBZA 1G0HA 2FVZA 1NV4A 4N81A 1K9YA 5A5LA 1K9ZA 1NV3A 1FPJA 2Q8MA 1NV1A 2FIXA 5ET8A 5ET6A 3A29A 4I3EA 1FPIA 2FIEA 4MJOA 3FBPA 2Y5KA 2Y5LA 1FJ6A 3BIGA 1SPIA 2R8TA 3BIHA 5ET5A 3LUZA 2WEFA 1EYJA 4HE1A 5IZ1A 2VT5A 3IFAA 3RPLA 1NUWA 5IZ3A 3B8BA 2P3NA 1FBCA 1DBZA 2QFLA 3T0JA 1IMFA 3KBZA 1IMBA 4GWUA 5FBPA 5EQ7A 2FHYA 3KC0A 4HXVA 4GWSA 2CZKA 1YZ0A 1LBXA 2OX3A 4GBWA 2QVUA 1FPBA 4HE0A 5EQ8A 3IFCA 1INPA 2FBPA 1D9QA 1KA0A 1FPGA 2BJIA 1NUXA 5F24A 3ROJA 1FTAA 1FBDA 1DCUA 5EQAA 5ESYA 4GWYA 1FRPA 1NUZA 1IMAA 2QVVA 1FJ9A 1FBFA 3KC1A 1FPEA 1LBYA 1NV7A 1Q9DA 1CNQA 1NUYA 5DW8A 1FBHA 1DK4A 1YYZA 1EYIA 2WBBA 3D1RA 2Q74A 1AWBA 1VDWA 1FPFA 3RPLB 1RDYA 5IZ3B 1RDXA 2F3DA 1FPDA 1EYKA 1LEVA
chains in the Genus database with same CATH superfamily
2YLNA 4H46A 3RNNA 1LCFA 3TDJA 1IEJA 4MAGA 4MLVA 4BDRA 5DVIA 1G0IA 1J1NA 4XKQA 2VP1A 4I9DA 2NUVA 3HV1A 4PC9A 1XI6A 1Q35A 2VPOA 2XXYA 4JDFA 3V89B 3OEMA 4EDPA 4MEVA 1N0TA 5I5PA 1ZIUA 4OFLA 3H03A 5HBCA 3E79A 3A29A 1MQJA 4PBHA 2F78A 4HCYA 4YKPA 3DP6A 3BIGA 3K4UA 1QKBA 3IB2A 2H9BA 4OETA 4NF6B 1D9VA 1EYJA 3B6TA 1I6QA 2HEUA 2XD2A 2I0CA 3OO6A 5I57B 3CI8A 3FV2A 3OOAA 4YB7A 5I59A 4P11A 4HXVA 4IO6A 4GWSA 3I3VA 4NEDA 1VR5A 1DOTA 1I69A 5ELVA 1MQDA 4R6HA 3W15C 3SERA 1XS5A 2OK2A 4BLAA 2Q89A 4H5GA 3KN7A 2ESNA 4N8YA 1LAXA 2I4BA 3B6WA 4NQ8A 4ZEKA 3KG2A 1VDWA 1FPFA 3QAXA 1RDYA 4P1EA 4DZ1A 3IOWA 4GWOA 3TQLA 1UTBA 1R9QA 4EF1A 5ITPA 4MNIA 4PFUA 3UA8A 4NF4A 2I49A 5DVFA 1NKXA 4GX6A 2QMWA 1FBGA 5KCJA 2ONSA 2AL5A 3R7XA 4KFQA 4OVSA 2XHDA 2VGQA 4K3FA 5A5LA 3CG3A 4KPTA 1BLFA 1LFGA 3KBRA 4FIMA 4LZ5A 4JBZA 4LN5A 4OEVA 4PDHA 3MZ1A 1H45A 2R8TA 4NWDA 3A09A 3OELA 1B3LA 4HE1A 1I6AA 2QL3A 3GXAA 3IJOB 3TZAA 3Q25A 4ZS9A 5J1DA 3B8BA 4GD5A 3H6VA 4OYVA 2AYSA 1MG1A 1TT1A 1B0HA 2R71A 4QFLA 1B2HA 2FHYA 2XWVA 1FCKA 3FD3A 4F31B 4PFBA 5L9OA 4LATA 1YZ0A 2QPQA 3KFMA 3S9LC 4ISUA 4ELRA 2UVIA 1MQIA 4G2ZA 1A55A 1BP5A 4GWYA 1IMAA 2A5TA 2ZNTA 1JVYA 3ECRA 3IO4A 1NNTA 3B7DA 2XWIA 3S9MC 2NXOA 2OPDA 1P1NA 4IO2A 1A40A 3P7IA 2ZYNA 4F3PA 4FEBA 3CSGA 5CMCA 5I2NB 3K6UA 3Q29A 4NX1A 4OMBA 1NV5A 5M2VA 1RDZA 2X7PA 4U22A 4GXAA 1NH7A 2F5XA 3TEPA 3EPEA 2CZLA 2PX1A 3S2VA 5B7DA 2Y84A 1YAEA 1AL3A 4YMAA 5ITOA 5I7IA 3LR1A 3PPNA 1Y1ZA 2DE2A 2CEXA 1MY3A 1NV6A 4XXUA 3G3JA 3OEKA 3JV9A 3V8XB 4U4SA 1XVYA 3C32A 3CRBA 1K9ZA 4FATA 3FJ7A 3K02A 2F7BA 4HW8A 1B51A 4TLLB 5IZZA 3RQTA 2FIEA 3LSFB 5FHOA 4OVPA 2Y5KA 5DVJA 1UIVA 3C36A 4G68C 4MCOA 4ZEFA 1Y20A 3PTYA 4KCCA 4PF8A 2IEEA 4ELQA 3K6XA 1B3HA 2O51A 1FTOA 3MVYA 2Q88A 3LC8A 2RC7A 5EQ7A 1IITA 5KDTB 2REJA 1NH8A 1HSLA 3CG1A 4H65A 3VXBA 4ZE9A 1A7LA 4WXJA 2ZZVA 1WVJA 4OVQA 3K0VA 3C9HA 3G3FA 4GIZA 4Q8RA 4PBQA 3QYTA 3O6IA 1FJ9A 1XVXA 4PFYA 2R6GE 2OWSA 3CIJA 1Q9DA 1RYOA 3T9HB 1OQHA 5DW8A 2X7QA 2DVZA 3JYRA 4XTCQ 4YICA 3HO7A 3AXFA 4MF3A 4P1LA 1RDXA 2Z22A 4R74A 1FPDA 2RINA 2I6EA 4YKJA 3TCHA 2QSXA 2DYXA 3FXRA 4R73A 4GQOA 4DCXA 2HZLA 2OPEA 1BTJA 3FVOA 4RPOA 4R9FA 1OIBA 3SZPA 3MVZA 1NV0A 2P0SA 4QXDA 4EF2A 3O6HA 3FXUA 3MVWA 4O7IA 3TPAA 1B7UA 3W9VA 3PUXE 2OWZA 2PFYA 2PYYA 3NOHA 2P3VA 3ODBA 1JETA 1Y4CA 4PE3A 4XKRA 1DTZA 1H76A 3G3HA 1D4NA 4NWCA 1QKAA 3FVKA 4P0IA 1WODA 5IM2A 2UXAA 1BIYA 4R6YA 1TXFA 3E4RA 1SPIA 3O66A 4QHQA 4GFRA 2HXRA 1Y1MA 3SEYA 1Y4TA 3OO9A 1MXXA 1EZOA 5F1QA 2RCAA 3H7MA 4XEQA 1FBCA 4IGTA 1MXVA 1SI0A 2B3BA 2XXHA 2WYKA 3K1MA 3TCFA 5CBSA 3FVGA 4H8IA 4P0GA 2ZZXA 4ZEIA 2QVUA 1FPBA 5JTYB 1FQFA 1T0KA 3MYUA 2HQ0A 4MH5A 3ILUB 1FTAA 4RK2A 4XKPA 5H8NA 1IXIA 5JK4A 2QVVA 3U72A 3C4MA 5CI5A 1GR2A 1R1NA 1EU8A 3T96B 1NV7A 1SBPA 3N26A 4EQ9A 4X9TA 1AIVA 1PEBA 2UYFA 2O84X 3N5LA 2XXVA 4PDDA 1FPKA 3QK6A 4OEUA 4R2BA 2PCRA 2B3FA 1QUKA 4DCYA 2OCUA 4NE4A 3T9VA 1MY4A 1LFHA 1NV2A 1IXCA 3C33A 4LP2B 5EYGA 1VFEA 3MPLA 3MJNA 4EQ7A 4KCDA 2CZIA 1N76A 4GWWA 4GWXA 3BFTA 4JWXA 1LBZA 1QUIA 1Z7NE 5ICQA 1URDA 3ZS6A 3LSLA 4X1DA 2FIXA 5ET6A 2YPNA 4M1VA 4MHFA 4U23A 4PFRA 4Z7EA 1UTBB 4N6PA 4DLDA 3C34A 3U1OA 1SVXB 1B3GA 4X8RA 3IB1A 5ET5A 4MBPA 4KQPA 1B58A 3VXCA 4F2QA 3G3KA 5LTCA 1NNFA 2Z23A 3RPLA 4NF4B 4H5FA 2P3NA 4POXA 1BKAA 1IMFA 4HS7A 4TQUQ 5KCJB 1XT8A 1B32A 3MZBA 1ELJA 1Y3PA 3LSXA 2WYPA 3GLBA 1FTMA 3IFCA 2DE3A 2XXPA 1JW4A 4OFOA 4TOZA 5DEXA 2GHBA 5EQAA 1N7WA 1URSA 3BKIB 4N07A 1ZTYA 4POWA 2QS2A 4DXUA 2O7IA 1CB6A 4OZ9A 4NF5A 1YYZA 1R9LA 4F19A 3H3GA 3KEIA 1D3KA 4XKNA 2NVUB 4PAFA 1D9YA 3DELB 1QGXA 5CRYA 2NOOA 2Q9TA 2PMSA 4C0RA 4R9GA 1YTVA 4OTEA 2F8DA 4RY1A 2A5TB 1YXIA 1SYIA 5EYHA 3EHTA 4OFJA 3TCGA 3T1BA 3QIMA 3PPPA 3RLFE 2QJEA 1S9TA 3TELA 2Y7IA 1SYHA 2DQVA 4R75A 1MDQA 3H4ZA 1P1WA 5IAIA 2F7CA 2WKYA 3HN0A 4GWUA 5I2KA 4Q5TA 2OX3A 2RF1A 3K2DA 2DOJA 3PPQA 2LAOA 3HCQA 1FPGA 3PMXA 5ESYA 1Y9UA 1FRPA 3KC1A 4AB5A 1N84A 1I6BA 1MM7A 5B70A 4XIGQ 3OMBA 2PT2A 3Q28A 1PBQA 1M5DA 2Q74A 1ZU0A 2V4CA 1B5HA 4G8MA 3A3CA 1H3DA 3L6GA 1B5JA 3IB0A 3T22A 4HTGA 4QSDA 4G68A 2G93A 1LGBC 3C31A 3TTKA 1UIUA 3LSWA 1VE4A 4YKIA 1LBWA 2X26A 4FAJA 4HE2A 5TPAA 4H8JA 3WAFA 4IY6A 1VSOA 2V93A 2D21A 5BUUA 2ONKE 4IGRA 4NHBA 4N6KA 1POTA 4MJOA 4BDQA 1N04A 1M5CA 3CHGA 4Q0CA 1O7TA 1FTKA 1FQDA 3EKIA 1GV8A 2GFEA 5IZ3A 2UYEA 3QSLA 2Y7RA 4GOTA 4F3GA 1SQYA 3UN6A 3VLWA 1A8FA 5AA4A 3PGFA 4PE5B 3PMWA 1FQAA 5HM4B 1CE2A 2D3IA 3OO7A 4R2FA 3EHUA 4N6DA 3MUQA 4EXKA 1IQ7A 1MXUA 2RCBA 3HFUA 4LQ2A 2XD3A 4NF8A 1L5TA 3FZVA 2DSFA 4ZDMA 2XXWA 4QSEA 2F3DA 2I48A 3GYYA 3HPIA 1QVSA 3R26A 4O8MA 2ZZWA 3FJMA 3MBPA 4ZEDA 2DWHA 5H8FA 2QMXA 4OANA 1FBPA 2DS9A 1POY1 3H6WA 1JP4A 2I3VA 1GVCA 1US5A 4OVRA 2XXTA 5H8NB 3THIA 5BWJA 4IY5A 1JW5A 2QS4A 4QF9A 3FATA 2CZHA 2A5SA 5I58A 3GBAA 2XXXA 4O94A 3QXMA 5TP9A 3O6GA 3K1NA 5JEIA 1OVTA 4U4XA 2I4CA 3M8UA 5KZTA 4BDMA 5CMKA 1SW4A 4G8HA 1KWHA 2Q8MA 3K01A 4X04A 2Q2AA 3K6VA 4DI4B 2XX7A 3FGSA 5AA2B 3S9EA 1OQGA 2QS1A 2ALUA 1GTKA 3IX1A 2QFLA 1AH5A 4OVTA 2NWJA 4KYSA 1SW2A 1EH3A 1O63A 2PFZA 1MH3A 4L17A 1MXZA 3FIRA 5CM6A 3SESA 2I0BA 2FBPA 1FQEA 3K6WA 4Q30B 2UVGA 3MC2A 2V25A 3PPRA 3ZKKA 4NF6A 4ELPA 4AB6A 3BFUA 4FORA 4FECA 4F3SA 2Y7KA 1SW5A 3RPLB 3TYHA 4ZECA 4JXIA 4H0WA 2VOZA 1LAGE 3LV0A 4RJZA 4GL0A 5K2XA 4N15A 1B05A 5AA2D 3TMGA 4LA9A 3IOTA 2B65A 1QW0A 2F6PA 3H6TA 1FSAA 1ZJLA 3KOSA 4ESXA 2P1SA 2XA5A 4AS5A 5T3JA 3U94A 1FTLA 3B6QA 4H45A 4HCWA 4GX3A 1LBVA 1WDNA 4NF5B 5EYFA 3SEXA 1URGA 1H44A 4MFIA 3L6HA 3B50A 4GF8A 1JNFA 2CEYA 1USYE 1IIWA 1PBPA 2O69A 4MNPA 4DXCA 4O3AA 3LUZA 5I56A 3OO8A 1Q1KA 4LVQA 4OHNA 2XXUA 3T0JA 4BDLA 4X48A 5FBPA 3M3LA 3D4GA 3IORA 1MXYA 4N8GA 1PDAA 1O64A 1LBCA 3VVFA 2DWAA 2XWOA 1LCTA 4C1TA 4ZZAA 4BDNA 2GH9A 1LBYA 5FTHA 1B3FA 2HPGA 2O68A 3T93B 5K2YA 2RKMA 1TFDA 1RYXA 5EQ8A 2XX8A 1LEVA 3IR1A 2QVRA 1R6ZA 2R9JA 2OJTA 4U1ZA 1PB9A 3ZKLA 2HCAA 3DLNA 3FXBA 4YB6A 4ESWA 1B40A 3LBSA 1HSJA 3T9UA 4PTKA 3VLVA 5AA3A 2RC9A 5ISUA 4UACA 4I40A 3CFZA 4YU0A 3FV1A 2XWKA 4F1VA 5CC2A 5I59B 2XXQA 4AQ4A 1B5IA 3KN8A 2V3TA 1DSNA 1ZLQA 1JW1A 2H99A 3A3UA 4WKMA 1GGGA 1FPJA 3UIFA 2KR0A 2HAVA 3FUZA 4G68B 2W7YA 3N6TA 2O7UA 4MLQA 3DP4A 4ONYA 3IFAA 3MW0A 4P3LA 4ND9A 1A54A 5TPAB 2I3WA 5HPQA 1MPCA 3RN8A 1XHYA 3MPKA 4H1XA 1DTGA 1LBBA 2GRVA 1OLAA 3EHSA 2F6GA 1KA0A 3PUZE 1QUJA 1FBDA 1MH4A 1FPEA 5ICTA 1NMUA 4QFKA 4DXBA 2XXRA 3SDFA 1QULA 2V3QA 2HZKA 4PFIA 4MX6A 3UORA 3TTNA 5LOMA 4U1OA 1AWBA 3CSBA 4U2RA 1P1QA 5IZ3B 3S4UA 2ZXTA 4DE8A 1EYKA 4P9KA 4OWDA 3M3KA 1DMBA 1KA1A 1YCJA 1B46A 5AA4B 3I6VA 1IXHA 1B4HA 4KXPA 3MZ9A 4OXVA 2GQ1A 4RXLA 2KQZA 3N94A 1NNPA 1FW0A 2VHAA 1KZ8A 1EZPA 3QUJA 4IO3A 1QJMA 3N6UA 1LFIA 4NF8B 1LLSA 3IOUA 1NV4A 1PC3A 1K9YA 2H25A 3TKDA 4N17A 1NV3A 3RTWB 4JWOA 4C1UA 3EQ1A 3TQWA 1MPDA 5DT6A 2CMOA 3UP9A 2VPNA 1AMFA 3CFXA 4G77A 5H8FB 5IZ1A 3G3GA 3PV0E 4F39A 1UQWA 2O6AA 4LZ8A 2IA4A 5TU0A 3RY3A 4F18A 4P47A 2Z8EA 1SDXA 2CZKA 3UGWA 4QFNA 4HE0A 4ECFA 1INPA 4NN3A 4ZZEA 1D9QA 1NFTA 2H98A 1UTHA 4NGUA 5CBRA 1B0LA 4NTLA 3TODA 4F22A 1NL5A 3T9XB 4LUBA 1B6HA 4PFTA 1ANFA 2OBGA 3KJ7A 2WBBA 3BBRA 2FNCA 4OESA 4PCDA 1MY0A 3RGYA 1N3WA 4I8CA 4UA8A 4E0WA 5JTYA 2Q8JA 1NI9A 5H8SA 3S9NC 2PVUA 1LB9A 4KD5A 2FA7A 2F3BA 1Y3NA 4UABA 4JWYA 3TAJA 5CMBA 4G61A 3RUMA 1IMEA 2DWJA 4JVCA 4GX4A 5H8HA 4G8NA 3VE1B 1MXWA 1G0HA 4LQ5A 3O2AA 4DIGA 3O29A 3MVXA 1NNKA 3TFLA 5ET8A 3JZJA 2REGA 4QFOA 4I3EA 3IL1B 2F97A 2DXYA 3E3KA 4PAIA 3FXQA 2AL4A 3WAEA 4GRKA 4PGNA 4P56A 2QRYA 4JVDA 1DBZA 5L8DA 5FHNA 1TWYA 4PFWA 1Y3QA 3SKPA 3E9XA 1B52A 3KC0A 2D5WA 2THIA 2F35A 4RPNA 3T66A 4PP0A 4EUOA 1DCUA 1MQHA 2Z8FA 4IB2A 3OENA 1SD3A 5FHMA 3U92A 2O1MA 4GXSB 3VVDA 3VDFA 4MIJA 3MP1A 3GZGA 5I56B 5EHSA 3O28A 3Q27A 3RT6B 1LSTA 5F7VA 1OMPA 3OSQA 4JB7A 2ONRA 4P8BA 3OD7A 3U8QA 4XF5A 1MY1A 4AS4A 1SW1A 4F3BA 1M5BA 1OVBA 1FPLA 3D4CA 2Y7PA 3HSTA 5A5XA 2UVJA 3RTFB 1B9JA 3H06B 1BK4A 4FBPA 2FVZA 4I62A 2XXIA 3R6UA 1MRPA 4NG7A 5IKBA 4PETA 3OSRA 4ELOA 2L5VA 2RC8A 1FPIA 3C35A 3FBPA 2ZYMA 3G3IA 1ATGA 5H8QA 3MAMA 2WEFA 4YAHX 2UVHA 2VT5A 3SEUA 1NUWA 1US4A 3O9PA 3M3FA 4F29A 1B1HA 3KSJA 3KSXA 2V84A 3H6UA 4YZZA 4NF0A 1MDP1 4RA1A 4X1BA 4IO5A 4JSDA 5L9SA 3IAZA 3E78A 5F24A 2V3UA 4FEDA 2DXRA 3FVNA 1FBFA 3SETA 4KR5A 2ANJA 1NUYA 4LONB 2ZNSA 1DK4A 4I1DA 3SEWA 3D1RA 2P2AA 1FTJA 2ZMBA 2O1LA 3RT8A 5LDZA 3HHFA 3QMFA 3IK6B 4GBVA 1IXGA 2HHMA 1MQGA 3CVGA 3IOVA 5I57A 4GL8A 5I3SA 2JJKA 3GBBA 3KN3A 4GWZA 5CMMA 5J16A 4OERA 4GVOA 2XX9A 4WEPA 3FASA 2Z8DA 4IO4A 3FJGA 4R6KA 3MP6A 5DYHA 2ZNUA 2DVCA 5DEXB 4PQJA 4TLMB 4O7MA 3VV5A 1FJ6A 2I58A 5L9MA 1XOCA 4FJPA 4U21A 2G29A 1S50A 3VFJA 3ZSFA 3KZGA 4F1YA 4F1UA 2MKZA 1USYH 3DM0A 4H67A 1IMBA 1MS7A 4QBAA 1AOVA 3F11A 4GBWA 1FQBA 3CFLA 1P99A 3PUWE 2WX9A 4OVJA 2BJJX 5FTIA 1A8EA 1N3XA 1FBHA 1PB8A 2FYIA 2OZZA 4ZEBA 3UK4A 2KLFA 2DE4A 1M5EA 4N13A 2M8CA 5EHMA 3V5AA 4KI0E 2F34A 3PPOA 2DDKA 1SI1A 4RYAA 4KYEA 1P1OA 4QSCA 1RKMA 2WBDA 4N91A 1UTHB 1B4ZA 1S7YA 4F2OA 1Z7ME 3OXNA 3IO6A 2GHAA 3MP8A 4N4UA 4QRZA 3G7WA 3SEVA 2H4IA 4E0XA 4BDOA 1ZBMA 4MNCA 2HFBA 5I2KB 3MSTA 4ZE8A 2ABHA 1ZMGA 2HXWA 3PD9A 2VD2A 4O3BA 2Q2CA 3HHGA 2OLBA 1TFAA 1MM6A 4YKKA 2Y5LA 5AE4A 3ILTB 4THIA 3USDA 4XFEA 3U93A 4EQBA 4IO7A 3TTRA 2QS3A 4FE8A 3KBZA 4WEDA 5I2NA 4KYDA 3V83A 4GLIA 5H8HB 1LBXA 2BJIA 1NUXA 4OENA 1HSEA 4RNSA 1NUZA 4NAPA 3E13X 4PGPA 1M5FA 4RK9A 4R72A 5AA2A 1EZ9A 2E0SA 1N7XA 3TTLA 1II5A 2AIXA 2B4LA 3QUFA 1EYIA 4PAKA 1VFDA 3TUSA 1H43A 4KHZE 1DPEA 4YB5A 3PUYE 3MWBA 4DI3D 2F7AA 4H6DA 4EXLA 1JEVA 1A99A 3RYDA 4QFPA 5EQ9A 4MMPA 1B7ZA 1IMCA 2H5YA 4IR8A 1B1XA 1FBEA 5ET7A 2HAUA 2ZYOA 1IZ1A 3VVEA 3IJXB 3CR9A 1XC1A 4YMBA 4I3YA 4JVIA 1LAFE 2VD3A 5AA1A 3KOTA 1FQCA 2PBWA 5I84A 5KDTA 3PMVA 1IMDA 3O97A 1ZKBA 3Q26A 3ISPA 3ONMA 4N81A 3U65A 1B3EA 3I5OA 3MQ9A 1P1UA 1F9BA 1NV1A 2E1SA 4NMYA 3RPWA 1OLCA 4Z0IA 4LZ7A 4OQOA 3TTMA 3BIHA 2Y7WA 1JQFA 2DP8A 1IUDA 2DWIA 4OA4A 2B4MA 2YJPA 3PU5A 5A5XB 3K00A 4DDDA 3DP8A 1DPPA 3EN3A 5IGAA 1LB8A 1PB7A 3KGCA 4JSOA 1MY2A 3ROJA 4G4PA 2F36A 2XXKA 1B7HA 3LUYA 2PT1A 3PD8A 3W9WA 1LAHE 5DTBA 3EF7A 1CNQA 5H8QB 4M4GA 5I58B 1JEUA 2OWTA 1YPNA 2ZYKA 3VLUA 1MPBA 5TP9B 1JVXA 3K1PA 3KJTA 4PF6A 4O3CA 3PUVE
chains in the Genus database with same CATH topology
3LV0A 4H46A 4P8BA 2PCRA 4XF5A 4AS4A 4MAGA 4N15A 1G0IA 1NV2A 1FSAA 1FPLA 2XA5A 5EYGA 4AS5A 4PC9A 5T3JA 1XI6A 2CZIA 2VPOA 4H45A 4HCWA 4GWWA 4GWXA 4GX3A 1LBVA 1BK4A 4FBPA 1LBZA 4MEVA 2FVZA 5I5PA 4NG7A 4PETA 2FIXA 2L5VA 3E79A 5ET6A 3A29A 3B50A 1FPIA 4M1VA 4MHFA 4PFRA 3FBPA 4PBHA 2CEYA 4HCYA 4MNPA 4X8RA 3BIGA 5ET5A 3LUZA 2WEFA 1EYJA 2VT5A 5LTCA 3RPLA 1NUWA 2P3NA 3T0JA 1IMFA 5FBPA 4HXVA 4YZZA 4GWSA 4NF0A 2WYPA 4N8GA 3IFCA 2DE3A 2XWOA 3E78A 5F24A 5EQAA 1FBFA 1LBYA 4N8YA 2HPGA 1NUYA 1DK4A 1YYZA 4NQ8A 3D1RA 4F19A 1VDWA 1FPFA 1RDYA 4P1EA 5EQ8A 1LEVA 2QVRA 4PAFA 5LDZA 3QMFA 1QGXA 4GBVA 4MNIA 2HHMA 2Q9TA 3FXBA 4PTKA 4GX6A 1FBGA 5I3SA 2JJKA 4GWZA 1YXIA 4I40A 5J16A 5EYHA 2XWKA 4F1VA 4OVSA 3T1BA 5A5LA 1FPJA 2KR0A 4O7MA 4LN5A 4PDHA 1FJ6A 2R8TA 4HE1A 3IFAA 4P3LA 5J1DA 3B8BA 4F1UA 2MKZA 1IMBA 4GWUA 4QBAA 2FHYA 2XWVA 4PFBA 1YZ0A 2QPQA 4GBWA 2OX3A 1KA0A 1FPGA 2WX9A 1FBDA 5ESYA 4GWYA 1FRPA 1IMAA 3KC1A 1FPEA 2V3QA 2HZKA 2XWIA 4PFIA 1FBHA 4MX6A 2Q74A 1AWBA 2V4CA 2DE4A 5IZ3B 1EYKA 4P9KA 4NX1A 1NV5A 1KA1A 1RDZA 2DDKA 4KXPA 2F5XA 2GQ1A 1LBWA 2WBDA 2KQZA 4N91A 4HE2A 1KZ8A 5I7IA 2DE2A 2CEXA 4N4UA 1NV6A 4MNCA 1NV4A 1K9YA 3MSTA 4NHBA 4N17A 1K9ZA 1NV3A 4N6KA 5IZZA 2FIEA 4MJOA 4OVPA 3CHGA 2Y5KA 2Y5LA 2VPNA 4MCOA 4XFEA 3PTYA 3EKIA 4PF8A 5IZ1A 5IZ3A 3KBZA 4PDDA 4F18A 4P47A 5EQ7A 2CZKA 1LBXA 4HE0A 1INPA 4NN3A 2ZZVA 1D9QA 2BJIA 4OVQA 1NUXA 4NGUA 4PBQA 4N6DA 1NUZA 4NAPA 4PGPA 1FJ9A 1Q9DA 3HFUA 5DW8A 2B4LA 2DVZA 1EYIA 2WBBA 4YICA 4PAKA 4P1LA 1RDXA 2F3DA 1FPDA 4PCDA 3GYYA 4O8MA 4DI3D 2ZZWA 2HZLA 1NI9A 3RYDA 5EQ9A 2F3BA 4OANA 3SZPA 1FBPA 1NV0A 4MMPA 4UABA 1IMCA 1JP4A 4QXDA 4IR8A 1FBEA 4G61A 5ET7A 4OVRA 4O7IA 3W9VA 2OWZA 2PFYA 4I3YA 2P3VA 3NOHA 4JVIA 2CZHA 1IMEA 4JVCA 4O94A 4GX4A 1IMDA 4PE3A 1G0HA 3ISPA 4N81A 3U65A 2Q8MA 1NV1A 5ET8A 4X04A 4I3EA 5IM2A 4PAIA 1SPIA 4DI4B 3BIHA 2HXRA 4PGNA 4P56A 4JVDA 4XEQA 2QFLA 1FBCA 1DBZA 4OVTA 4OA4A 2B4MA 2WYKA 3KC0A 2PFZA 5IGAA 2ZZXA 2QVUA 1FPBA 5CM6A 3MYUA 2FBPA 3ROJA 1FTAA 1DCUA 5JK4A 2QVVA 2XXKA 3W9WA 1NV7A 1CNQA 4MIJA 4X9TA 3RPLB 4PF6A 1FPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LV0 A;  2QVR A;  5LDZ A;  1NV5 A;  3QMF A;  1KA1 A;  4H46 A;  1RDZ A;  2DDK A;  1QGX A;  1NI9 A;  4GBV A;  3RYD A;  2PCR A;  4KXP A;  2HHM A;  4AS4 A;  5EQ9 A;  1FPK A;  2F3B A;  2GQ1 A;  1FBP A;  1NV0 A;  1IMC A;  1JP4 A;  4QXD A;  1LBW A;  2WBD A;  4IR8 A;  1G0I A;  1NV2 A;  1FBE A;  4G61 A;  5ET7 A;  1FSA A;  4O7I A;  4PTK A;  4GX6 A;  1FPL A;  1FBG A;  5EYG A;  4HE2 A;  2OWZ A;  5I3S A;  4AS5 A;  1KZ8 A;  2P3V A;  4I3Y A;  2JJK A;  1XI6 A;  5T3J A;  2CZH A;  4GWZ A;  1IME A;  1YXI A;  2CZI A;  4I40 A;  5J16 A;  4H45 A;  4GWW A;  4GWX A;  5EYH A;  4GX3 A;  1IMD A;  1LBV A;  4GX4 A;  1BK4 A;  1NV6 A;  4FBP A;  1LBZ A;  1G0H A;  2FVZ A;  1NV4 A;  4N81 A;  1K9Y A;  5A5L A;  1K9Z A;  1NV3 A;  1FPJ A;  2Q8M A;  1NV1 A;  2FIX A;  5ET8 A;  5ET6 A;  3A29 A;  4I3E A;  1FPI A;  2FIE A;  4MJO A;  3FBP A;  2Y5K A;  2Y5L A;  1FJ6 A;  3BIG A;  1SPI A;  2R8T A;  3BIH A;  5ET5 A;  3LUZ A;  2WEF A;  1EYJ A;  4HE1 A;  5IZ1 A;  2VT5 A;  3IFA A;  3RPL A;  1NUW A;  5IZ3 A;  3B8B A;  2P3N A;  1FBC A;  1DBZ A;  2QFL A;  3T0J A;  1IMF A;  3KBZ A;  1IMB A;  4GWU A;  5FBP A;  5EQ7 A;  2FHY A;  3KC0 A;  4HXV A;  4GWS A;  2CZK A;  1YZ0 A;  1LBX A;  2OX3 A;  4GBW A;  2QVU A;  1FPB A;  4HE0 A;  5EQ8 A;  3IFC A;  1INP A;  2FBP A;  1D9Q A;  1KA0 A;  1FPG A;  2BJI A;  1NUX A;  5F24 A;  3ROJ A;  1FTA A;  1FBD A;  1DCU A;  5EQA A;  5ESY A;  4GWY A;  1FRP A;  1NUZ A;  1IMA A;  2QVV A;  1FJ9 A;  1FBF A;  3KC1 A;  1FPE A;  1LBY A;  1NV7 A;  1Q9D A;  1CNQ A;  1NUY A;  5DW8 A;  1FBH A;  1DK4 A;  1YYZ A;  1EYI A;  2WBB A;  3D1R A;  2Q74 A;  1AWB A;  1VDW A;  1FPF A;  3RPL B;  1RDY A;  5IZ3 B;  1RDX A;  2F3D A;  1FPD A;  1EYK A;  1LEV A; 
#chains in the Genus database with same CATH topology
 2YLN A;  4H46 A;  3RNN A;  1LCF A;  3TDJ A;  1IEJ A;  4MAG A;  4MLV A;  4BDR A;  5DVI A;  1G0I A;  1J1N A;  4XKQ A;  2VP1 A;  4I9D A;  2NUV A;  3HV1 A;  4PC9 A;  1XI6 A;  1Q35 A;  2VPO A;  2XXY A;  4JDF A;  3V89 B;  3OEM A;  4EDP A;  4MEV A;  1N0T A;  5I5P A;  1ZIU A;  4OFL A;  3H03 A;  5HBC A;  3E79 A;  3A29 A;  1MQJ A;  4PBH A;  2F78 A;  4HCY A;  4YKP A;  3DP6 A;  3BIG A;  3K4U A;  1QKB A;  3IB2 A;  2H9B A;  4OET A;  4NF6 B;  1D9V A;  1EYJ A;  3B6T A;  1I6Q A;  2HEU A;  2XD2 A;  2I0C A;  3OO6 A;  5I57 B;  3CI8 A;  3FV2 A;  3OOA A;  4YB7 A;  5I59 A;  4P11 A;  4HXV A;  4IO6 A;  4GWS A;  3I3V A;  4NED A;  1VR5 A;  1DOT A;  1I69 A;  5ELV A;  1MQD A;  4R6H A;  3W15 C;  3SER A;  1XS5 A;  2OK2 A;  4BLA A;  2Q89 A;  4H5G A;  3KN7 A;  2ESN A;  4N8Y A;  1LAX A;  2I4B A;  3B6W A;  4NQ8 A;  4ZEK A;  3KG2 A;  1VDW A;  1FPF A;  3QAX A;  1RDY A;  4P1E A;  4DZ1 A;  3IOW A;  4GWO A;  3TQL A;  1UTB A;  1R9Q A;  4EF1 A;  5ITP A;  4MNI A;  4PFU A;  3UA8 A;  4NF4 A;  2I49 A;  5DVF A;  1NKX A;  4GX6 A;  2QMW A;  1FBG A;  5KCJ A;  2ONS A;  2AL5 A;  3R7X A;  4KFQ A;  4OVS A;  2XHD A;  2VGQ A;  4K3F A;  5A5L A;  3CG3 A;  4KPT A;  1BLF A;  1LFG A;  3KBR A;  4FIM A;  4LZ5 A;  4JBZ A;  4LN5 A;  4OEV A;  4PDH A;  3MZ1 A;  1H45 A;  2R8T A;  4NWD A;  3A09 A;  3OEL A;  1B3L A;  4HE1 A;  1I6A A;  2QL3 A;  3GXA A;  3IJO B;  3TZA A;  3Q25 A;  4ZS9 A;  5J1D A;  3B8B A;  4GD5 A;  3H6V A;  4OYV A;  2AYS A;  1MG1 A;  1TT1 A;  1B0H A;  2R71 A;  4QFL A;  1B2H A;  2FHY A;  2XWV A;  1FCK A;  3FD3 A;  4F31 B;  4PFB A;  5L9O A;  4LAT A;  1YZ0 A;  2QPQ A;  3KFM A;  3S9L C;  4ISU A;  4ELR A;  2UVI A;  1MQI A;  4G2Z A;  1A55 A;  1BP5 A;  4GWY A;  1IMA A;  2A5T A;  2ZNT A;  1JVY A;  3ECR A;  3IO4 A;  1NNT A;  3B7D A;  2XWI A;  3S9M C;  2NXO A;  2OPD A;  1P1N A;  4IO2 A;  1A40 A;  3P7I A;  2ZYN A;  4F3P A;  4FEB A;  3CSG A;  5CMC A;  5I2N B;  3K6U A;  3Q29 A;  4NX1 A;  4OMB A;  1NV5 A;  5M2V A;  1RDZ A;  2X7P A;  4U22 A;  4GXA A;  1NH7 A;  2F5X A;  3TEP A;  3EPE A;  2CZL A;  2PX1 A;  3S2V A;  5B7D A;  2Y84 A;  1YAE A;  1AL3 A;  4YMA A;  5ITO A;  5I7I A;  3LR1 A;  3PPN A;  1Y1Z A;  2DE2 A;  2CEX A;  1MY3 A;  1NV6 A;  4XXU A;  3G3J A;  3OEK A;  3JV9 A;  3V8X B;  4U4S A;  1XVY A;  3C32 A;  3CRB A;  1K9Z A;  4FAT A;  3FJ7 A;  3K02 A;  2F7B A;  4HW8 A;  1B51 A;  4TLL B;  5IZZ A;  3RQT A;  2FIE A;  3LSF B;  5FHO A;  4OVP A;  2Y5K A;  5DVJ A;  1UIV A;  3C36 A;  4G68 C;  4MCO A;  4ZEF A;  1Y20 A;  3PTY A;  4KCC A;  4PF8 A;  2IEE A;  4ELQ A;  3K6X A;  1B3H A;  2O51 A;  1FTO A;  3MVY A;  2Q88 A;  3LC8 A;  2RC7 A;  5EQ7 A;  1IIT A;  5KDT B;  2REJ A;  1NH8 A;  1HSL A;  3CG1 A;  4H65 A;  3VXB A;  4ZE9 A;  1A7L A;  4WXJ A;  2ZZV A;  1WVJ A;  4OVQ A;  3K0V A;  3C9H A;  3G3F A;  4GIZ A;  4Q8R A;  4PBQ A;  3QYT A;  3O6I A;  1FJ9 A;  1XVX A;  4PFY A;  2R6G E;  2OWS A;  3CIJ A;  1Q9D A;  1RYO A;  3T9H B;  1OQH A;  5DW8 A;  2X7Q A;  2DVZ A;  3JYR A;  4XTC Q;  4YIC A;  3HO7 A;  3AXF A;  4MF3 A;  4P1L A;  1RDX A;  2Z22 A;  4R74 A;  1FPD A;  2RIN A;  2I6E A;  4YKJ A;  3TCH A;  2QSX A;  2DYX A;  3FXR A;  4R73 A;  4GQO A;  4DCX A;  2HZL A;  2OPE A;  1BTJ A;  3FVO A;  4RPO A;  4R9F A;  1OIB A;  3SZP A;  3MVZ A;  1NV0 A;  2P0S A;  4QXD A;  4EF2 A;  3O6H A;  3FXU A;  3MVW A;  4O7I A;  3TPA A;  1B7U A;  3W9V A;  3PUX E;  2OWZ A;  2PFY A;  2PYY A;  3NOH A;  2P3V A;  3ODB A;  1JET A;  1Y4C A;  4PE3 A;  4XKR A;  1DTZ A;  1H76 A;  3G3H A;  1D4N A;  4NWC A;  1QKA A;  3FVK A;  4P0I A;  1WOD A;  5IM2 A;  2UXA A;  1BIY A;  4R6Y A;  1TXF A;  3E4R A;  1SPI A;  3O66 A;  4QHQ A;  4GFR A;  2HXR A;  1Y1M A;  3SEY A;  1Y4T A;  3OO9 A;  1MXX A;  1EZO A;  5F1Q A;  2RCA A;  3H7M A;  4XEQ A;  1FBC A;  4IGT A;  1MXV A;  1SI0 A;  2B3B A;  2XXH A;  2WYK A;  3K1M A;  3TCF A;  5CBS A;  3FVG A;  4H8I A;  4P0G A;  2ZZX A;  4ZEI A;  2QVU A;  1FPB A;  5JTY B;  1FQF A;  1T0K A;  3MYU A;  2HQ0 A;  4MH5 A;  3ILU B;  1FTA A;  4RK2 A;  4XKP A;  5H8N A;  1IXI A;  5JK4 A;  2QVV A;  3U72 A;  3C4M A;  5CI5 A;  1GR2 A;  1R1N A;  1EU8 A;  3T96 B;  1NV7 A;  1SBP A;  3N26 A;  4EQ9 A;  4X9T A;  1AIV A;  1PEB A;  2UYF A;  2O84 X;  3N5L A;  2XXV A;  4PDD A;  1FPK A;  3QK6 A;  4OEU A;  4R2B A;  2PCR A;  2B3F A;  1QUK A;  4DCY A;  2OCU A;  4NE4 A;  3T9V A;  1MY4 A;  1LFH A;  1NV2 A;  1IXC A;  3C33 A;  4LP2 B;  5EYG A;  1VFE A;  3MPL A;  3MJN A;  4EQ7 A;  4KCD A;  2CZI A;  1N76 A;  4GWW A;  4GWX A;  3BFT A;  4JWX A;  1LBZ A;  1QUI A;  1Z7N E;  5ICQ A;  1URD A;  3ZS6 A;  3LSL A;  4X1D A;  2FIX A;  5ET6 A;  2YPN A;  4M1V A;  4MHF A;  4U23 A;  4PFR A;  4Z7E A;  1UTB B;  4N6P A;  4DLD A;  3C34 A;  3U1O A;  1SVX B;  1B3G A;  4X8R A;  3IB1 A;  5ET5 A;  4MBP A;  4KQP A;  1B58 A;  3VXC A;  4F2Q A;  3G3K A;  5LTC A;  1NNF A;  2Z23 A;  3RPL A;  4NF4 B;  4H5F A;  2P3N A;  4POX A;  1BKA A;  1IMF A;  4HS7 A;  4TQU Q;  5KCJ B;  1XT8 A;  1B32 A;  3MZB A;  1ELJ A;  1Y3P A;  3LSX A;  2WYP A;  3GLB A;  1FTM A;  3IFC A;  2DE3 A;  2XXP A;  1JW4 A;  4OFO A;  4TOZ A;  5DEX A;  2GHB A;  5EQA A;  1N7W A;  1URS A;  3BKI B;  4N07 A;  1ZTY A;  4POW A;  2QS2 A;  4DXU A;  2O7I A;  1CB6 A;  4OZ9 A;  4NF5 A;  1YYZ A;  1R9L A;  4F19 A;  3H3G A;  3KEI A;  1D3K A;  4XKN A;  2NVU B;  4PAF A;  1D9Y A;  3DEL B;  1QGX A;  5CRY A;  2NOO A;  2Q9T A;  2PMS A;  4C0R A;  4R9G A;  1YTV A;  4OTE A;  2F8D A;  4RY1 A;  2A5T B;  1YXI A;  1SYI A;  5EYH A;  3EHT A;  4OFJ A;  3TCG A;  3T1B A;  3QIM A;  3PPP A;  3RLF E;  2QJE A;  1S9T A;  3TEL A;  2Y7I A;  1SYH A;  2DQV A;  4R75 A;  1MDQ A;  3H4Z A;  1P1W A;  5IAI A;  2F7C A;  2WKY A;  3HN0 A;  4GWU A;  5I2K A;  4Q5T A;  2OX3 A;  2RF1 A;  3K2D A;  2DOJ A;  3PPQ A;  2LAO A;  3HCQ A;  1FPG A;  3PMX A;  5ESY A;  1Y9U A;  1FRP A;  3KC1 A;  4AB5 A;  1N84 A;  1I6B A;  1MM7 A;  5B70 A;  4XIG Q;  3OMB A;  2PT2 A;  3Q28 A;  1PBQ A;  1M5D A;  2Q74 A;  1ZU0 A;  2V4C A;  1B5H A;  4G8M A;  3A3C A;  1H3D A;  3L6G A;  1B5J A;  3IB0 A;  3T22 A;  4HTG A;  4QSD A;  4G68 A;  2G93 A;  1LGB C;  3C31 A;  3TTK A;  1UIU A;  3LSW A;  1VE4 A;  4YKI A;  1LBW A;  2X26 A;  4FAJ A;  4HE2 A;  5TPA A;  4H8J A;  3WAF A;  4IY6 A;  1VSO A;  2V93 A;  2D21 A;  5BUU A;  2ONK E;  4IGR A;  4NHB A;  4N6K A;  1POT A;  4MJO A;  4BDQ A;  1N04 A;  1M5C A;  3CHG A;  4Q0C A;  1O7T A;  1FTK A;  1FQD A;  3EKI A;  1GV8 A;  2GFE A;  5IZ3 A;  2UYE A;  3QSL A;  2Y7R A;  4GOT A;  4F3G A;  1SQY A;  3UN6 A;  3VLW A;  1A8F A;  5AA4 A;  3PGF A;  4PE5 B;  3PMW A;  1FQA A;  5HM4 B;  1CE2 A;  2D3I A;  3OO7 A;  4R2F A;  3EHU A;  4N6D A;  3MUQ A;  4EXK A;  1IQ7 A;  1MXU A;  2RCB A;  3HFU A;  4LQ2 A;  2XD3 A;  4NF8 A;  1L5T A;  3FZV A;  2DSF A;  4ZDM A;  2XXW A;  4QSE A;  2F3D A;  2I48 A;  3GYY A;  3HPI A;  1QVS A;  3R26 A;  4O8M A;  2ZZW A;  3FJM A;  3MBP A;  4ZED A;  2DWH A;  5H8F A;  2QMX A;  4OAN A;  1FBP A;  2DS9 A;  1POY 1;  3H6W A;  1JP4 A;  2I3V A;  1GVC A;  1US5 A;  4OVR A;  2XXT A;  5H8N B;  3THI A;  5BWJ A;  4IY5 A;  1JW5 A;  2QS4 A;  4QF9 A;  3FAT A;  2CZH A;  2A5S A;  5I58 A;  3GBA A;  2XXX A;  4O94 A;  3QXM A;  5TP9 A;  3O6G A;  3K1N A;  5JEI A;  1OVT A;  4U4X A;  2I4C A;  3M8U A;  5KZT A;  4BDM A;  5CMK A;  1SW4 A;  4G8H A;  1KWH A;  2Q8M A;  3K01 A;  4X04 A;  2Q2A A;  3K6V A;  4DI4 B;  2XX7 A;  3FGS A;  5AA2 B;  3S9E A;  1OQG A;  2QS1 A;  2ALU A;  1GTK A;  3IX1 A;  2QFL A;  1AH5 A;  4OVT A;  2NWJ A;  4KYS A;  1SW2 A;  1EH3 A;  1O63 A;  2PFZ A;  1MH3 A;  4L17 A;  1MXZ A;  3FIR A;  5CM6 A;  3SES A;  2I0B A;  2FBP A;  1FQE A;  3K6W A;  4Q30 B;  2UVG A;  3MC2 A;  2V25 A;  3PPR A;  3ZKK A;  4NF6 A;  4ELP A;  4AB6 A;  3BFU A;  4FOR A;  4FEC A;  4F3S A;  2Y7K A;  1SW5 A;  3RPL B;  3TYH A;  4ZEC A;  4JXI A;  4H0W A;  2VOZ A;  1LAG E;  3LV0 A;  4RJZ A;  4GL0 A;  5K2X A;  4N15 A;  1B05 A;  5AA2 D;  3TMG A;  4LA9 A;  3IOT A;  2B65 A;  1QW0 A;  2F6P A;  3H6T A;  1FSA A;  1ZJL A;  3KOS A;  4ESX A;  2P1S A;  2XA5 A;  4AS5 A;  5T3J A;  3U94 A;  1FTL A;  3B6Q A;  4H45 A;  4HCW A;  4GX3 A;  1LBV A;  1WDN A;  4NF5 B;  5EYF A;  3SEX A;  1URG A;  1H44 A;  4MFI A;  3L6H A;  3B50 A;  4GF8 A;  1JNF A;  2CEY A;  1USY E;  1IIW A;  1PBP A;  2O69 A;  4MNP A;  4DXC A;  4O3A A;  3LUZ A;  5I56 A;  3OO8 A;  1Q1K A;  4LVQ A;  4OHN A;  2XXU A;  3T0J A;  4BDL A;  4X48 A;  5FBP A;  3M3L A;  3D4G A;  3IOR A;  1MXY A;  4N8G A;  1PDA A;  1O64 A;  1LBC A;  3VVF A;  2DWA A;  2XWO A;  1LCT A;  4C1T A;  4ZZA A;  4BDN A;  2GH9 A;  1LBY A;  5FTH A;  1B3F A;  2HPG A;  2O68 A;  3T93 B;  5K2Y A;  2RKM A;  1TFD A;  1RYX A;  5EQ8 A;  2XX8 A;  1LEV A;  3IR1 A;  2QVR A;  1R6Z A;  2R9J A;  2OJT A;  4U1Z A;  1PB9 A;  3ZKL A;  2HCA A;  3DLN A;  3FXB A;  4YB6 A;  4ESW A;  1B40 A;  3LBS A;  1HSJ A;  3T9U A;  4PTK A;  3VLV A;  5AA3 A;  2RC9 A;  5ISU A;  4UAC A;  4I40 A;  3CFZ A;  4YU0 A;  3FV1 A;  2XWK A;  4F1V A;  5CC2 A;  5I59 B;  2XXQ A;  4AQ4 A;  1B5I A;  3KN8 A;  2V3T A;  1DSN A;  1ZLQ A;  1JW1 A;  2H99 A;  3A3U A;  4WKM A;  1GGG A;  1FPJ A;  3UIF A;  2KR0 A;  2HAV A;  3FUZ A;  4G68 B;  2W7Y A;  3N6T A;  2O7U A;  4MLQ A;  3DP4 A;  4ONY A;  3IFA A;  3MW0 A;  4P3L A;  4ND9 A;  1A54 A;  5TPA B;  2I3W A;  5HPQ A;  1MPC A;  3RN8 A;  1XHY A;  3MPK A;  4H1X A;  1DTG A;  1LBB A;  2GRV A;  1OLA A;  3EHS A;  2F6G A;  1KA0 A;  3PUZ E;  1QUJ A;  1FBD A;  1MH4 A;  1FPE A;  5ICT A;  1NMU A;  4QFK A;  4DXB A;  2XXR A;  3SDF A;  1QUL A;  2V3Q A;  2HZK A;  4PFI A;  4MX6 A;  3UOR A;  3TTN A;  5LOM A;  4U1O A;  1AWB A;  3CSB A;  4U2R A;  1P1Q A;  5IZ3 B;  3S4U A;  2ZXT A;  4DE8 A;  1EYK A;  4P9K A;  4OWD A;  3M3K A;  1DMB A;  1KA1 A;  1YCJ A;  1B46 A;  5AA4 B;  3I6V A;  1IXH A;  1B4H A;  4KXP A;  3MZ9 A;  4OXV A;  2GQ1 A;  4RXL A;  2KQZ A;  3N94 A;  1NNP A;  1FW0 A;  2VHA A;  1KZ8 A;  1EZP A;  3QUJ A;  4IO3 A;  1QJM A;  3N6U A;  1LFI A;  4NF8 B;  1LLS A;  3IOU A;  1NV4 A;  1PC3 A;  1K9Y A;  2H25 A;  3TKD A;  4N17 A;  1NV3 A;  3RTW B;  4JWO A;  4C1U A;  3EQ1 A;  3TQW A;  1MPD A;  5DT6 A;  2CMO A;  3UP9 A;  2VPN A;  1AMF A;  3CFX A;  4G77 A;  5H8F B;  5IZ1 A;  3G3G A;  3PV0 E;  4F39 A;  1UQW A;  2O6A A;  4LZ8 A;  2IA4 A;  5TU0 A;  3RY3 A;  4F18 A;  4P47 A;  2Z8E A;  1SDX A;  2CZK A;  3UGW A;  4QFN A;  4HE0 A;  4ECF A;  1INP A;  4NN3 A;  4ZZE A;  1D9Q A;  1NFT A;  2H98 A;  1UTH A;  4NGU A;  5CBR A;  1B0L A;  4NTL A;  3TOD A;  4F22 A;  1NL5 A;  3T9X B;  4LUB A;  1B6H A;  4PFT A;  1ANF A;  2OBG A;  3KJ7 A;  2WBB A;  3BBR A;  2FNC A;  4OES A;  4PCD A;  1MY0 A;  3RGY A;  1N3W A;  4I8C A;  4UA8 A;  4E0W A;  5JTY A;  2Q8J A;  1NI9 A;  5H8S A;  3S9N C;  2PVU A;  1LB9 A;  4KD5 A;  2FA7 A;  2F3B A;  1Y3N A;  4UAB A;  4JWY A;  3TAJ A;  5CMB A;  4G61 A;  3RUM A;  1IME A;  2DWJ A;  4JVC A;  4GX4 A;  5H8H A;  4G8N A;  3VE1 B;  1MXW A;  1G0H A;  4LQ5 A;  3O2A A;  4DIG A;  3O29 A;  3MVX A;  1NNK A;  3TFL A;  5ET8 A;  3JZJ A;  2REG A;  4QFO A;  4I3E A;  3IL1 B;  2F97 A;  2DXY A;  3E3K A;  4PAI A;  3FXQ A;  2AL4 A;  3WAE A;  4GRK A;  4PGN A;  4P56 A;  2QRY A;  4JVD A;  1DBZ A;  5L8D A;  5FHN A;  1TWY A;  4PFW A;  1Y3Q A;  3SKP A;  3E9X A;  1B52 A;  3KC0 A;  2D5W A;  2THI A;  2F35 A;  4RPN A;  3T66 A;  4PP0 A;  4EUO A;  1DCU A;  1MQH A;  2Z8F A;  4IB2 A;  3OEN A;  1SD3 A;  5FHM A;  3U92 A;  2O1M A;  4GXS B;  3VVD A;  3VDF A;  4MIJ A;  3MP1 A;  3GZG A;  5I56 B;  5EHS A;  3O28 A;  3Q27 A;  3RT6 B;  1LST A;  5F7V A;  1OMP A;  3OSQ A;  4JB7 A;  2ONR A;  4P8B A;  3OD7 A;  3U8Q A;  4XF5 A;  1MY1 A;  4AS4 A;  1SW1 A;  4F3B A;  1M5B A;  1OVB A;  1FPL A;  3D4C A;  2Y7P A;  3HST A;  5A5X A;  2UVJ A;  3RTF B;  1B9J A;  3H06 B;  1BK4 A;  4FBP A;  2FVZ A;  4I62 A;  2XXI A;  3R6U A;  1MRP A;  4NG7 A;  5IKB A;  4PET A;  3OSR A;  4ELO A;  2L5V A;  2RC8 A;  1FPI A;  3C35 A;  3FBP A;  2ZYM A;  3G3I A;  1ATG A;  5H8Q A;  3MAM A;  2WEF A;  4YAH X;  2UVH A;  2VT5 A;  3SEU A;  1NUW A;  1US4 A;  3O9P A;  3M3F A;  4F29 A;  1B1H A;  3KSJ A;  3KSX A;  2V84 A;  3H6U A;  4YZZ A;  4NF0 A;  1MDP 1;  4RA1 A;  4X1B A;  4IO5 A;  4JSD A;  5L9S A;  3IAZ A;  3E78 A;  5F24 A;  2V3U A;  4FED A;  2DXR A;  3FVN A;  1FBF A;  3SET A;  4KR5 A;  2ANJ A;  1NUY A;  4LON B;  2ZNS A;  1DK4 A;  4I1D A;  3SEW A;  3D1R A;  2P2A A;  1FTJ A;  2ZMB A;  2O1L A;  3RT8 A;  5LDZ A;  3HHF A;  3QMF A;  3IK6 B;  4GBV A;  1IXG A;  2HHM A;  1MQG A;  3CVG A;  3IOV A;  5I57 A;  4GL8 A;  5I3S A;  2JJK A;  3GBB A;  3KN3 A;  4GWZ A;  5CMM A;  5J16 A;  4OER A;  4GVO A;  2XX9 A;  4WEP A;  3FAS A;  2Z8D A;  4IO4 A;  3FJG A;  4R6K A;  3MP6 A;  5DYH A;  2ZNU A;  2DVC A;  5DEX B;  4PQJ A;  4TLM B;  4O7M A;  3VV5 A;  1FJ6 A;  2I58 A;  5L9M A;  1XOC A;  4FJP A;  4U21 A;  2G29 A;  1S50 A;  3VFJ A;  3ZSF A;  3KZG A;  4F1Y A;  4F1U A;  2MKZ A;  1USY H;  3DM0 A;  4H67 A;  1IMB A;  1MS7 A;  4QBA A;  1AOV A;  3F11 A;  4GBW A;  1FQB A;  3CFL A;  1P99 A;  3PUW E;  2WX9 A;  4OVJ A;  2BJJ X;  5FTI A;  1A8E A;  1N3X A;  1FBH A;  1PB8 A;  2FYI A;  2OZZ A;  4ZEB A;  3UK4 A;  2KLF A;  2DE4 A;  1M5E A;  4N13 A;  2M8C A;  5EHM A;  3V5A A;  4KI0 E;  2F34 A;  3PPO A;  2DDK A;  1SI1 A;  4RYA A;  4KYE A;  1P1O A;  4QSC A;  1RKM A;  2WBD A;  4N91 A;  1UTH B;  1B4Z A;  1S7Y A;  4F2O A;  1Z7M E;  3OXN A;  3IO6 A;  2GHA A;  3MP8 A;  4N4U A;  4QRZ A;  3G7W A;  3SEV A;  2H4I A;  4E0X A;  4BDO A;  1ZBM A;  4MNC A;  2HFB A;  5I2K B;  3MST A;  4ZE8 A;  2ABH A;  1ZMG A;  2HXW A;  3PD9 A;  2VD2 A;  4O3B A;  2Q2C A;  3HHG A;  2OLB A;  1TFA A;  1MM6 A;  4YKK A;  2Y5L A;  5AE4 A;  3ILT B;  4THI A;  3USD A;  4XFE A;  3U93 A;  4EQB A;  4IO7 A;  3TTR A;  2QS3 A;  4FE8 A;  3KBZ A;  4WED A;  5I2N A;  4KYD A;  3V83 A;  4GLI A;  5H8H B;  1LBX A;  2BJI A;  1NUX A;  4OEN A;  1HSE A;  4RNS A;  1NUZ A;  4NAP A;  3E13 X;  4PGP A;  1M5F A;  4RK9 A;  4R72 A;  5AA2 A;  1EZ9 A;  2E0S A;  1N7X A;  3TTL A;  1II5 A;  2AIX A;  2B4L A;  3QUF A;  1EYI A;  4PAK A;  1VFD A;  3TUS A;  1H43 A;  4KHZ E;  1DPE A;  4YB5 A;  3PUY E;  3MWB A;  4DI3 D;  2F7A A;  4H6D A;  4EXL A;  1JEV A;  1A99 A;  3RYD A;  4QFP A;  5EQ9 A;  4MMP A;  1B7Z A;  1IMC A;  2H5Y A;  4IR8 A;  1B1X A;  1FBE A;  5ET7 A;  2HAU A;  2ZYO A;  1IZ1 A;  3VVE A;  3IJX B;  3CR9 A;  1XC1 A;  4YMB A;  4I3Y A;  4JVI A;  1LAF E;  2VD3 A;  5AA1 A;  3KOT A;  1FQC A;  2PBW A;  5I84 A;  5KDT A;  3PMV A;  1IMD A;  3O97 A;  1ZKB A;  3Q26 A;  3ISP A;  3ONM A;  4N81 A;  3U65 A;  1B3E A;  3I5O A;  3MQ9 A;  1P1U A;  1F9B A;  1NV1 A;  2E1S A;  4NMY A;  3RPW A;  1OLC A;  4Z0I A;  4LZ7 A;  4OQO A;  3TTM A;  3BIH A;  2Y7W A;  1JQF A;  2DP8 A;  1IUD A;  2DWI A;  4OA4 A;  2B4M A;  2YJP A;  3PU5 A;  5A5X B;  3K00 A;  4DDD A;  3DP8 A;  1DPP A;  3EN3 A;  5IGA A;  1LB8 A;  1PB7 A;  3KGC A;  4JSO A;  1MY2 A;  3ROJ A;  4G4P A;  2F36 A;  2XXK A;  1B7H A;  3LUY A;  2PT1 A;  3PD8 A;  3W9W A;  1LAH E;  5DTB A;  3EF7 A;  1CNQ A;  5H8Q B;  4M4G A;  5I58 B;  1JEU A;  2OWT A;  1YPN A;  2ZYK A;  3VLU A;  1MPB A;  5TP9 B;  1JVX A;  3K1P A;  3KJT A;  4PF6 A;  4O3C A;  3PUV E; 
#chains in the Genus database with same CATH homology
 3LV0 A;  4H46 A;  4P8B A;  2PCR A;  4XF5 A;  4AS4 A;  4MAG A;  4N15 A;  1G0I A;  1NV2 A;  1FSA A;  1FPL A;  2XA5 A;  5EYG A;  4AS5 A;  4PC9 A;  5T3J A;  1XI6 A;  2CZI A;  2VPO A;  4H45 A;  4HCW A;  4GWW A;  4GWX A;  4GX3 A;  1LBV A;  1BK4 A;  4FBP A;  1LBZ A;  4MEV A;  2FVZ A;  5I5P A;  4NG7 A;  4PET A;  2FIX A;  2L5V A;  3E79 A;  5ET6 A;  3A29 A;  3B50 A;  1FPI A;  4M1V A;  4MHF A;  4PFR A;  3FBP A;  4PBH A;  2CEY A;  4HCY A;  4MNP A;  4X8R A;  3BIG A;  5ET5 A;  3LUZ A;  2WEF A;  1EYJ A;  2VT5 A;  5LTC A;  3RPL A;  1NUW A;  2P3N A;  3T0J A;  1IMF A;  5FBP A;  4HXV A;  4YZZ A;  4GWS A;  4NF0 A;  2WYP A;  4N8G A;  3IFC A;  2DE3 A;  2XWO A;  3E78 A;  5F24 A;  5EQA A;  1FBF A;  1LBY A;  4N8Y A;  2HPG A;  1NUY A;  1DK4 A;  1YYZ A;  4NQ8 A;  3D1R A;  4F19 A;  1VDW A;  1FPF A;  1RDY A;  4P1E A;  5EQ8 A;  1LEV A;  2QVR A;  4PAF A;  5LDZ A;  3QMF A;  1QGX A;  4GBV A;  4MNI A;  2HHM A;  2Q9T A;  3FXB A;  4PTK A;  4GX6 A;  1FBG A;  5I3S A;  2JJK A;  4GWZ A;  1YXI A;  4I40 A;  5J16 A;  5EYH A;  2XWK A;  4F1V A;  4OVS A;  3T1B A;  5A5L A;  1FPJ A;  2KR0 A;  4O7M A;  4LN5 A;  4PDH A;  1FJ6 A;  2R8T A;  4HE1 A;  3IFA A;  4P3L A;  5J1D A;  3B8B A;  4F1U A;  2MKZ A;  1IMB A;  4GWU A;  4QBA A;  2FHY A;  2XWV A;  4PFB A;  1YZ0 A;  2QPQ A;  4GBW A;  2OX3 A;  1KA0 A;  1FPG A;  2WX9 A;  1FBD A;  5ESY A;  4GWY A;  1FRP A;  1IMA A;  3KC1 A;  1FPE A;  2V3Q A;  2HZK A;  2XWI A;  4PFI A;  1FBH A;  4MX6 A;  2Q74 A;  1AWB A;  2V4C A;  2DE4 A;  5IZ3 B;  1EYK A;  4P9K A;  4NX1 A;  1NV5 A;  1KA1 A;  1RDZ A;  2DDK A;  4KXP A;  2F5X A;  2GQ1 A;  1LBW A;  2WBD A;  2KQZ A;  4N91 A;  4HE2 A;  1KZ8 A;  5I7I A;  2DE2 A;  2CEX A;  4N4U A;  1NV6 A;  4MNC A;  1NV4 A;  1K9Y A;  3MST A;  4NHB A;  4N17 A;  1K9Z A;  1NV3 A;  4N6K A;  5IZZ A;  2FIE A;  4MJO A;  4OVP A;  3CHG A;  2Y5K A;  2Y5L A;  2VPN A;  4MCO A;  4XFE A;  3PTY A;  3EKI A;  4PF8 A;  5IZ1 A;  5IZ3 A;  3KBZ A;  4PDD A;  4F18 A;  4P47 A;  5EQ7 A;  2CZK A;  1LBX A;  4HE0 A;  1INP A;  4NN3 A;  2ZZV A;  1D9Q A;  2BJI A;  4OVQ A;  1NUX A;  4NGU A;  4PBQ A;  4N6D A;  1NUZ A;  4NAP A;  4PGP A;  1FJ9 A;  1Q9D A;  3HFU A;  5DW8 A;  2B4L A;  2DVZ A;  1EYI A;  2WBB A;  4YIC A;  4PAK A;  4P1L A;  1RDX A;  2F3D A;  1FPD A;  4PCD A;  3GYY A;  4O8M A;  4DI3 D;  2ZZW A;  2HZL A;  1NI9 A;  3RYD A;  5EQ9 A;  2F3B A;  4OAN A;  3SZP A;  1FBP A;  1NV0 A;  4MMP A;  4UAB A;  1IMC A;  1JP4 A;  4QXD A;  4IR8 A;  1FBE A;  4G61 A;  5ET7 A;  4OVR A;  4O7I A;  3W9V A;  2OWZ A;  2PFY A;  4I3Y A;  2P3V A;  3NOH A;  4JVI A;  2CZH A;  1IME A;  4JVC A;  4O94 A;  4GX4 A;  1IMD A;  4PE3 A;  1G0H A;  3ISP A;  4N81 A;  3U65 A;  2Q8M A;  1NV1 A;  5ET8 A;  4X04 A;  4I3E A;  5IM2 A;  4PAI A;  1SPI A;  4DI4 B;  3BIH A;  2HXR A;  4PGN A;  4P56 A;  4JVD A;  4XEQ A;  2QFL A;  1FBC A;  1DBZ A;  4OVT A;  4OA4 A;  2B4M A;  2WYK A;  3KC0 A;  2PFZ A;  5IGA A;  2ZZX A;  2QVU A;  1FPB A;  5CM6 A;  3MYU A;  2FBP A;  3ROJ A;  1FTA A;  1DCU A;  5JK4 A;  2QVV A;  2XXK A;  3W9W A;  1NV7 A;  1CNQ A;  4MIJ A;  4X9T A;  3RPL B;  4PF6 A;  1FPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...