1IMCA

Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
266
structure length
266
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE
total genus 83
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1imcA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1imcA02
4GWYA 4HE2A 1NI9A 1D9QA 1FPDA 5EQ9A 5F24A 2Q74A 2FHYA 2WBDA 1KA0A 5ET5A 2JJKA 1DK4A 1IMEA 4GWZA 1FPEA 1NUYA 5EYHA 1EYIA 5EYGA 2P3NA 1NUWA 1LBWA 1IMDA 4MJOA 1EYKA 5IZ3A 3T0JA 4GBWA 3ROJA 1YXIA 3IFCA 2Q8MA 4O7IA 1FPJA 2FIEA 1RDZA 4GX3A 5LDZA 1EYJA 1FBCA 5IZ1A 3BIGA 3QMFA 4GWUA 4GX4A 1JP4A 2CZHA 2WBBA 5ESYA 4IR8A 1FTAA 4GWWA 1FBEA 2F3DA 1FSAA 5EQ7A 1FJ9A 1G0IA 3FBPA 4I3YA 1K9YA 1NV4A 5IZ3B 1YYZA 4N81A 2GQ1A 3A29A 1QGXA 1FBDA 2CZKA 2Y5LA 2FBPA 2QVVA 1RDXA 4H45A 1Q9DA 5T3JA 2QVUA 1NV7A 2QVRA 3KC1A 2FVZA 2DDKA 1FBGA 1FPGA 1NV0A 2WEFA 2R8TA 1FPBA 1INPA 4HXVA 2BJIA 1IMAA 1NUZA 2OWZA 1K9ZA 4GWSA 1FBHA 5I3SA 4AS4A 5A5LA 3KC0A 5ET8A 2CZIA 1DBZA 1RDYA 1NV6A 4I40A 5ET7A 1SPIA 1FPIA 1CNQA 1NV2A 2Y5KA 5EQAA 4FBPA 1IMBA 1AWBA 5EQ8A 4GBVA 4HE0A 1LBXA 4I3EA 1LBYA 3IFAA 5ET6A 1FPKA 4GWXA 2PCRA 3LUZA 3RPLB 1NV1A 2QFLA 1LBVA 1NV5A 4G61A 1KZ8A 5FBPA 2OX3A 1BK4A 1VDWA 1G0HA 1KA1A 1IMFA 1DCUA 1FBPA 4QXDA 1IMCA 1FBFA 1FPLA 2FIXA 1LEVA 3B8BA 1XI6A 3LV0A 5DW8A 3RYDA 2P3VA 3KBZA 4PTKA 4AS5A 1NV3A 4HE1A 2F3BA 4KXPA 5J16A 3BIHA 4GX6A 1FJ6A 2HHMA 2VT5A 3D1RA 1YZ0A 1FPFA 4H46A 3RPLA 1LBZA 1FRPA 1NUXA
chains in the Genus database with same CATH superfamily
5ET5A 1IMEA 1MS7A 1P1UA 3ROJA 1FPJA 4NTLA 2ZYNA 5DT6A 1D3KA 4LQ5A 5IZ1A 4XTCQ 3RPWA 3S9EA 4M4GA 5ESYA 2UVJA 1US5A 1I6QA 3E79A 1BTJA 4F2OA 3V89B 1QUJA 5EHSA 2Y5LA 3VE1B 3OO9A 4EQ7A 2OWTA 2Y7PA 3KFMA 4AQ4A 5CM6A 4OXVA 3OSRA 3CR9A 4R6YA 2DE3A 1ZKBA 3TTNA 2QMXA 3EHTA 3VVFA 5ICTA 2FNCA 1RDYA 2QRYA 4NF8B 1NV2A 5H8QB 4LQ2A 5I59B 1IUDA 3TDJA 1DTGA 3G3JA 4X1DA 2V3QA 2NWJA 4QSEA 4BDOA 4UABA 1NV1A 2VD2A 4G61A 3KBRA 5H8SA 4G77A 3KEIA 4BDNA 1Y20A 2Q2CA 3B6TA 2X7PA 4H1XA 4R9FA 5DW8A 3BBRA 1YCJA 3PPRA 2DE4A 4DZ1A 2ZYKA 2ANJA 1NUXA 2V93A 5JTYA 4H8JA 3S4UA 2DOJA 4U1ZA 2Q74A 4FJPA 1MPDA 5AA2B 1IMDA 4TLMB 1EYKA 4I9DA 2OZZA 2GH9A 4YB6A 2F8DA 3T9UA 4LONB 3LC8A 3QMFA 4GWUA 1NH8A 1JP4A 1NNFA 3MZ9A 4JVDA 1SBPA 5EQ7A 4NEDA 4DIGA 5A5XA 1NV4A 5IZ3B 3LR1A 1NNKA 4G8NA 3PUVE 3A29A 3OEKA 1JEUA 1FBDA 2OPDA 1LAGE 1RDXA 1LSTA 3VLUA 4IO3A 1D4NA 4N15A 2ZYMA 3MPLA 5BWJA 2QVRA 4ZEFA 2ABHA 3QIMA 5KCJA 1IEJA 3C31A 4ZEIA 1IITA 4PP0A 1IMAA 3RLFE 3H3GA 1SI1A 2UVGA 3GXAA 2QL3A 3QSLA 1BKAA 4QBAA 1Y3NA 4OVJA 1SPIA 5H8NA 4NHBA 4X1BA 5EQAA 2VP1A 4N13A 1B1HA 1OLCA 1LBBA 4U4XA 1P1NA 4N07A 4YKIA 1OVTA 3IAZA 2B4LA 1QKBA 5I57B 2DWAA 4NX1A 2V3TA 2VHAA 2XXWA 1MXVA 4ELRA 2A5TA 1A99A 4EUOA 4GXAA 3UIFA 3MP6A 3M8UA 4ECFA 3E3KA 1LB9A 3OO6A 4PQJA 4PGNA 1P1QA 3LSWA 3CFXA 1OLAA 4OVSA 2XXXA 3U65A 4HS7A 1FPEA 5EYHA 2F5XA 3CG1A 4OVPA 1Y4TA 2XHDA 3S9LC 2XXUA 2X7QA 2RF1A 2Z8FA 1QUKA 2ZNTA 3GBAA 1MPCA 5IKBA 1YAEA 3D4GA 3PPPA 5FHNA 3PU5A 4YMBA 3CG3A 2KQZA 2NUVA 1Z7NE 5DEXA 4NF6A 3GBBA 1UIVA 3GYYA 1TFDA 3PMVA 2DYXA 3UP9A 5T3JA 1B40A 3EHSA 4NE4A 4JWYA 2RCBA 3RGYA 4H8IA 3O2AA 3H6VA 1US4A 2BJIA 1H43A 1MXUA 5KDTB 3FVKA 1OIBA 4OVRA 2I4CA 3PMXA 2DXRA 3VXCA 1QKAA 4ELQA 2D5WA 4PAIA 4F3PA 1II5A 1POY1 5TPAA 4QFKA 1G0HA 1MXWA 4P1LA 1IMFA 1IMCA 3G3FA 4WEPA 1Y3PA 3I6VA 4F3GA 3ILUB 1O63A 1XVYA 2P3VA 4KD5A 4HE1A 2F3BA 4N4UA 4KHZE 1LAFE 3OELA 5HBCA 1JVYA 1MQGA 3K0VA 1D9QA 4R74A 2FHYA 1MQJA 1FQDA 1B6HA 4C1UA 4FATA 4OFOA 1SYHA 4JBZA 2ONSA 1B3FA 1B0HA 4PFTA 4O3AA 2FIEA 3EHUA 3IJXB 4IO5A 4GX4A 3ISPA 1EZOA 1FTAA 4F2QA 4NN3A 1SI0A 4PBQA 1D9VA 4RJZA 3MYUA 1P99A 2GQ1A 4OANA 1O64A 1NL5A 2XXIA 2QMWA 4RYAA 5I58A 3AXFA 3FV1A 2DDKA 1PBQA 4UA8A 1N7XA 3R26A 1K9ZA 4F31B 2OJTA 2QS1A 1CB6A 1NV6A 4ONYA 1AWBA 3JZJA 3O9PA 4EQ9A 1AIVA 1D9YA 3N94A 2UVIA 2FA7A 4DI3D 2XWVA 4PBHA 2Q88A 3PV0E 3SDFA 1BK4A 4PF8A 4RPOA 4QXDA 3FJMA 4DI4B 3B8BA 5ICQA 3TCGA 5J16A 2THIA 1B4ZA 4YZZA 3RQTA 4BLAA 3D1RA 4QRZA 5EYGA 4PFIA 4WXJA 3QUJA 2Y84A 4AB6A 2Y7WA 3RTFB 2I49A 2YLNA 4GBWA 2F6PA 2MKZA 2AYSA 3MQ9A 1L5TA 4HCWA 4OFLA 2XWIA 2RC9A 4F3BA 2O69A 4GLIA 5L8DA 4DXUA 2XX9A 4G8HA 1Y1MA 4AB5A 2UYEA 4NWDA 2F3DA 4P0IA 4I3YA 1MH3A 5HPQA 1PBPA 4OERA 4NF8A 2NXOA 3Q29A 1A55A 5I59A 3MWBA 3U94A 3BFTA 4EF2A 1AMFA 2KR0A 3CSBA 2D3IA 2Q9TA 2CZIA 5ET7A 2I4BA 1CNQA 2F7CA 2F97A 2O84X 2ZZWA 5CMMA 1XS5A 4PC9A 3MJNA 4U22A 5ET6A 2UYFA 1FPKA 3VVDA 1A40A 4G4PA 1JW4A 1NV5A 1B0LA 1A7LA 3DP4A 4PF6A 2RKMA 4IGRA 1UTBB 2QPQA 3MZ1A 5AA2A 3K02A 3IL1B 4ZEKA 3ZKKA 1NV3A 3SEUA 5FHOA 3BIHA 2Q89A 2WYKA 2XX7A 5CMCA 4HW8A 4H65A 5FTHA 4HE2A 3T9VA 3H6WA 1WODA 5JK4A 3IB0A 4PFWA 2O68A 2YPNA 4POXA 3W9VA 2P3NA 5A5XB 5I7IA 5IZ3A 3TTLA 3RTWB 5CC2A 4P47A 2GFEA 3B6WA 3VLVA 3Q26A 3ZKLA 1B51A 1B46A 3BIGA 2CZHA 3K01A 3E9XA 4YKPA 1G0IA 5B70A 4M1VA 1ZTYA 4YICA 2DQVA 4XEQA 1BIYA 5H8NB 3TFLA 1SW2A 5IZZA 5DYHA 3T96B 4ND9A 1LFGA 4LA9A 3QK6A 3E4RA 1FBGA 1I69A 2R8TA 1FQFA 1S7YA 1SW4A 1R9QA 5AA3A 4YKKA 3FV2A 3FJGA 4O3BA 2HXWA 1FPIA 3B6QA 4XFEA 3V8XB 5I2KB 1IMBA 2ZMBA 1EH3A 3I5OA 1VSOA 3HV1A 4G68B 4QFOA 3FUZA 3H03A 1B05A 1MDP1 4X9TA 1FTOA 3N6UA 4R2FA 1ZBMA 2OBGA 1N7WA 4MCOA 3USDA 2P1SA 2DP8A 4ZDMA 1M5BA 5TU0A 1SYIA 3T22A 4R9GA 3TTKA 3A09A 1NH7A 2OLBA 2VPNA 2WX9A 5LOMA 3UA8A 4LZ8A 1XOCA 2XXYA 3ZSFA 2F6GA 1MG1A 3IO6A 2O51A 3WAEA 4FORA 1LBWA 2F35A 3IFCA 2OK2A 5EHMA 3DM0A 4GX3A 4FEBA 2OWSA 1OMPA 3DP8A 2V84A 4H67A 1N04A 5I84A 2PYYA 4KPTA 1DPEA 2QS2A 4OENA 1NKXA 3TCFA 4P8BA 4ZE9A 5L9OA 4IO4A 4K3FA 2FBPA 2QVUA 2GRVA 4U1OA 2E0SA 3H6UA 4DCYA 2CEYA 5I56A 2R9JA 4KYDA 3PGFA 1DSNA 1QJMA 3IOWA 5TPAB 2OCUA 4PE3A 5HM4B 4NQ8A 3KOTA 3ONMA 4HTGA 4GWXA 2PCRA 1PEBA 3FXUA 4GFRA 3S2VA 1JW5A 3CSGA 3K6UA 1KA1A 4O7MA 2VD3A 3SZPA 1ANFA 3MZBA 2DVCA 3O66A 4Z7EA 4GF8A 2PMSA 3TQWA 2Z8DA 1USYE 4U2RA 3LV0A 2OPEA 4QSCA 1YTVA 2B4MA 1XT8A 5FTIA 2DWHA 3FZVA 3GLBA 3RY3A 1DTZA 4RK9A 4YKJA 4MNPA 3KZGA 2ZZVA 2REGA 3C9HA 2UVHA 1RKMA 4E0XA 3VV5A 1FTKA 3PUWE 4JVIA 3T0JA 3RT6B 2NOOA 1N84A 4R73A 3EPEA 4P11A 4MH5A 4OA4A 1FCKA 1M5EA 1ATGA 1T0KA 2I0BA 3FIRA 4JWOA 1B3GA 5I2NA 1UIUA 1TT1A 1Z7ME 1DMBA 3T9XB 3THIA 2B3FA 2I6EA 3PPQA 3EQ1A 2CZKA 3E13X 4H45A 2BJJX 3FD3A 4LZ7A 3OEMA 3FVOA 3IORA 3K4UA 2ONRA 3OO7A 1NV0A 4RY1A 1HSLA 4R72A 4MLQA 4HXVA 4KI0E 4Q5TA 4QHQA 1JETA 3VXBA 2P0SA 4X04A 1DBZA 1OQHA 4LVQA 3CHGA 3W9WA 4F1UA 2Y5KA 3K1NA 1MY2A 3H7MA 5EQ8A 3KSXA 4PAFA 1LAHE 4I3EA 5CBRA 3O97A 3KG2A 2DE2A 1ZJLA 2I48A 3QXMA 2HCAA 2HEUA 4Q0CA 2HZKA 1VFDA 1IXHA 1OVBA 3O6IA 4I1DA 4XF5A 4PGPA 4F19A 4AS5A 1YPNA 4DXCA 5CMKA 4OMBA 5I57A 1FRPA 4H5GA 1PB7A 4ESWA 3ECRA 2A5TB 2PT1A 3PPNA 4QSDA 2B3BA 4DLDA 3U1OA 1UTHA 4OZ9A 5F7VA 1GVCA 2I3WA 3TZAA 2REJA 2CZLA 1B7ZA 5ITOA 4C1TA 1H45A 5TP9B 1H76A 1B32A 2Q8JA 3TYHA 1RYXA 2QS3A 5AA4A 3KN3A 3N26A 4KCCA 4TLLB 1Q1KA 3C34A 3O6HA 4TQUQ 1YYZA 3KJTA 2H4IA 4MF3A 1B4HA 3C35A 4R6HA 4YMAA 2F36A 1R6ZA 5DVFA 4GWOA 1FPBA 3MPKA 2ALUA 2WKYA 1LLSA 3LUYA 4ZEBA 2IA4A 3K6VA 2XXTA 4JXIA 4NG7A 1M5FA 3TQLA 4LATA 3MP8A 4NF0A 3IFAA 5L9MA 4GL0A 2O1MA 1LBVA 4F22A 3ILTB 3SEVA 2YJPA 1SVXB 1AOVA 2XXRA 3PUZE 3TKDA 3TPAA 3O6GA 2FIXA 4MLVA 2B65A 3CI8A 5DVIA 2AIXA 3EF7A 4GRKA 4H46A 2F78A 3RPLA 1LBZA 2H99A 1NI9A 1IZ1A 1FPDA 1Y3QA 2RINA 2XWKA 5M2VA 3N6TA 2XD2A 1NUYA 2G29A 4I8CA 4Q30B 1CE2A 3SERA 4GOTA 1NNTA 3MVZA 3PD8A 4G8MA 3JYRA 1EU8A 3FASA 3IOTA 4DE8A 4IY5A 1MPBA 4H6DA 1PC3A 1K9YA 1IXGA 3VVEA 1QW0A 4FAJA 4N8YA 3GZGA 4N6DA 3BFUA 5I2KA 1Q9DA 4DDDA 3FGSA 4QFPA 2V3UA 4MIJA 4ZS9A 2FVZA 1LFIA 2O7IA 5IGAA 4JWXA 1FBHA 3U93A 4WKMA 4RNSA 1PB9A 4N6PA 3SEYA 3FXQA 1MM6A 4RPNA 5I58B 2DVZA 2O7UA 3MVXA 4LN5A 1NFTA 3MSTA 2ZNUA 4NF5A 1Y9UA 4ZZEA 2KLFA 1N76A 3PUXE 3CIJA 1FBPA 2HQ0A 4ISUA 3T1BA 4HCYA 1URSA 1MH4A 3O29A 1ZIUA 1LFHA 4EQBA 2WYPA 1IIWA 4GX6A 2PFYA 1YZ0A 4JB7A 3JV9A 2RC7A 3SKPA 3KOSA 1LGBC 2WBDA 1EZ9A 3IOUA 3VLWA 1H44A 1EYIA 2ESNA 3PD9A 3UK4A 1NUWA 1GV8A 1A54A 1POTA 1B52A 1R9LA 4BDMA 3RUMA 4EXLA 2XXQA 1MY4A 1EYJA 4BDQA 2Z23A 4R2BA 2PFZA 5I56B 1S9TA 1ZMGA 4O3CA 5ISUA 4U4SA 4NF4B 4FE8A 4MX6A 5H8QA 3TTRA 2XXHA 3FVNA 4OEUA 2Y7RA 4FECA 1NMUA 3MVWA 3DLNA 2WEFA 4LZ5A 2HXRA 4C0RA 2H9BA 2IEEA 4P1EA 2HAVA 3V83A 4IY6A 4BDRA 3RN8A 2F7BA 2LAOA 3TUSA 3G3IA 4HE0A 5AA1A 5H8HA 2ZXTA 1LBYA 3MVYA 3UGWA 1LBCA 3WAFA 4YAHX 1OQGA 5K2XA 1S50A 4P9KA 4F1YA 4XKRA 4N8GA 1FTLA 4PE5B 3T9HB 1N0TA 1GTKA 4IO6A 2VOZA 3CFZA 3LSLA 3TCHA 2ZYOA 4KXPA 3FVGA 4XXUA 4MFIA 1B7HA 1RYOA 3B7DA 5F24A 5EQ9A 2XXVA 2PT2A 2M8CA 5I2NB 2G93A 3G3KA 4FEDA 4LP2B 2PX1A 2AL4A 3QYTA 3TAJA 2A5SA 4IO7A 1B9JA 1YXIA 2Q8MA 3C4MA 4DXBA 3PTYA 1FTMA 4X8RA 4EDPA 4ELPA 4F1VA 3Q25A 4LUBA 3Q28A 2O1LA 1VFEA 1URDA 4GXSB 1URGA 3VFJA 5IAIA 4OVQA 1QGXA 4OTEA 4ELOA 2QVVA 1BP5A 2DWIA 4NMYA 1SDXA 4NGUA 1NV7A 1JW1A 1XC1A 1O7TA 2XXKA 4YB5A 4G68C 3U72A 1WVJA 1FQCA 1GR2A 3KN7A 3T66A 1DPPA 2OWZA 1SW5A 3SEWA 4AS4A 4XIGQ 3PPOA 1N3XA 4R75A 1GGGA 1MQIA 4ESXA 3V5AA 1Y1ZA 2VPOA 1LCTA 3D4CA 1VE4A 5FBPA 3DP6A 2OX3A 1VDWA 3IK6B 4RK2A 3H6TA 2NVUB 4JVCA 3HFUA 4ZEDA 1VR5A 4XKQA 3C32A 3PMWA 1UTHB 4RA1A 1FJ6A 2HHMA 2PBWA 1A8FA 2RCAA 5TP9A 4IB2A 5H8FA 1Y4CA 1R1NA 4X48A 3QUFA 2E1SA 2XXPA 4O7IA 3IX1A 1RDZA 5I5PA 1FQEA 3MP1A 5CBSA 4U21A 5IM2A 2H25A 3S9NC 1B58A 4Z0IA 4IR8A 4GWWA 1FBEA 3QAXA 4H0WA 1ZU0A 3FBPA 1FQBA 3NOHA 3EN3A 2DS9A 2ZZXA 1DOTA 3UN6A 3DELB 2F34A 1JVXA 2D21A 5KZTA 3KC1A 4N17A 3RNNA 2HFBA 5AA2D 2CMOA 2QS4A 1NUZA 4OQOA 4GWSA 2Y7IA 3OO8A 3LBSA 4ZECA 4YU0A 3CRBA 2L5VA 4EF1A 1I6BA 3U8QA 4GBVA 5CMBA 2R6GE 3LUZA 3RPLB 3L6GA 4GQOA 1B3EA 2QFLA 1KZ8A 4GIZA 1QUIA 3TEPA 4OESA 3TODA 5ELVA 4MNIA 3C36A 3EKIA 1FBFA 4TOZA 3IJOB 4KYSA 4N6KA 1MM7A 4F29A 1TXFA 1MDQA 3RYDA 4PTKA 5LTCA 2Y7KA 2DWJA 2VT5A 1FTJA 1XHYA 4P56A 3VDFA 4OFJA 1F9BA 3K2DA 2QSXA 4GWYA 1B5HA 3OXNA 4XKNA 5B7DA 4OETA 3N5LA 1DK4A 4N91A 4GWZA 2HAUA 2GHBA 4MJOA 4U23A 3ZS6A 4NAPA 4NWCA 2GHAA 2XX8A 3PUYE 1P1WA 5JTYB 3CFLA 4GL8A 2XWOA 5CI5A 1PB8A 3OSQA 4PFYA 1FJ9A 3OOAA 4OYVA 4MAGA 4MNCA 3FXBA 1TWYA 5K2YA 5J1DA 1BLFA 3U92A 3M3LA 1QVSA 5AE4A 1JQFA 1B3HA 1FPGA 2DSFA 2O6AA 4NF5B 5I3SA 5A5LA 1IQ7A 4G2ZA 4KR5A 3W15C 4FBPA 2XA5A 2V25A 3I3VA 2V4CA 1LBXA 3MW0A 2H5YA 3HPIA 5KCJB 4OVTA 3R7XA 4PFRA 1B5IA 1I6AA 1FQAA 1N3WA 3FXRA 3E78A 3A3UA 4MMPA 2X26A 4QFLA 4F39A 4DCXA 2CEXA 4MBPA 1MXZA 1LEVA 1SQYA 3IB1A 5DTBA 2I3VA 3OENA 3HSTA 2R71A 3S9MC 1FPFA 2DXYA 2H98A 3Q27A 1A8EA 2P2AA 2AL5A 3P7IA 3K6XA 3IB2A 4OEVA 4POWA 4KFQA 1MXXA 4R6KA 3KJ7A 4NF4A 4E0WA 4PDDA 1MQDA 1MRPA 2XD3A 5LDZA 3CVGA 1FBCA 4P3LA 1JNFA 2HZLA 1FSAA 3KN8A 4F3SA 2F7AA 4WEDA 4OHNA 3K1MA 2Q2AA 1QULA 3G3HA 1MXYA 4PDHA 1M5CA 5H8HB 2ZNSA 4YB7A 2I0CA 1Q35A 1H3DA 5AA4B 1MY0A 3IR1A 1EZPA 5DEXB 3KC0A 3HCQA 4NF6B 1XVXA 4I40A 4MEVA 5L9SA 2I58A 3HO7A 2ONKE 4EXKA 1UTBA 1LAXA 4GD5A 3SESA 3OMBA 1UQWA 4KQPA 3HN0A 2QJEA 3R6UA 3ODBA 3G7WA 3UORA 3RT8A 5CRYA 5KDTA 3KSJA 3MUQA 1SW1A 2RC8A 3H4ZA 4JSOA 1DCUA 2FYIA 3MAMA 5EYFA 4RXLA 1JEVA 3FJ7A 1FPLA 3KGCA 4O8MA 4P0GA 4H5FA 5FHMA 2Z22A 1M5DA 4PFUA 3KBZA 4L17A 1ZLQA 3M3FA 1AL3A 3HHGA 4PFBA 3T93B 4IGTA 3LSXA 3SEXA 4I62A 4JDFA 1USYH 1KA0A 1MY3A 4THIA 2JJKA 4BDLA 5ITPA 3TMGA 3FATA 4PCDA 3BKIB 3IO4A 3C33A 3H06B 4JSDA 1HSEA 2UXAA 3M3KA 5F1QA 1WDNA 1MQHA 1SD3A 1KWHA 3L6HA 2PVUA 4O94A 2WBBA 4QFNA 1PDAA 1FW0A 3HHFA 1AH5A 3MC2A 1NNPA 1ELJA 4MHFA 4KCDA 1B7UA 1MY1A 2VGQA 4FIMA 3B50A 4N81A 5BUUA 1IXIA 2HPGA 3A3CA 1HSJA 4UACA 3TTMA 5JEIA 3MBPA 4G68A 3SETA 3O28A 3K1PA 4XKPA 1INPA 1B2HA 1B1XA 5ET8A 4QF9A 1B3LA 1B5JA 4ZE8A 3G3GA 4OWDA 3F11A 3OD7A 4Q8RA 4ZZAA 4PAKA 1TFAA 1IXCA 3K00A 5H8FB 1J1NA 3IOVA 2W7YA 1LB8A 2Z8EA 4KYEA 1XI6A 3K6WA 4IO2A 4PETA 3LSFB 1P1OA 4F18A 1LCFA 4GVOA 3TELA 5DVJA
chains in the Genus database with same CATH topology
4GWYA 4HE2A 4PFIA 1NI9A 4OVSA 4MNPA 1D9QA 1FPDA 5EQ9A 5F24A 2ZZVA 5JK4A 2Q74A 2FHYA 2WBDA 1KA0A 5ET5A 2XWKA 3U65A 2JJKA 1DK4A 1IMEA 4GWZA 1FPEA 4N91A 1NUYA 5EYHA 1EYIA 5EYGA 2F5XA 4OVPA 3W9VA 2P3NA 1NUWA 1LBWA 4JVIA 1IMDA 4MJOA 4PCDA 5I7IA 1EYKA 5IZ3A 3T0JA 4GBWA 3ROJA 1YXIA 3IFCA 2Q8MA 4O7IA 4PDDA 2MKZA 4P47A 1FPJA 2FIEA 4NAPA 1RDZA 4OA4A 4GX3A 4HCWA 3PTYA 5I5PA 5LDZA 1EYJA 1FBCA 5IZ1A 2XWIA 4X8RA 3BIGA 4P3LA 4F1VA 3QMFA 4GWUA 4GX4A 4O94A 2PFZA 5IM2A 1JP4A 2CZHA 2WBBA 2XWOA 3ISPA 5ESYA 4IR8A 4JVDA 1FTAA 4GWWA 1FBEA 4NN3A 2F3DA 1FSAA 2HZLA 5EQ7A 1FJ9A 1G0IA 3FBPA 4MAGA 2KQZA 3E79A 4I3YA 3FXBA 4M1VA 4MHFA 4MNCA 4PBQA 1K9YA 1NV4A 3NOHA 4YICA 5IZ3B 3MYUA 4P8BA 4XEQA 3B50A 4OVQA 4N8YA 1YYZA 4N81A 2GQ1A 4OANA 3A29A 1QGXA 1FBDA 2CZKA 3GYYA 2Y5LA 2FBPA 2QVVA 4MX6A 2ZZXA 4N6DA 1RDXA 2HPGA 4H45A 1Q9DA 5T3JA 2QVUA 4PDHA 4N15A 5IZZA 4NGUA 1NV7A 2QVRA 2CEYA 3KC1A 2XXKA 4MIJA 4N17A 5CM6A 2FVZA 2KR0A 2DDKA 1FBGA 1FPGA 1NV0A 2WEFA 2R8TA 5IGAA 2HXRA 1FPBA 1INPA 4HXVA 2BJIA 1IMAA 1NUZA 2DE3A 4P1EA 2OWZA 1K9ZA 4GWSA 1FBHA 5I3SA 4AS4A 2Q9TA 5A5LA 3KC0A 5ET8A 2CZIA 4OVRA 1DBZA 4QBAA 4X04A 1RDYA 1NV6A 5J1DA 4I40A 5ET7A 1SPIA 3CHGA 1FPIA 1CNQA 2L5VA 4MEVA 4PE3A 3W9WA 1NV2A 2Y5KA 5EQAA 4NHBA 4XFEA 4NG7A 4FBPA 4F18A 2XA5A 2ZZWA 1IMBA 1AWBA 5EQ8A 4NF0A 4GBVA 4HE0A 2WX9A 4PAFA 2DVZA 2V3QA 2V4CA 4NQ8A 1LBXA 4PC9A 4I3EA 1LBYA 2VPOA 3IFAA 5ET6A 1FPKA 4GWXA 2PCRA 2B4LA 4LN5A 4OVTA 4PAIA 4PFRA 3MSTA 3LUZA 4UABA 4DI3D 3RPLB 1NV1A 2DE2A 2QFLA 1LBVA 1NV5A 4G61A 2XWVA 1KZ8A 5FBPA 4NX1A 4P9KA 2OX3A 4PAKA 1BK4A 4PBHA 4PF6A 4PF8A 4X9TA 3E78A 1VDWA 1G0HA 2HZKA 4F1UA 4MNIA 1KA1A 4MMPA 4O7MA 1IMFA 1DCUA 4P1LA 3SZPA 4N8GA 1FBPA 4QXDA 1IMCA 1FBFA 1FPLA 2CEXA 3EKIA 4MCOA 4O8MA 3T1BA 4HCYA 2FIXA 2QPQA 4DI4B 4JVCA 1LEVA 3B8BA 3HFUA 1XI6A 4N6KA 3LV0A 4XF5A 4PGPA 5DW8A 4PETA 4F19A 3RYDA 2P3VA 3KBZA 4PTKA 4AS5A 1NV3A 4HE1A 2F3BA 4KXPA 5J16A 2B4MA 2DE4A 4N4UA 2WYPA 4YZZA 3BIHA 5LTCA 4GX6A 1FJ6A 2HHMA 2VT5A 3D1RA 1YZ0A 1FPFA 4H46A 2PFYA 3RPLA 2WYKA 4P56A 4PFBA 1LBZA 4PGNA 1FRPA 1NUXA 2VPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GWY A;  4HE2 A;  1NI9 A;  1D9Q A;  1FPD A;  5EQ9 A;  5F24 A;  2Q74 A;  2FHY A;  2WBD A;  1KA0 A;  5ET5 A;  2JJK A;  1DK4 A;  1IME A;  4GWZ A;  1FPE A;  1NUY A;  5EYH A;  1EYI A;  5EYG A;  2P3N A;  1NUW A;  1LBW A;  1IMD A;  4MJO A;  1EYK A;  5IZ3 A;  3T0J A;  4GBW A;  3ROJ A;  1YXI A;  3IFC A;  2Q8M A;  4O7I A;  1FPJ A;  2FIE A;  1RDZ A;  4GX3 A;  5LDZ A;  1EYJ A;  1FBC A;  5IZ1 A;  3BIG A;  3QMF A;  4GWU A;  4GX4 A;  1JP4 A;  2CZH A;  2WBB A;  5ESY A;  4IR8 A;  1FTA A;  4GWW A;  1FBE A;  2F3D A;  1FSA A;  5EQ7 A;  1FJ9 A;  1G0I A;  3FBP A;  4I3Y A;  1K9Y A;  1NV4 A;  5IZ3 B;  1YYZ A;  4N81 A;  2GQ1 A;  3A29 A;  1QGX A;  1FBD A;  2CZK A;  2Y5L A;  2FBP A;  2QVV A;  1RDX A;  4H45 A;  1Q9D A;  5T3J A;  2QVU A;  1NV7 A;  2QVR A;  3KC1 A;  2FVZ A;  2DDK A;  1FBG A;  1FPG A;  1NV0 A;  2WEF A;  2R8T A;  1FPB A;  1INP A;  4HXV A;  2BJI A;  1IMA A;  1NUZ A;  2OWZ A;  1K9Z A;  4GWS A;  1FBH A;  5I3S A;  4AS4 A;  5A5L A;  3KC0 A;  5ET8 A;  2CZI A;  1DBZ A;  1RDY A;  1NV6 A;  4I40 A;  5ET7 A;  1SPI A;  1FPI A;  1CNQ A;  1NV2 A;  2Y5K A;  5EQA A;  4FBP A;  1IMB A;  1AWB A;  5EQ8 A;  4GBV A;  4HE0 A;  1LBX A;  4I3E A;  1LBY A;  3IFA A;  5ET6 A;  1FPK A;  4GWX A;  2PCR A;  3LUZ A;  3RPL B;  1NV1 A;  2QFL A;  1LBV A;  1NV5 A;  4G61 A;  1KZ8 A;  5FBP A;  2OX3 A;  1BK4 A;  1VDW A;  1G0H A;  1KA1 A;  1IMF A;  1DCU A;  1FBP A;  4QXD A;  1IMC A;  1FBF A;  1FPL A;  2FIX A;  1LEV A;  3B8B A;  1XI6 A;  3LV0 A;  5DW8 A;  3RYD A;  2P3V A;  3KBZ A;  4PTK A;  4AS5 A;  1NV3 A;  4HE1 A;  2F3B A;  4KXP A;  5J16 A;  3BIH A;  4GX6 A;  1FJ6 A;  2HHM A;  2VT5 A;  3D1R A;  1YZ0 A;  1FPF A;  4H46 A;  3RPL A;  1LBZ A;  1FRP A;  1NUX A; 
#chains in the Genus database with same CATH topology
 5ET5 A;  1IME A;  1MS7 A;  1P1U A;  3ROJ A;  1FPJ A;  4NTL A;  2ZYN A;  5DT6 A;  1D3K A;  4LQ5 A;  5IZ1 A;  4XTC Q;  3RPW A;  3S9E A;  4M4G A;  5ESY A;  2UVJ A;  1US5 A;  1I6Q A;  3E79 A;  1BTJ A;  4F2O A;  3V89 B;  1QUJ A;  5EHS A;  2Y5L A;  3VE1 B;  3OO9 A;  4EQ7 A;  2OWT A;  2Y7P A;  3KFM A;  4AQ4 A;  5CM6 A;  4OXV A;  3OSR A;  3CR9 A;  4R6Y A;  2DE3 A;  1ZKB A;  3TTN A;  2QMX A;  3EHT A;  3VVF A;  5ICT A;  2FNC A;  1RDY A;  2QRY A;  4NF8 B;  1NV2 A;  5H8Q B;  4LQ2 A;  5I59 B;  1IUD A;  3TDJ A;  1DTG A;  3G3J A;  4X1D A;  2V3Q A;  2NWJ A;  4QSE A;  4BDO A;  4UAB A;  1NV1 A;  2VD2 A;  4G61 A;  3KBR A;  5H8S A;  4G77 A;  3KEI A;  4BDN A;  1Y20 A;  2Q2C A;  3B6T A;  2X7P A;  4H1X A;  4R9F A;  5DW8 A;  3BBR A;  1YCJ A;  3PPR A;  2DE4 A;  4DZ1 A;  2ZYK A;  2ANJ A;  1NUX A;  2V93 A;  5JTY A;  4H8J A;  3S4U A;  2DOJ A;  4U1Z A;  2Q74 A;  4FJP A;  1MPD A;  5AA2 B;  1IMD A;  4TLM B;  1EYK A;  4I9D A;  2OZZ A;  2GH9 A;  4YB6 A;  2F8D A;  3T9U A;  4LON B;  3LC8 A;  3QMF A;  4GWU A;  1NH8 A;  1JP4 A;  1NNF A;  3MZ9 A;  4JVD A;  1SBP A;  5EQ7 A;  4NED A;  4DIG A;  5A5X A;  1NV4 A;  5IZ3 B;  3LR1 A;  1NNK A;  4G8N A;  3PUV E;  3A29 A;  3OEK A;  1JEU A;  1FBD A;  2OPD A;  1LAG E;  1RDX A;  1LST A;  3VLU A;  4IO3 A;  1D4N A;  4N15 A;  2ZYM A;  3MPL A;  5BWJ A;  2QVR A;  4ZEF A;  2ABH A;  3QIM A;  5KCJ A;  1IEJ A;  3C31 A;  4ZEI A;  1IIT A;  4PP0 A;  1IMA A;  3RLF E;  3H3G A;  1SI1 A;  2UVG A;  3GXA A;  2QL3 A;  3QSL A;  1BKA A;  4QBA A;  1Y3N A;  4OVJ A;  1SPI A;  5H8N A;  4NHB A;  4X1B A;  5EQA A;  2VP1 A;  4N13 A;  1B1H A;  1OLC A;  1LBB A;  4U4X A;  1P1N A;  4N07 A;  4YKI A;  1OVT A;  3IAZ A;  2B4L A;  1QKB A;  5I57 B;  2DWA A;  4NX1 A;  2V3T A;  2VHA A;  2XXW A;  1MXV A;  4ELR A;  2A5T A;  1A99 A;  4EUO A;  4GXA A;  3UIF A;  3MP6 A;  3M8U A;  4ECF A;  3E3K A;  1LB9 A;  3OO6 A;  4PQJ A;  4PGN A;  1P1Q A;  3LSW A;  3CFX A;  1OLA A;  4OVS A;  2XXX A;  3U65 A;  4HS7 A;  1FPE A;  5EYH A;  2F5X A;  3CG1 A;  4OVP A;  1Y4T A;  2XHD A;  3S9L C;  2XXU A;  2X7Q A;  2RF1 A;  2Z8F A;  1QUK A;  2ZNT A;  3GBA A;  1MPC A;  5IKB A;  1YAE A;  3D4G A;  3PPP A;  5FHN A;  3PU5 A;  4YMB A;  3CG3 A;  2KQZ A;  2NUV A;  1Z7N E;  5DEX A;  4NF6 A;  3GBB A;  1UIV A;  3GYY A;  1TFD A;  3PMV A;  2DYX A;  3UP9 A;  5T3J A;  1B40 A;  3EHS A;  4NE4 A;  4JWY A;  2RCB A;  3RGY A;  4H8I A;  3O2A A;  3H6V A;  1US4 A;  2BJI A;  1H43 A;  1MXU A;  5KDT B;  3FVK A;  1OIB A;  4OVR A;  2I4C A;  3PMX A;  2DXR A;  3VXC A;  1QKA A;  4ELQ A;  2D5W A;  4PAI A;  4F3P A;  1II5 A;  1POY 1;  5TPA A;  4QFK A;  1G0H A;  1MXW A;  4P1L A;  1IMF A;  1IMC A;  3G3F A;  4WEP A;  1Y3P A;  3I6V A;  4F3G A;  3ILU B;  1O63 A;  1XVY A;  2P3V A;  4KD5 A;  4HE1 A;  2F3B A;  4N4U A;  4KHZ E;  1LAF E;  3OEL A;  5HBC A;  1JVY A;  1MQG A;  3K0V A;  1D9Q A;  4R74 A;  2FHY A;  1MQJ A;  1FQD A;  1B6H A;  4C1U A;  4FAT A;  4OFO A;  1SYH A;  4JBZ A;  2ONS A;  1B3F A;  1B0H A;  4PFT A;  4O3A A;  2FIE A;  3EHU A;  3IJX B;  4IO5 A;  4GX4 A;  3ISP A;  1EZO A;  1FTA A;  4F2Q A;  4NN3 A;  1SI0 A;  4PBQ A;  1D9V A;  4RJZ A;  3MYU A;  1P99 A;  2GQ1 A;  4OAN A;  1O64 A;  1NL5 A;  2XXI A;  2QMW A;  4RYA A;  5I58 A;  3AXF A;  3FV1 A;  2DDK A;  1PBQ A;  4UA8 A;  1N7X A;  3R26 A;  1K9Z A;  4F31 B;  2OJT A;  2QS1 A;  1CB6 A;  1NV6 A;  4ONY A;  1AWB A;  3JZJ A;  3O9P A;  4EQ9 A;  1AIV A;  1D9Y A;  3N94 A;  2UVI A;  2FA7 A;  4DI3 D;  2XWV A;  4PBH A;  2Q88 A;  3PV0 E;  3SDF A;  1BK4 A;  4PF8 A;  4RPO A;  4QXD A;  3FJM A;  4DI4 B;  3B8B A;  5ICQ A;  3TCG A;  5J16 A;  2THI A;  1B4Z A;  4YZZ A;  3RQT A;  4BLA A;  3D1R A;  4QRZ A;  5EYG A;  4PFI A;  4WXJ A;  3QUJ A;  2Y84 A;  4AB6 A;  2Y7W A;  3RTF B;  2I49 A;  2YLN A;  4GBW A;  2F6P A;  2MKZ A;  2AYS A;  3MQ9 A;  1L5T A;  4HCW A;  4OFL A;  2XWI A;  2RC9 A;  4F3B A;  2O69 A;  4GLI A;  5L8D A;  4DXU A;  2XX9 A;  4G8H A;  1Y1M A;  4AB5 A;  2UYE A;  4NWD A;  2F3D A;  4P0I A;  4I3Y A;  1MH3 A;  5HPQ A;  1PBP A;  4OER A;  4NF8 A;  2NXO A;  3Q29 A;  1A55 A;  5I59 A;  3MWB A;  3U94 A;  3BFT A;  4EF2 A;  1AMF A;  2KR0 A;  3CSB A;  2D3I A;  2Q9T A;  2CZI A;  5ET7 A;  2I4B A;  1CNQ A;  2F7C A;  2F97 A;  2O84 X;  2ZZW A;  5CMM A;  1XS5 A;  4PC9 A;  3MJN A;  4U22 A;  5ET6 A;  2UYF A;  1FPK A;  3VVD A;  1A40 A;  4G4P A;  1JW4 A;  1NV5 A;  1B0L A;  1A7L A;  3DP4 A;  4PF6 A;  2RKM A;  4IGR A;  1UTB B;  2QPQ A;  3MZ1 A;  5AA2 A;  3K02 A;  3IL1 B;  4ZEK A;  3ZKK A;  1NV3 A;  3SEU A;  5FHO A;  3BIH A;  2Q89 A;  2WYK A;  2XX7 A;  5CMC A;  4HW8 A;  4H65 A;  5FTH A;  4HE2 A;  3T9V A;  3H6W A;  1WOD A;  5JK4 A;  3IB0 A;  4PFW A;  2O68 A;  2YPN A;  4POX A;  3W9V A;  2P3N A;  5A5X B;  5I7I A;  5IZ3 A;  3TTL A;  3RTW B;  5CC2 A;  4P47 A;  2GFE A;  3B6W A;  3VLV A;  3Q26 A;  3ZKL A;  1B51 A;  1B46 A;  3BIG A;  2CZH A;  3K01 A;  3E9X A;  4YKP A;  1G0I A;  5B70 A;  4M1V A;  1ZTY A;  4YIC A;  2DQV A;  4XEQ A;  1BIY A;  5H8N B;  3TFL A;  1SW2 A;  5IZZ A;  5DYH A;  3T96 B;  4ND9 A;  1LFG A;  4LA9 A;  3QK6 A;  3E4R A;  1FBG A;  1I69 A;  2R8T A;  1FQF A;  1S7Y A;  1SW4 A;  1R9Q A;  5AA3 A;  4YKK A;  3FV2 A;  3FJG A;  4O3B A;  2HXW A;  1FPI A;  3B6Q A;  4XFE A;  3V8X B;  5I2K B;  1IMB A;  2ZMB A;  1EH3 A;  3I5O A;  1VSO A;  3HV1 A;  4G68 B;  4QFO A;  3FUZ A;  3H03 A;  1B05 A;  1MDP 1;  4X9T A;  1FTO A;  3N6U A;  4R2F A;  1ZBM A;  2OBG A;  1N7W A;  4MCO A;  3USD A;  2P1S A;  2DP8 A;  4ZDM A;  1M5B A;  5TU0 A;  1SYI A;  3T22 A;  4R9G A;  3TTK A;  3A09 A;  1NH7 A;  2OLB A;  2VPN A;  2WX9 A;  5LOM A;  3UA8 A;  4LZ8 A;  1XOC A;  2XXY A;  3ZSF A;  2F6G A;  1MG1 A;  3IO6 A;  2O51 A;  3WAE A;  4FOR A;  1LBW A;  2F35 A;  3IFC A;  2OK2 A;  5EHM A;  3DM0 A;  4GX3 A;  4FEB A;  2OWS A;  1OMP A;  3DP8 A;  2V84 A;  4H67 A;  1N04 A;  5I84 A;  2PYY A;  4KPT A;  1DPE A;  2QS2 A;  4OEN A;  1NKX A;  3TCF A;  4P8B A;  4ZE9 A;  5L9O A;  4IO4 A;  4K3F A;  2FBP A;  2QVU A;  2GRV A;  4U1O A;  2E0S A;  3H6U A;  4DCY A;  2CEY A;  5I56 A;  2R9J A;  4KYD A;  3PGF A;  1DSN A;  1QJM A;  3IOW A;  5TPA B;  2OCU A;  4PE3 A;  5HM4 B;  4NQ8 A;  3KOT A;  3ONM A;  4HTG A;  4GWX A;  2PCR A;  1PEB A;  3FXU A;  4GFR A;  3S2V A;  1JW5 A;  3CSG A;  3K6U A;  1KA1 A;  4O7M A;  2VD3 A;  3SZP A;  1ANF A;  3MZB A;  2DVC A;  3O66 A;  4Z7E A;  4GF8 A;  2PMS A;  3TQW A;  2Z8D A;  1USY E;  4U2R A;  3LV0 A;  2OPE A;  4QSC A;  1YTV A;  2B4M A;  1XT8 A;  5FTI A;  2DWH A;  3FZV A;  3GLB A;  3RY3 A;  1DTZ A;  4RK9 A;  4YKJ A;  4MNP A;  3KZG A;  2ZZV A;  2REG A;  3C9H A;  2UVH A;  1RKM A;  4E0X A;  3VV5 A;  1FTK A;  3PUW E;  4JVI A;  3T0J A;  3RT6 B;  2NOO A;  1N84 A;  4R73 A;  3EPE A;  4P11 A;  4MH5 A;  4OA4 A;  1FCK A;  1M5E A;  1ATG A;  1T0K A;  2I0B A;  3FIR A;  4JWO A;  1B3G A;  5I2N A;  1UIU A;  1TT1 A;  1Z7M E;  1DMB A;  3T9X B;  3THI A;  2B3F A;  2I6E A;  3PPQ A;  3EQ1 A;  2CZK A;  3E13 X;  4H45 A;  2BJJ X;  3FD3 A;  4LZ7 A;  3OEM A;  3FVO A;  3IOR A;  3K4U A;  2ONR A;  3OO7 A;  1NV0 A;  4RY1 A;  1HSL A;  4R72 A;  4MLQ A;  4HXV A;  4KI0 E;  4Q5T A;  4QHQ A;  1JET A;  3VXB A;  2P0S A;  4X04 A;  1DBZ A;  1OQH A;  4LVQ A;  3CHG A;  3W9W A;  4F1U A;  2Y5K A;  3K1N A;  1MY2 A;  3H7M A;  5EQ8 A;  3KSX A;  4PAF A;  1LAH E;  4I3E A;  5CBR A;  3O97 A;  3KG2 A;  2DE2 A;  1ZJL A;  2I48 A;  3QXM A;  2HCA A;  2HEU A;  4Q0C A;  2HZK A;  1VFD A;  1IXH A;  1OVB A;  3O6I A;  4I1D A;  4XF5 A;  4PGP A;  4F19 A;  4AS5 A;  1YPN A;  4DXC A;  5CMK A;  4OMB A;  5I57 A;  1FRP A;  4H5G A;  1PB7 A;  4ESW A;  3ECR A;  2A5T B;  2PT1 A;  3PPN A;  4QSD A;  2B3B A;  4DLD A;  3U1O A;  1UTH A;  4OZ9 A;  5F7V A;  1GVC A;  2I3W A;  3TZA A;  2REJ A;  2CZL A;  1B7Z A;  5ITO A;  4C1T A;  1H45 A;  5TP9 B;  1H76 A;  1B32 A;  2Q8J A;  3TYH A;  1RYX A;  2QS3 A;  5AA4 A;  3KN3 A;  3N26 A;  4KCC A;  4TLL B;  1Q1K A;  3C34 A;  3O6H A;  4TQU Q;  1YYZ A;  3KJT A;  2H4I A;  4MF3 A;  1B4H A;  3C35 A;  4R6H A;  4YMA A;  2F36 A;  1R6Z A;  5DVF A;  4GWO A;  1FPB A;  3MPK A;  2ALU A;  2WKY A;  1LLS A;  3LUY A;  4ZEB A;  2IA4 A;  3K6V A;  2XXT A;  4JXI A;  4NG7 A;  1M5F A;  3TQL A;  4LAT A;  3MP8 A;  4NF0 A;  3IFA A;  5L9M A;  4GL0 A;  2O1M A;  1LBV A;  4F22 A;  3ILT B;  3SEV A;  2YJP A;  1SVX B;  1AOV A;  2XXR A;  3PUZ E;  3TKD A;  3TPA A;  3O6G A;  2FIX A;  4MLV A;  2B65 A;  3CI8 A;  5DVI A;  2AIX A;  3EF7 A;  4GRK A;  4H46 A;  2F78 A;  3RPL A;  1LBZ A;  2H99 A;  1NI9 A;  1IZ1 A;  1FPD A;  1Y3Q A;  2RIN A;  2XWK A;  5M2V A;  3N6T A;  2XD2 A;  1NUY A;  2G29 A;  4I8C A;  4Q30 B;  1CE2 A;  3SER A;  4GOT A;  1NNT A;  3MVZ A;  3PD8 A;  4G8M A;  3JYR A;  1EU8 A;  3FAS A;  3IOT A;  4DE8 A;  4IY5 A;  1MPB A;  4H6D A;  1PC3 A;  1K9Y A;  1IXG A;  3VVE A;  1QW0 A;  4FAJ A;  4N8Y A;  3GZG A;  4N6D A;  3BFU A;  5I2K A;  1Q9D A;  4DDD A;  3FGS A;  4QFP A;  2V3U A;  4MIJ A;  4ZS9 A;  2FVZ A;  1LFI A;  2O7I A;  5IGA A;  4JWX A;  1FBH A;  3U93 A;  4WKM A;  4RNS A;  1PB9 A;  4N6P A;  3SEY A;  3FXQ A;  1MM6 A;  4RPN A;  5I58 B;  2DVZ A;  2O7U A;  3MVX A;  4LN5 A;  1NFT A;  3MST A;  2ZNU A;  4NF5 A;  1Y9U A;  4ZZE A;  2KLF A;  1N76 A;  3PUX E;  3CIJ A;  1FBP A;  2HQ0 A;  4ISU A;  3T1B A;  4HCY A;  1URS A;  1MH4 A;  3O29 A;  1ZIU A;  1LFH A;  4EQB A;  2WYP A;  1IIW A;  4GX6 A;  2PFY A;  1YZ0 A;  4JB7 A;  3JV9 A;  2RC7 A;  3SKP A;  3KOS A;  1LGB C;  2WBD A;  1EZ9 A;  3IOU A;  3VLW A;  1H44 A;  1EYI A;  2ESN A;  3PD9 A;  3UK4 A;  1NUW A;  1GV8 A;  1A54 A;  1POT A;  1B52 A;  1R9L A;  4BDM A;  3RUM A;  4EXL A;  2XXQ A;  1MY4 A;  1EYJ A;  4BDQ A;  2Z23 A;  4R2B A;  2PFZ A;  5I56 B;  1S9T A;  1ZMG A;  4O3C A;  5ISU A;  4U4S A;  4NF4 B;  4FE8 A;  4MX6 A;  5H8Q A;  3TTR A;  2XXH A;  3FVN A;  4OEU A;  2Y7R A;  4FEC A;  1NMU A;  3MVW A;  3DLN A;  2WEF A;  4LZ5 A;  2HXR A;  4C0R A;  2H9B A;  2IEE A;  4P1E A;  2HAV A;  3V83 A;  4IY6 A;  4BDR A;  3RN8 A;  2F7B A;  2LAO A;  3TUS A;  3G3I A;  4HE0 A;  5AA1 A;  5H8H A;  2ZXT A;  1LBY A;  3MVY A;  3UGW A;  1LBC A;  3WAF A;  4YAH X;  1OQG A;  5K2X A;  1S50 A;  4P9K A;  4F1Y A;  4XKR A;  4N8G A;  1FTL A;  4PE5 B;  3T9H B;  1N0T A;  1GTK A;  4IO6 A;  2VOZ A;  3CFZ A;  3LSL A;  3TCH A;  2ZYO A;  4KXP A;  3FVG A;  4XXU A;  4MFI A;  1B7H A;  1RYO A;  3B7D A;  5F24 A;  5EQ9 A;  2XXV A;  2PT2 A;  2M8C A;  5I2N B;  2G93 A;  3G3K A;  4FED A;  4LP2 B;  2PX1 A;  2AL4 A;  3QYT A;  3TAJ A;  2A5S A;  4IO7 A;  1B9J A;  1YXI A;  2Q8M A;  3C4M A;  4DXB A;  3PTY A;  1FTM A;  4X8R A;  4EDP A;  4ELP A;  4F1V A;  3Q25 A;  4LUB A;  3Q28 A;  2O1L A;  1VFE A;  1URD A;  4GXS B;  1URG A;  3VFJ A;  5IAI A;  4OVQ A;  1QGX A;  4OTE A;  4ELO A;  2QVV A;  1BP5 A;  2DWI A;  4NMY A;  1SDX A;  4NGU A;  1NV7 A;  1JW1 A;  1XC1 A;  1O7T A;  2XXK A;  4YB5 A;  4G68 C;  3U72 A;  1WVJ A;  1FQC A;  1GR2 A;  3KN7 A;  3T66 A;  1DPP A;  2OWZ A;  1SW5 A;  3SEW A;  4AS4 A;  4XIG Q;  3PPO A;  1N3X A;  4R75 A;  1GGG A;  1MQI A;  4ESX A;  3V5A A;  1Y1Z A;  2VPO A;  1LCT A;  3D4C A;  1VE4 A;  5FBP A;  3DP6 A;  2OX3 A;  1VDW A;  3IK6 B;  4RK2 A;  3H6T A;  2NVU B;  4JVC A;  3HFU A;  4ZED A;  1VR5 A;  4XKQ A;  3C32 A;  3PMW A;  1UTH B;  4RA1 A;  1FJ6 A;  2HHM A;  2PBW A;  1A8F A;  2RCA A;  5TP9 A;  4IB2 A;  5H8F A;  1Y4C A;  1R1N A;  4X48 A;  3QUF A;  2E1S A;  2XXP A;  4O7I A;  3IX1 A;  1RDZ A;  5I5P A;  1FQE A;  3MP1 A;  5CBS A;  4U21 A;  5IM2 A;  2H25 A;  3S9N C;  1B58 A;  4Z0I A;  4IR8 A;  4GWW A;  1FBE A;  3QAX A;  4H0W A;  1ZU0 A;  3FBP A;  1FQB A;  3NOH A;  3EN3 A;  2DS9 A;  2ZZX A;  1DOT A;  3UN6 A;  3DEL B;  2F34 A;  1JVX A;  2D21 A;  5KZT A;  3KC1 A;  4N17 A;  3RNN A;  2HFB A;  5AA2 D;  2CMO A;  2QS4 A;  1NUZ A;  4OQO A;  4GWS A;  2Y7I A;  3OO8 A;  3LBS A;  4ZEC A;  4YU0 A;  3CRB A;  2L5V A;  4EF1 A;  1I6B A;  3U8Q A;  4GBV A;  5CMB A;  2R6G E;  3LUZ A;  3RPL B;  3L6G A;  4GQO A;  1B3E A;  2QFL A;  1KZ8 A;  4GIZ A;  1QUI A;  3TEP A;  4OES A;  3TOD A;  5ELV A;  4MNI A;  3C36 A;  3EKI A;  1FBF A;  4TOZ A;  3IJO B;  4KYS A;  4N6K A;  1MM7 A;  4F29 A;  1TXF A;  1MDQ A;  3RYD A;  4PTK A;  5LTC A;  2Y7K A;  2DWJ A;  2VT5 A;  1FTJ A;  1XHY A;  4P56 A;  3VDF A;  4OFJ A;  1F9B A;  3K2D A;  2QSX A;  4GWY A;  1B5H A;  3OXN A;  4XKN A;  5B7D A;  4OET A;  3N5L A;  1DK4 A;  4N91 A;  4GWZ A;  2HAU A;  2GHB A;  4MJO A;  4U23 A;  3ZS6 A;  4NAP A;  4NWC A;  2GHA A;  2XX8 A;  3PUY E;  1P1W A;  5JTY B;  3CFL A;  4GL8 A;  2XWO A;  5CI5 A;  1PB8 A;  3OSQ A;  4PFY A;  1FJ9 A;  3OOA A;  4OYV A;  4MAG A;  4MNC A;  3FXB A;  1TWY A;  5K2Y A;  5J1D A;  1BLF A;  3U92 A;  3M3L A;  1QVS A;  5AE4 A;  1JQF A;  1B3H A;  1FPG A;  2DSF A;  2O6A A;  4NF5 B;  5I3S A;  5A5L A;  1IQ7 A;  4G2Z A;  4KR5 A;  3W15 C;  4FBP A;  2XA5 A;  2V25 A;  3I3V A;  2V4C A;  1LBX A;  3MW0 A;  2H5Y A;  3HPI A;  5KCJ B;  4OVT A;  3R7X A;  4PFR A;  1B5I A;  1I6A A;  1FQA A;  1N3W A;  3FXR A;  3E78 A;  3A3U A;  4MMP A;  2X26 A;  4QFL A;  4F39 A;  4DCX A;  2CEX A;  4MBP A;  1MXZ A;  1LEV A;  1SQY A;  3IB1 A;  5DTB A;  2I3V A;  3OEN A;  3HST A;  2R71 A;  3S9M C;  1FPF A;  2DXY A;  2H98 A;  3Q27 A;  1A8E A;  2P2A A;  2AL5 A;  3P7I A;  3K6X A;  3IB2 A;  4OEV A;  4POW A;  4KFQ A;  1MXX A;  4R6K A;  3KJ7 A;  4NF4 A;  4E0W A;  4PDD A;  1MQD A;  1MRP A;  2XD3 A;  5LDZ A;  3CVG A;  1FBC A;  4P3L A;  1JNF A;  2HZL A;  1FSA A;  3KN8 A;  4F3S A;  2F7A A;  4WED A;  4OHN A;  3K1M A;  2Q2A A;  1QUL A;  3G3H A;  1MXY A;  4PDH A;  1M5C A;  5H8H B;  2ZNS A;  4YB7 A;  2I0C A;  1Q35 A;  1H3D A;  5AA4 B;  1MY0 A;  3IR1 A;  1EZP A;  5DEX B;  3KC0 A;  3HCQ A;  4NF6 B;  1XVX A;  4I40 A;  4MEV A;  5L9S A;  2I58 A;  3HO7 A;  2ONK E;  4EXK A;  1UTB A;  1LAX A;  4GD5 A;  3SES A;  3OMB A;  1UQW A;  4KQP A;  3HN0 A;  2QJE A;  3R6U A;  3ODB A;  3G7W A;  3UOR A;  3RT8 A;  5CRY A;  5KDT A;  3KSJ A;  3MUQ A;  1SW1 A;  2RC8 A;  3H4Z A;  4JSO A;  1DCU A;  2FYI A;  3MAM A;  5EYF A;  4RXL A;  1JEV A;  3FJ7 A;  1FPL A;  3KGC A;  4O8M A;  4P0G A;  4H5F A;  5FHM A;  2Z22 A;  1M5D A;  4PFU A;  3KBZ A;  4L17 A;  1ZLQ A;  3M3F A;  1AL3 A;  3HHG A;  4PFB A;  3T93 B;  4IGT A;  3LSX A;  3SEX A;  4I62 A;  4JDF A;  1USY H;  1KA0 A;  1MY3 A;  4THI A;  2JJK A;  4BDL A;  5ITP A;  3TMG A;  3FAT A;  4PCD A;  3BKI B;  3IO4 A;  3C33 A;  3H06 B;  4JSD A;  1HSE A;  2UXA A;  3M3K A;  5F1Q A;  1WDN A;  1MQH A;  1SD3 A;  1KWH A;  3L6H A;  2PVU A;  4O94 A;  2WBB A;  4QFN A;  1PDA A;  1FW0 A;  3HHF A;  1AH5 A;  3MC2 A;  1NNP A;  1ELJ A;  4MHF A;  4KCD A;  1B7U A;  1MY1 A;  2VGQ A;  4FIM A;  3B50 A;  4N81 A;  5BUU A;  1IXI A;  2HPG A;  3A3C A;  1HSJ A;  4UAC A;  3TTM A;  5JEI A;  3MBP A;  4G68 A;  3SET A;  3O28 A;  3K1P A;  4XKP A;  1INP A;  1B2H A;  1B1X A;  5ET8 A;  4QF9 A;  1B3L A;  1B5J A;  4ZE8 A;  3G3G A;  4OWD A;  3F11 A;  3OD7 A;  4Q8R A;  4ZZA A;  4PAK A;  1TFA A;  1IXC A;  3K00 A;  5H8F B;  1J1N A;  3IOV A;  2W7Y A;  1LB8 A;  2Z8E A;  4KYE A;  1XI6 A;  3K6W A;  4IO2 A;  4PET A;  3LSF B;  1P1O A;  4F18 A;  1LCF A;  4GVO A;  3TEL A;  5DVJ A; 
#chains in the Genus database with same CATH homology
 4GWY A;  4HE2 A;  4PFI A;  1NI9 A;  4OVS A;  4MNP A;  1D9Q A;  1FPD A;  5EQ9 A;  5F24 A;  2ZZV A;  5JK4 A;  2Q74 A;  2FHY A;  2WBD A;  1KA0 A;  5ET5 A;  2XWK A;  3U65 A;  2JJK A;  1DK4 A;  1IME A;  4GWZ A;  1FPE A;  4N91 A;  1NUY A;  5EYH A;  1EYI A;  5EYG A;  2F5X A;  4OVP A;  3W9V A;  2P3N A;  1NUW A;  1LBW A;  4JVI A;  1IMD A;  4MJO A;  4PCD A;  5I7I A;  1EYK A;  5IZ3 A;  3T0J A;  4GBW A;  3ROJ A;  1YXI A;  3IFC A;  2Q8M A;  4O7I A;  4PDD A;  2MKZ A;  4P47 A;  1FPJ A;  2FIE A;  4NAP A;  1RDZ A;  4OA4 A;  4GX3 A;  4HCW A;  3PTY A;  5I5P A;  5LDZ A;  1EYJ A;  1FBC A;  5IZ1 A;  2XWI A;  4X8R A;  3BIG A;  4P3L A;  4F1V A;  3QMF A;  4GWU A;  4GX4 A;  4O94 A;  2PFZ A;  5IM2 A;  1JP4 A;  2CZH A;  2WBB A;  2XWO A;  3ISP A;  5ESY A;  4IR8 A;  4JVD A;  1FTA A;  4GWW A;  1FBE A;  4NN3 A;  2F3D A;  1FSA A;  2HZL A;  5EQ7 A;  1FJ9 A;  1G0I A;  3FBP A;  4MAG A;  2KQZ A;  3E79 A;  4I3Y A;  3FXB A;  4M1V A;  4MHF A;  4MNC A;  4PBQ A;  1K9Y A;  1NV4 A;  3NOH A;  4YIC A;  5IZ3 B;  3MYU A;  4P8B A;  4XEQ A;  3B50 A;  4OVQ A;  4N8Y A;  1YYZ A;  4N81 A;  2GQ1 A;  4OAN A;  3A29 A;  1QGX A;  1FBD A;  2CZK A;  3GYY A;  2Y5L A;  2FBP A;  2QVV A;  4MX6 A;  2ZZX A;  4N6D A;  1RDX A;  2HPG A;  4H45 A;  1Q9D A;  5T3J A;  2QVU A;  4PDH A;  4N15 A;  5IZZ A;  4NGU A;  1NV7 A;  2QVR A;  2CEY A;  3KC1 A;  2XXK A;  4MIJ A;  4N17 A;  5CM6 A;  2FVZ A;  2KR0 A;  2DDK A;  1FBG A;  1FPG A;  1NV0 A;  2WEF A;  2R8T A;  5IGA A;  2HXR A;  1FPB A;  1INP A;  4HXV A;  2BJI A;  1IMA A;  1NUZ A;  2DE3 A;  4P1E A;  2OWZ A;  1K9Z A;  4GWS A;  1FBH A;  5I3S A;  4AS4 A;  2Q9T A;  5A5L A;  3KC0 A;  5ET8 A;  2CZI A;  4OVR A;  1DBZ A;  4QBA A;  4X04 A;  1RDY A;  1NV6 A;  5J1D A;  4I40 A;  5ET7 A;  1SPI A;  3CHG A;  1FPI A;  1CNQ A;  2L5V A;  4MEV A;  4PE3 A;  3W9W A;  1NV2 A;  2Y5K A;  5EQA A;  4NHB A;  4XFE A;  4NG7 A;  4FBP A;  4F18 A;  2XA5 A;  2ZZW A;  1IMB A;  1AWB A;  5EQ8 A;  4NF0 A;  4GBV A;  4HE0 A;  2WX9 A;  4PAF A;  2DVZ A;  2V3Q A;  2V4C A;  4NQ8 A;  1LBX A;  4PC9 A;  4I3E A;  1LBY A;  2VPO A;  3IFA A;  5ET6 A;  1FPK A;  4GWX A;  2PCR A;  2B4L A;  4LN5 A;  4OVT A;  4PAI A;  4PFR A;  3MST A;  3LUZ A;  4UAB A;  4DI3 D;  3RPL B;  1NV1 A;  2DE2 A;  2QFL A;  1LBV A;  1NV5 A;  4G61 A;  2XWV A;  1KZ8 A;  5FBP A;  4NX1 A;  4P9K A;  2OX3 A;  4PAK A;  1BK4 A;  4PBH A;  4PF6 A;  4PF8 A;  4X9T A;  3E78 A;  1VDW A;  1G0H A;  2HZK A;  4F1U A;  4MNI A;  1KA1 A;  4MMP A;  4O7M A;  1IMF A;  1DCU A;  4P1L A;  3SZP A;  4N8G A;  1FBP A;  4QXD A;  1IMC A;  1FBF A;  1FPL A;  2CEX A;  3EKI A;  4MCO A;  4O8M A;  3T1B A;  4HCY A;  2FIX A;  2QPQ A;  4DI4 B;  4JVC A;  1LEV A;  3B8B A;  3HFU A;  1XI6 A;  4N6K A;  3LV0 A;  4XF5 A;  4PGP A;  5DW8 A;  4PET A;  4F19 A;  3RYD A;  2P3V A;  3KBZ A;  4PTK A;  4AS5 A;  1NV3 A;  4HE1 A;  2F3B A;  4KXP A;  5J16 A;  2B4M A;  2DE4 A;  4N4U A;  2WYP A;  4YZZ A;  3BIH A;  5LTC A;  4GX6 A;  1FJ6 A;  2HHM A;  2VT5 A;  3D1R A;  1YZ0 A;  1FPF A;  4H46 A;  2PFY A;  3RPL A;  2WYK A;  4P56 A;  4PFB A;  1LBZ A;  4PGN A;  1FRP A;  1NUX A;  2VPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...