1IMCA

Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
266
structure length
266
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE
total genus 83
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1imcA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1imcA02
2PCRA 1RDZA 1JP4A 1NUWA 2VT5A 1LBWA 2DDKA 1EYIA 1FPBA 2WBBA 1FPGA 1FJ6A 1KZ8A 1NV3A 5EQAA 3RPLB 1FBPA 2WBDA 1K9YA 3KBZA 4HE1A 5EYHA 1FJ9A 1FBGA 5IZ3A 3A29A 1FTAA 4MJOA 3IFCA 2BJIA 2FBPA 3RYDA 4GBVA 1FPJA 5IZ3B 3FBPA 1IMEA 1IMFA 1LBVA 1NUXA 5A5LA 2OWZA 1NV1A 4PTKA 4IR8A 3RPLA 4KXPA 2JJKA 1IMDA 1NI9A 4GX6A 1G0IA 5EYGA 2QVVA 1FBFA 1NUYA 1D9QA 1RDYA 3LUZA 4GBWA 4QXDA 3T0JA 1INPA 2WEFA 4G61A 3ROJA 4GWYA 4H45A 2HHMA 2Y5LA 5ET7A 1DBZA 4GWXA 4GX3A 1EYJA 1IMCA 1LBYA 1FBDA 2CZIA 1YZ0A 1VDWA 1NUZA 4GWZA 1QGXA 1KA0A 4I40A 1YXIA 5EQ7A 1LBZA 2FIXA 4AS5A 1NV2A 2FHYA 5LDZA 1FPIA 1FPLA 5T3JA 4I3EA 4N81A 1XI6A 1BK4A 1FSAA 4AS4A 2CZKA 4HXVA 1FPDA 1IMAA 1FRPA 5EQ9A 5ET5A 5ET6A 3KC0A 5DW8A 4O7IA 2CZHA 1Q9DA 1YYZA 4HE2A 4I3YA 3BIGA 4GX4A 2F3BA 1FPEA 1K9ZA 1NV0A 1NV6A 1EYKA 2Q74A 4H46A 1AWBA 2Q8MA 1G0HA 3IFAA 3BIHA 5ESYA 5F24A 2F3DA 1FBCA 1IMBA 1DCUA 5ET8A 4GWUA 1RDXA 3QMFA 5IZ1A 1FBEA 1LEVA 2QVRA 4GWWA 5I3SA 4GWSA 1FPKA 1NV7A 2P3NA 4HE0A 2FIEA 2P3VA 2FVZA 1NV4A 5J16A 3D1RA 5EQ8A 2GQ1A 1SPIA 2QVUA 1LBXA 2Y5KA 3KC1A 4FBPA 1KA1A 1FBHA 3B8BA 2OX3A 1FPFA 2QFLA 5FBPA 1CNQA 1DK4A 1NV5A 3LV0A 2R8TA
chains in the Genus database with same CATH superfamily
2PCRA 1LAHE 4P47A 1JETA 5AA4B 3RPLB 2WBDA 1YPNA 2QMWA 1I6QA 5FTHA 3A29A 3QK6A 2Q8JA 1ZKBA 3PV0E 1XS5A 1SI0A 2DE4A 3N6UA 1OQGA 4JXIA 3B7DA 3VE1B 1SQYA 2KLFA 4KCDA 1H76A 2WEFA 2I3WA 4G61A 1B7ZA 2HQ0A 4O3BA 3ECRA 3A3UA 4ONYA 3EPEA 2WX9A 3MZBA 5EQ7A 2OPDA 3R7XA 3U8QA 4F1VA 1B9JA 3KJTA 4F2OA 2DE2A 4MCOA 1B0HA 4GQOA 5ET6A 3VXCA 3RT8A 1YYZA 4FORA 4NHBA 3WAFA 3IOVA 2I4CA 3N5LA 5DVFA 1MXYA 2PT2A 4NAPA 4YKIA 2P0SA 1BTJA 4HE0A 4OVRA 2P3VA 4ZEBA 5EQ8A 3TUSA 1P99A 3O2AA 1N7WA 1IUDA 1IXCA 1AOVA 2ANJA 2DSFA 1OMPA 3H4ZA 1Y4TA 2ESNA 3I6VA 2F6GA 1JEVA 3KZGA 3RN8A 2Z23A 3C9HA 1DMBA 4AQ4A 3UGWA 4OFJA 5A5XA 1FTJA 1SBPA 3SEWA 4EDPA 3FV1A 5A5XB 2HCAA 4R72A 4IY5A 4X04A 3JV9A 2QS4A 4U4XA 1IMFA 5LOMA 1B1HA 5CBSA 5I84A 5H8NA 4FJPA 4BLAA 4NWDA 1NI9A 3HHGA 3V83A 2P1SA 3EHUA 3U94A 2DWAA 4JSOA 2Y5LA 2WYKA 3Q26A 2R71A 3N6TA 4C1TA 4RPNA 5ET8A 5M2VA 3HSTA 3E13X 3C35A 3G3JA 4JDFA 1Y1ZA 2A5SA 1QULA 3K1NA 2ONRA 3VVFA 3O66A 1OLCA 3R26A 4O7MA 3D4GA 2DWHA 3H6TA 1RKMA 1UIUA 1TFAA 1P1OA 4PFUA 4OEVA 3T9HB 3VLWA 4H46A 4NF0A 2NOOA 4PBQA 2X26A 4GWOA 1QW0A 4ZEDA 4KI0E 4G68C 1NV4A 2CZLA 2I48A 4POWA 3H6WA 1FBHA 1Y4CA 4L17A 4EF1A 2DYXA 2F7BA 4F1UA 2O68A 1SYIA 2VT5A 4Z0IA 4MBPA 5DYHA 3RNNA 1M5BA 4H8JA 4YB5A 4EXLA 4U21A 3TYHA 2PVUA 3O6HA 4N15A 4E0WA 1URSA 4KPTA 4RK9A 1MPBA 4HCWA 1NH7A 2XXQA 1EH3A 4YKJA 3NOHA 1N84A 2OCUA 2V93A 3FV2A 3QAXA 1UTHA 4NF4A 4XXUA 3TCFA 5L9SA 1NFTA 2GFEA 2Z8FA 3TTLA 2Z8DA 5JTYB 1NKXA 3SZPA 5CRYA 3FZVA 3IO4A 4RYAA 5KZTA 4R6YA 1H45A 1M5CA 5I2NB 1IMCA 2FHYA 1FPIA 5T3JA 4OVPA 4I62A 2VP1A 5H8NB 5ITPA 4RK2A 4QSDA 1Q9DA 4I3YA 4N6DA 2RKMA 1ATGA 2PYYA 1UTHB 3S9EA 4QSCA 5I58B 2V84A 1IMBA 3S4UA 2BJJX 1RDXA 3CG1A 4PDDA 4PE3A 5TU0A 5AA1A 5H8QB 3FATA 1MQDA 3TKDA 2AL4A 4N13A 4RA1A 3IX1A 3LV0A 4OXVA 1EYIA 2GHBA 3IK6B 1SVXB 1FJ9A 4OHNA 4NF5B 1FBGA 1LB8A 3EHSA 5JTYA 4R9GA 1ELJA 4LUBA 2XXPA 3S2VA 5HBCA 5ICQA 3DLNA 3OO7A 4G2ZA 2UVJA 1Y20A 4QF9A 2PBWA 3MUQA 2KR0A 3PMXA 1WODA 2PFYA 3TEPA 3CI8A 3MVWA 4MMPA 3HPIA 1BLFA 1EYJA 2YLNA 4TQUQ 1SW5A 2QMXA 4KQPA 3KOTA 4PF6A 2F34A 2AL5A 2XX8A 2V4CA 3LSFB 4KYEA 1DSNA 2HZLA 2YPNA 1AMFA 3BFTA 2O7UA 3EQ1A 4BDOA 2F35A 1GGGA 2H25A 2Q8MA 4ZEIA 4DXBA 2P2AA 4QFPA 3OSQA 4F22A 4NF4B 1LCTA 2XHDA 1L5TA 1URGA 1FPKA 1XHYA 1AH5A 3T1BA 2ZNTA 3DM0A 1OVBA 2NVUB 2H4IA 2QFLA 3DP4A 1CNQA 3L6GA 1B3GA 4ZEKA 5AA2B 1B52A 3FXBA 1A7LA 1LBBA 1PEBA 3HCQA 4Z7EA 4EUOA 3QIMA 3K6UA 5EYFA 3ZKLA 1M5DA 4MNCA 4DE8A 3IFCA 2Z22A 4ZDMA 4KYSA 1Y3NA 1LAGE 5CMKA 1LB9A 4QSEA 2RCAA 1J1NA 1B7HA 2I0CA 3ILTB 2PT1A 1JVXA 3M3KA 1DPPA 1US5A 1RDYA 1JW5A 3C32A 3TQLA 2OWSA 1DBZA 4HCYA 2VD3A 3M3LA 4OVTA 4Q8RA 2DWJA 3O29A 2CZIA 1NNTA 1KA0A 1BP5A 3I3VA 2D5WA 2GH9A 2OZZA 3R6UA 1YCJA 2ZZVA 3I5OA 1SW1A 1MY0A 3KN8A 3VXBA 3MQ9A 1P1WA 3C36A 3FASA 4YU0A 2R6GE 2Q74A 4HS7A 4YMBA 3MWBA 4KFQA 5HPQA 4P3LA 3KOSA 2XXKA 3FIRA 1FBEA 3B6WA 4GWWA 4OQOA 1I69A 3RPWA 2P3NA 3G3GA 1VR5A 3IB1A 3K1PA 2Y5KA 3PPNA 3OO9A 5FBPA 3CRBA 2R8TA 3LUYA 4NF6A 4ELOA 4YMAA 4PAFA 2WBBA 1JW4A 4LONB 3EF7A 4YZZA 2RC7A 3Q29A 3T9UA 3TZAA 1MXUA 4IGRA 3CSGA 2FBPA 3Q25A 5IGAA 5CBRA 3MBPA 2Y84A 4M4GA 2OWZA 5L8DA 4PTKA 1N0TA 1B3LA 4GX6A 4R6KA 1XC1A 1FBFA 3LUZA 4GBWA 1N76A 3L6HA 4LQ2A 3E3KA 2QS3A 3EN3A 2RINA 4F18A 1JEUA 1B5JA 4PGNA 4F3BA 4PFWA 3TCGA 3VLUA 1BK4A 2V3QA 4PFRA 3VVDA 3O9PA 4DCXA 2WYPA 5KDTA 2Q2CA 3GXAA 4JVIA 2XD3A 5IAIA 1B6HA 3ONMA 3VVEA 4H8IA 3C34A 3BIHA 2NWJA 1AIVA 1CE2A 1B4ZA 2QVRA 3SDFA 1GVCA 2ZMBA 1O63A 4AB6A 3LSLA 1H43A 4H1XA 3KC1A 4MFIA 5CMMA 4E0XA 4FEBA 2RCBA 1FPFA 2PMSA 1DK4A 1S9TA 1IQ7A 2DDKA 3KGCA 4HTGA 3O28A 1S7YA 4MIJA 1FJ6A 2OPEA 5I59B 3KBZA 5L9MA 3B50A 3CG3A 2OLBA 1IIWA 4X48A 1DTGA 1FTAA 1D9YA 4H0WA 4R2FA 1FQAA 1IMEA 2Z8EA 1QJMA 1ZIUA 4ELRA 3GYYA 1IZ1A 3SETA 1NNPA 2QVVA 1DPEA 3E79A 3WAEA 4X1BA 3K02A 2ZNUA 5FHOA 1MQJA 5FHMA 3ODBA 1I6BA 2I58A 1YZ0A 4NX1A 4DIGA 3SEUA 2B4MA 3MW0A 2XXRA 1USYE 3G3FA 3S9LC 1OIBA 1D3KA 1IXHA 5JK4A 2QRYA 4UA8A 4R75A 4ZZEA 4I1DA 4BDRA 4OZ9A 4N8YA 4XEQA 4U23A 1FW0A 5TP9A 1NNKA 1TFDA 4IO6A 1AWBA 5H8HB 2HZKA 3PU5A 4EQBA 5H8QA 3MVXA 2B3FA 4P8BA 4XKPA 2HXWA 2XXVA 5IZ1A 5I3SA 3OELA 4ZEFA 4IY6A 4P1EA 3SESA 4Q0CA 1POTA 2DXYA 5TPAA 3Q28A 4OA4A 2XX7A 2OX3A 4GBVA 1NV5A 2ZXTA 2D21A 1MPDA 4MHFA 1FPBA 4MF3A 4NF6B 1ZMGA 4HE1A 1LLSA 3A09A 4N4UA 4U1ZA 2DQVA 4H5GA 1NUXA 2VOZA 4OWDA 4LZ5A 3O6GA 1A99A 3AXFA 5K2XA 5FHNA 3T0JA 1HSLA 2H99A 1MXZA 4PFYA 5LTCA 3W9VA 3UORA 1VDWA 3HHFA 1NUZA 1PDAA 1LBZA 4P0IA 4IGTA 1GR2A 4JWOA 3FXQA 4LN5A 3UP9A 4ZECA 4GLIA 1Y9UA 4FATA 3U72A 2DXRA 2XD2A 5ET5A 4KCCA 3CVGA 4RNSA 3K6XA 3MVZA 2B3BA 5H8FA 1EYKA 1Q1KA 3QSLA 3IFAA 2XWIA 4PFBA 4RPOA 3MSTA 1P1NA 4X8RA 2ZYKA 3VFJA 3FUZA 5B7DA 1SI1A 1Y1MA 1MQHA 3G7WA 3SEYA 1TWYA 4FAJA 3TPAA 1FQBA 4G8NA 4C1UA 4XKNA 3OSRA 1JP4A 4G4PA 4ZS9A 5TP9B 1LBWA 3D4CA 2I0BA 1MRPA 2HPGA 1KZ8A 1VSOA 4U2RA 1K9YA 1F9BA 1FTOA 2M8CA 4DCYA 1WVJA 2F36A 3H06B 4BDQA 3PPPA 1XOCA 3USDA 1NNFA 4NN3A 1TXFA 2RC9A 3VLVA 1MXXA 4ND9A 4KXPA 3KJ7A 4U4SA 3E78A 2QJEA 1LBCA 5F1QA 3ROJA 3Q27A 3U93A 4H45A 3FJ7A 4GFRA 5ET7A 2O84X 2PX1A 3SEVA 2A5TA 4GVOA 1MQIA 2FA7A 4H5FA 1A40A 2O51A 5DVJA 2H9BA 2FIXA 4OETA 1QUJA 3W15C 4QFOA 3ISPA 5DVIA 3ZSFA 1MXWA 4FE8A 2Y7WA 4OMBA 3MAMA 4G68B 3GBBA 3O6IA 2RF1A 3U1OA 5I57B 3KC0A 1B3HA 4OVQA 1B7UA 4XTCQ 3SEXA 3FVGA 3FJGA 5ESYA 1USYH 3BBRA 3PD9A 3K6WA 4O94A 4PF8A 2UVGA 2X7QA 2VD2A 4FIMA 1A55A 2GHAA 4ELPA 5B70A 1NV7A 3IJXB 4P9KA 4JB7A 2UXAA 1SPIA 3IR1A 1A8FA 3PPRA 5DEXB 2Q89A 1B3EA 4PCDA 1LFHA 3ZS6A 2XXHA 2NXOA 1UTBB 1NUWA 1VFEA 4PFTA 2G93A 1NV3A 5AA4A 4PFIA 3PUVE 4M1VA 4H67A 4DDDA 2UVIA 4YB6A 4NF8A 3TTRA 4MJOA 4YKKA 3FJMA 3W9WA 2HXRA 2QSXA 2MKZA 3K4UA 5I59A 1PBPA 1H44A 4OVSA 5L9OA 1FQFA 2H5YA 3PUXE 4N8GA 5IM2A 1LAFE 4R73A 1JQFA 4DLDA 4F31B 5AE4A 1POY1 3P7IA 5H8HA 2HHMA 1PB7A 1O7TA 2VPNA 4F2QA 1DOTA 4ESWA 4GXAA 5I58A 2REJA 1OVTA 2OWTA 3K1MA 1US4A 2ZYMA 4IO5A 4Q5TA 1MH4A 3EHTA 3QUJA 1N3XA 3LSXA 4O7IA 2PFZA 4F39A 4HE2A 3IAZA 5CM6A 2F3BA 1FPEA 1NV6A 4PE5B 5HM4B 4LATA 2F3DA 5JEIA 5EHSA 4KR5A 3E4RA 3CFZA 1MG1A 1Z7NE 1QVSA 4IO4A 4R9FA 1MY4A 1M5EA 4IO3A 4OANA 1RYOA 4OENA 3D1RA 4NF8B 2QVUA 3OEMA 1KA1A 4NG7A 3GBAA 5F24A 3PPQA 2QL3A 5EQAA 2ZYNA 1ZTYA 1D9VA 3G3KA 2XXUA 3S9MC 1IXGA 5DT6A 4G77A 2REGA 1YTVA 3BFUA 4QFKA 4WEPA 3T22A 3TODA 1FPJA 1LFGA 3FBPA 1N7XA 3MZ9A 3GLBA 1FTKA 1B46A 3K2DA 4F19A 1B1XA 1G0IA 2Q9TA 3KG2A 3TTKA 4H65A 4P11A 5KCJA 4YICA 4YKPA 1MDP1 1B40A 1QGXA 5AA2A 3UIFA 5I2KA 4PGPA 4X9TA 1FPLA 4EQ7A 5I2KB 3TTMA 3KBRA 4F1YA 4AS4A 3FXUA 4TOZA 2W7YA 5EQ9A 2Q2AA 3HFUA 4U1OA 4Q30B 4MNIA 4MLVA 3LR1A 1B5HA 3H03A 3B6QA 2QS1A 3OENA 4NTLA 1IEJA 1N04A 1G0HA 2X7PA 4QBAA 4XKRA 4R74A 3UK4A 4P56A 4FEDA 4WXJA 1R6ZA 2DS9A 2UVHA 4NWCA 1VE4A 4N17A 4XF5A 1Y3PA 3IO6A 3LC8A 3RY3A 1M5FA 3K00A 4PDHA 1PB8A 1VFDA 1URDA 3F11A 4NGUA 5KDTB 1YAEA 2GRVA 4PBHA 1XT8A 3KFMA 3RLFE 2DE3A 4N91A 3IJOB 3RYDA 4ZE9A 2F6PA 5I2NA 2VHAA 4DXUA 5ICTA 4H6DA 2WKYA 3MP8A 1B4HA 1B5IA 1WDNA 4WEDA 2B4LA 5CI5A 3IOTA 1CB6A 1NUYA 4QXDA 1EZOA 2HEUA 4ELQA 1ANFA 3T93B 2ZZXA 4IO7A 5ELVA 1B51A 1LAXA 3N94A 4LA9A 4PAKA 3O97A 4EXKA 4GWZA 2QPQA 4TLLB 2XXXA 4F3PA 1MM7A 2XX9A 2ZNSA 1MXVA 1FQCA 3EKIA 4G8MA 2G29A 2IEEA 1T0KA 1R1NA 3QUFA 3V89B 1XVXA 4NF5A 2O69A 3FGSA 1FRPA 1SD3A 1PB9A 2XWOA 2O1LA 2CZHA 2Y7PA 1P1UA 5IKBA 1B2HA 2ABHA 3H3GA 4N6PA 5ITOA 5DEXA 2I3VA 4GWUA 4WKMA 4MH5A 3RUMA 3THIA 2FVZA 3U92A 4X1DA 4GD5A 4OERA 3MPLA 5FTIA 2D3IA 3T66A 3VDFA 1QKBA 5AA3A 2XXTA 3QYTA 1FPGA 3T96B 1FBPA 4YB7A 5DTBA 2CEYA 3MYUA 4MLQA 1SW4A 3FVNA 4IO2A 2BJIA 4XKQA 1NL5A 3TDJA 4GIZA 1MQGA 1LBVA 3IOUA 2Y7IA 1NV1A 4IR8A 3PUZE 3M3FA 2JJKA 4NEDA 1R9QA 3KEIA 2ALUA 1INPA 5BUUA 4NQ8A 1MM6A 1ZLQA 4GF8A 2AYSA 4PP0A 2V25A 4FECA 4QHQA 5H8SA 3OOAA 3OO6A 3T9VA 2FYIA 4TLMB 3KN7A 4EQ9A 1BKAA 3ILUB 4RXLA 1XVYA 1GV8A 1FSAA 3JZJA 1A8EA 2CZKA 2Y7RA 1ZJLA 1FPDA 1FCKA 2I4BA 2F5XA 4KYDA 4ISUA 1MH3A 2DP8A 1Q35A 4ZZAA 1TT1A 4MAGA 4IB2A 3RGYA 5I5PA 3T9XB 2ZZWA 4F29A 2XXWA 1B05A 4OYVA 1LEVA 4GWSA 2F7AA 3DP8A 4HW8A 2FIEA 2O1MA 2VPOA 4DXCA 3CIJA 1LBXA 3TTNA 2XWVA 1JVYA 2ONKE 2F97A 2XXIA 3FXRA 2ONSA 4GOTA 3C31A 4N07A 4O8MA 5F7VA 4THIA 1RDZA 2R9JA 3CR9A 1BIYA 4JWYA 2L5VA 1JW1A 3MP6A 2A5TB 1EZ9A 5IZ3A 4OFLA 4PQJA 4ECFA 1UQWA 4K3FA 3HV1A 3U65A 1LSTA 3GZGA 3KSJA 1FQEA 1EU8A 2E0SA 3KN3A 3M8UA 1UIVA 3TELA 1PBQA 4F3GA 4GXSB 3QXMA 4BDNA 1LCFA 1MY2A 3FVOA 4GL0A 2HAVA 3C33A 4QRZA 3TQWA 2E1SA 3IORA 3RTFB 4MNPA 3MPKA 2VGQA 2I49A 5ISUA 3PGFA 4UACA 1FBDA 4I8CA 3K6VA 3RQTA 1YXIA 4R2BA 2OJTA 1RYXA 4AS5A 1HSEA 1GTKA 1NV2A 3IOWA 3CFLA 4MX6A 2QS2A 3BKIB 1FQDA 4OEUA 3C4MA 1HSJA 1SYHA 2CEXA 3G3HA 1B3FA 1NV0A 1SDXA 4LQ5A 4G68A 2FNCA 1ZBMA 4LZ8A 5I7IA 1S50A 3ZKKA 3MP1A 1DCUA 1D4NA 2B65A 4P1LA 5EHMA 3PUYE 1UTBA 3PTYA 3TFLA 3UA8A 4KHZE 4P0GA 1B0LA 2V3TA 4LP2B 3V8XB 3RT6B 2UYEA 3DP6A 5I57A 4PETA 1JNFA 4DI3D 1QUKA 5EYHA 4POXA 1Y3QA 3RTWB 4OVJA 4DZ1A 4GL8A 1B32A 2CMOA 5CC2A 3KSXA 4JWXA 1LFIA 3H7MA 3K0VA 1OQHA 3OMBA 4UABA 2F7CA 2YJPA 5A5LA 4BDLA 2Q88A 1IMDA 1H3DA 3N26A 4O3AA 3UN6A 5EYGA 4MEVA 2AIXA 1PC3A 2DVZA 4LZ7A 4RY1A 4DI4B 1A54A 1P1QA 3JYRA 2ZYOA 1MS7A 4JVDA 1O64A 2KQZA 2IA4A 4I40A 1N3WA 3TMGA 3OD7A 5LDZA 2OBGA 3IL1B 2XA5A 1XI6A 3PPOA 4HXVA 2XXYA 3SERA 1LGBC 1II5A 2OK2A 4NE4A 4O3CA 2V3UA 4NMYA 4GX4A 2UYFA 2I6EA 3CHGA 4JBZA 1FBCA 5IZZA 3QMFA 4RJZA 1IXIA 4YAHX 3H6VA 1IITA 4ZE8A 1MDQA 1ZU0A 4PAIA 2GQ1A 3V5AA 4AB5A 1NH8A 1FTLA 3MJNA 3B8BA 3E9XA 4QFNA 3IB0A 4ESXA 4OTEA 1AL3A 4G8HA 4JSDA 3SKPA 4XIGQ 1DTZA 4EF2A 2DWIA 5J1DA 1Z7ME 1I6AA 4JVCA 4QFLA 3FD3A 2Y7KA 5TPAB 1FTMA 5IZ3B 3H6UA 3HO7A 1MPCA 5KCJB 3FVKA 3RPLA 1QUIA 5K2YA 4C0RA 4GRKA 2LAOA 2HAUA 1EZPA 4U22A 1D9QA 3HN0A 1MY1A 1OLAA 4OFOA 1QKAA 4N6KA 4GWYA 2H98A 5BWJA 1KWHA 4GWXA 4GX3A 1LBYA 4KD5A 3VV5A 2DVCA 1R9LA 4LVQA 5I56A 3S9NC 3OEKA 4BDMA 5I56B 5CMCA 3TAJA 4I3EA 4N81A 2F8DA 3PMVA 1B58A 3TCHA 5AA2D 1IMAA 3LSWA 5DW8A 3CFXA 2O7IA 3BIGA 3OO8A 1K9ZA 4I9DA 1MY3A 3LBSA 3K01A 4R6HA 3IB2A 4OESA 3DELB 3MZ1A 5CMBA 3MC2A 2XWKA 3CSBA 2RC8A 4PC9A 2NUVA 3A3CA 3PMWA 1SW2A 2DOJA 4F3SA 1NMUA 3B6TA 5J16A 3PD8A 3G3IA 4FBPA 2HFBA 2F78A 3OXNA 3MVYA 3PUWE 4XFEA 2O6AA 2THIA 5H8FB
chains in the Genus database with same CATH topology
2PCRA 1RDZA 1JP4A 4MHFA 1NUWA 4NGUA 2VT5A 4P47A 1LBWA 3FXBA 2DDKA 1EYIA 4PAFA 1FPBA 2WBBA 2L5VA 4PBHA 2HPGA 4PETA 1FPGA 1FJ6A 1KZ8A 1NV3A 5EQAA 3RPLB 4MIJA 1FBPA 2WBDA 1K9YA 3KBZA 4PFIA 2DE3A 3B50A 4M1VA 4YZZA 4HE1A 5EYHA 2CEYA 4N4UA 1FJ9A 1FBGA 3MYUA 4N91A 5IZ3A 5J1DA 4JVCA 3A29A 1FTAA 4MJOA 4MNCA 3W9WA 3IFCA 2BJIA 2FBPA 2HXRA 3RYDA 4GBVA 4N15A 4X04A 5IGAA 2MKZA 1FPJA 5IZ3B 4HCWA 3FBPA 4NN3A 3U65A 1IMEA 1IMFA 1LBVA 1NUXA 4UABA 5A5LA 4OVSA 2OWZA 1NV1A 3NOHA 4PTKA 4IR8A 3RPLA 4KXPA 2DE4A 4F19A 2JJKA 1IMDA 2WX9A 1NI9A 4GX6A 3GYYA 1G0IA 2KR0A 4N8GA 5IM2A 2Q9TA 3E78A 5EYGA 2B4LA 2QVVA 4MEVA 2PFYA 1FBFA 1NUYA 1D9QA 1RDYA 3LUZA 4GBWA 4QXDA 3T0JA 1INPA 2WEFA 2DVZA 3E79A 4DI4B 4G61A 4NQ8A 3SZPA 3ROJA 5LTCA 4N6KA 4GWYA 4H45A 2HHMA 2Y5LA 2WYKA 2ZZXA 5ET7A 4JVDA 3W9VA 4YICA 1DBZA 4HCYA 4MNPA 2VPNA 4OVTA 4GWXA 4MMPA 4GX3A 2KQZA 4F18A 4PAKA 1EYJA 1IMCA 1LBYA 1FBDA 2CZIA 1YZ0A 1VDWA 1NUZA 4GWZA 1QGXA 1KA0A 4I40A 1YXIA 5EQ7A 2QPQA 4NX1A 1LBZA 2B4MA 2FIXA 4AS5A 4PGPA 1NV2A 4PGNA 3ISPA 2FHYA 5LDZA 4MX6A 1FPIA 4X9TA 1FPLA 5T3JA 4F1VA 3EKIA 4I3EA 4LN5A 4N81A 2XA5A 4OVPA 4PF6A 1XI6A 1BK4A 2V3QA 4PFRA 1FSAA 4AS4A 2V4CA 2ZZVA 2CZKA 4HXVA 5JK4A 2DE2A 4O7MA 2WYPA 4MCOA 1FPDA 1IMAA 1FRPA 5EQ9A 5ET5A 5ET6A 3HFUA 3KC0A 5DW8A 4O7IA 2F5XA 2XWOA 2CZHA 2HZLA 2PFZA 4N8YA 4MNIA 1Q9DA 1YYZA 4JVIA 4XEQA 4HE2A 4I3YA 4N6DA 2CEXA 3BIGA 4GX4A 2F3BA 1FPEA 1K9ZA 4OVQA 4DI3D 5CM6A 1NV0A 1NV6A 1EYKA 4NHBA 2Q74A 4H46A 1AWBA 2Q8MA 4NF0A 2HZKA 3CHGA 1G0HA 4MAGA 3IFAA 2XWIA 4PFBA 3BIHA 5ESYA 5F24A 3MSTA 4PBQA 4QBAA 2F3DA 4P8BA 4P3LA 5I7IA 2XXKA 4X8RA 5I5PA 2XWKA 4O94A 4PF8A 1FBCA 1IMBA 1DCUA 5ET8A 4PC9A 4GWUA 4P56A 5IZZA 1RDXA 3QMFA 5IZ1A 2ZZWA 1FBEA 1LEVA 2QVRA 4P1LA 4GWWA 5I3SA 4PDDA 4GWSA 4NAPA 4PE3A 1FPKA 4O8MA 1NV7A 2P3NA 4OANA 4HE0A 3PTYA 2FIEA 2P3VA 4N17A 4OVRA 4P1EA 4P9KA 4XF5A 2FVZA 2VPOA 1NV4A 5J16A 3D1RA 4PAIA 5EQ8A 2GQ1A 3T1BA 1SPIA 2QVUA 1LBXA 2Y5KA 3KC1A 4PDHA 2XWVA 4FBPA 1KA1A 1FBHA 4OA4A 4PCDA 3B8BA 4NG7A 2OX3A 1FPFA 2QFLA 5FBPA 4XFEA 4F1UA 1CNQA 1DK4A 1NV5A 3LV0A 2R8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PCR A;  1RDZ A;  1JP4 A;  1NUW A;  2VT5 A;  1LBW A;  2DDK A;  1EYI A;  1FPB A;  2WBB A;  1FPG A;  1FJ6 A;  1KZ8 A;  1NV3 A;  5EQA A;  3RPL B;  1FBP A;  2WBD A;  1K9Y A;  3KBZ A;  4HE1 A;  5EYH A;  1FJ9 A;  1FBG A;  5IZ3 A;  3A29 A;  1FTA A;  4MJO A;  3IFC A;  2BJI A;  2FBP A;  3RYD A;  4GBV A;  1FPJ A;  5IZ3 B;  3FBP A;  1IME A;  1IMF A;  1LBV A;  1NUX A;  5A5L A;  2OWZ A;  1NV1 A;  4PTK A;  4IR8 A;  3RPL A;  4KXP A;  2JJK A;  1IMD A;  1NI9 A;  4GX6 A;  1G0I A;  5EYG A;  2QVV A;  1FBF A;  1NUY A;  1D9Q A;  1RDY A;  3LUZ A;  4GBW A;  4QXD A;  3T0J A;  1INP A;  2WEF A;  4G61 A;  3ROJ A;  4GWY A;  4H45 A;  2HHM A;  2Y5L A;  5ET7 A;  1DBZ A;  4GWX A;  4GX3 A;  1EYJ A;  1IMC A;  1LBY A;  1FBD A;  2CZI A;  1YZ0 A;  1VDW A;  1NUZ A;  4GWZ A;  1QGX A;  1KA0 A;  4I40 A;  1YXI A;  5EQ7 A;  1LBZ A;  2FIX A;  4AS5 A;  1NV2 A;  2FHY A;  5LDZ A;  1FPI A;  1FPL A;  5T3J A;  4I3E A;  4N81 A;  1XI6 A;  1BK4 A;  1FSA A;  4AS4 A;  2CZK A;  4HXV A;  1FPD A;  1IMA A;  1FRP A;  5EQ9 A;  5ET5 A;  5ET6 A;  3KC0 A;  5DW8 A;  4O7I A;  2CZH A;  1Q9D A;  1YYZ A;  4HE2 A;  4I3Y A;  3BIG A;  4GX4 A;  2F3B A;  1FPE A;  1K9Z A;  1NV0 A;  1NV6 A;  1EYK A;  2Q74 A;  4H46 A;  1AWB A;  2Q8M A;  1G0H A;  3IFA A;  3BIH A;  5ESY A;  5F24 A;  2F3D A;  1FBC A;  1IMB A;  1DCU A;  5ET8 A;  4GWU A;  1RDX A;  3QMF A;  5IZ1 A;  1FBE A;  1LEV A;  2QVR A;  4GWW A;  5I3S A;  4GWS A;  1FPK A;  1NV7 A;  2P3N A;  4HE0 A;  2FIE A;  2P3V A;  2FVZ A;  1NV4 A;  5J16 A;  3D1R A;  5EQ8 A;  2GQ1 A;  1SPI A;  2QVU A;  1LBX A;  2Y5K A;  3KC1 A;  4FBP A;  1KA1 A;  1FBH A;  3B8B A;  2OX3 A;  1FPF A;  2QFL A;  5FBP A;  1CNQ A;  1DK4 A;  1NV5 A;  3LV0 A;  2R8T A; 
#chains in the Genus database with same CATH topology
 2PCR A;  1LAH E;  4P47 A;  1JET A;  5AA4 B;  3RPL B;  2WBD A;  1YPN A;  2QMW A;  1I6Q A;  5FTH A;  3A29 A;  3QK6 A;  2Q8J A;  1ZKB A;  3PV0 E;  1XS5 A;  1SI0 A;  2DE4 A;  3N6U A;  1OQG A;  4JXI A;  3B7D A;  3VE1 B;  1SQY A;  2KLF A;  4KCD A;  1H76 A;  2WEF A;  2I3W A;  4G61 A;  1B7Z A;  2HQ0 A;  4O3B A;  3ECR A;  3A3U A;  4ONY A;  3EPE A;  2WX9 A;  3MZB A;  5EQ7 A;  2OPD A;  3R7X A;  3U8Q A;  4F1V A;  1B9J A;  3KJT A;  4F2O A;  2DE2 A;  4MCO A;  1B0H A;  4GQO A;  5ET6 A;  3VXC A;  3RT8 A;  1YYZ A;  4FOR A;  4NHB A;  3WAF A;  3IOV A;  2I4C A;  3N5L A;  5DVF A;  1MXY A;  2PT2 A;  4NAP A;  4YKI A;  2P0S A;  1BTJ A;  4HE0 A;  4OVR A;  2P3V A;  4ZEB A;  5EQ8 A;  3TUS A;  1P99 A;  3O2A A;  1N7W A;  1IUD A;  1IXC A;  1AOV A;  2ANJ A;  2DSF A;  1OMP A;  3H4Z A;  1Y4T A;  2ESN A;  3I6V A;  2F6G A;  1JEV A;  3KZG A;  3RN8 A;  2Z23 A;  3C9H A;  1DMB A;  4AQ4 A;  3UGW A;  4OFJ A;  5A5X A;  1FTJ A;  1SBP A;  3SEW A;  4EDP A;  3FV1 A;  5A5X B;  2HCA A;  4R72 A;  4IY5 A;  4X04 A;  3JV9 A;  2QS4 A;  4U4X A;  1IMF A;  5LOM A;  1B1H A;  5CBS A;  5I84 A;  5H8N A;  4FJP A;  4BLA A;  4NWD A;  1NI9 A;  3HHG A;  3V83 A;  2P1S A;  3EHU A;  3U94 A;  2DWA A;  4JSO A;  2Y5L A;  2WYK A;  3Q26 A;  2R71 A;  3N6T A;  4C1T A;  4RPN A;  5ET8 A;  5M2V A;  3HST A;  3E13 X;  3C35 A;  3G3J A;  4JDF A;  1Y1Z A;  2A5S A;  1QUL A;  3K1N A;  2ONR A;  3VVF A;  3O66 A;  1OLC A;  3R26 A;  4O7M A;  3D4G A;  2DWH A;  3H6T A;  1RKM A;  1UIU A;  1TFA A;  1P1O A;  4PFU A;  4OEV A;  3T9H B;  3VLW A;  4H46 A;  4NF0 A;  2NOO A;  4PBQ A;  2X26 A;  4GWO A;  1QW0 A;  4ZED A;  4KI0 E;  4G68 C;  1NV4 A;  2CZL A;  2I48 A;  4POW A;  3H6W A;  1FBH A;  1Y4C A;  4L17 A;  4EF1 A;  2DYX A;  2F7B A;  4F1U A;  2O68 A;  1SYI A;  2VT5 A;  4Z0I A;  4MBP A;  5DYH A;  3RNN A;  1M5B A;  4H8J A;  4YB5 A;  4EXL A;  4U21 A;  3TYH A;  2PVU A;  3O6H A;  4N15 A;  4E0W A;  1URS A;  4KPT A;  4RK9 A;  1MPB A;  4HCW A;  1NH7 A;  2XXQ A;  1EH3 A;  4YKJ A;  3NOH A;  1N84 A;  2OCU A;  2V93 A;  3FV2 A;  3QAX A;  1UTH A;  4NF4 A;  4XXU A;  3TCF A;  5L9S A;  1NFT A;  2GFE A;  2Z8F A;  3TTL A;  2Z8D A;  5JTY B;  1NKX A;  3SZP A;  5CRY A;  3FZV A;  3IO4 A;  4RYA A;  5KZT A;  4R6Y A;  1H45 A;  1M5C A;  5I2N B;  1IMC A;  2FHY A;  1FPI A;  5T3J A;  4OVP A;  4I62 A;  2VP1 A;  5H8N B;  5ITP A;  4RK2 A;  4QSD A;  1Q9D A;  4I3Y A;  4N6D A;  2RKM A;  1ATG A;  2PYY A;  1UTH B;  3S9E A;  4QSC A;  5I58 B;  2V84 A;  1IMB A;  3S4U A;  2BJJ X;  1RDX A;  3CG1 A;  4PDD A;  4PE3 A;  5TU0 A;  5AA1 A;  5H8Q B;  3FAT A;  1MQD A;  3TKD A;  2AL4 A;  4N13 A;  4RA1 A;  3IX1 A;  3LV0 A;  4OXV A;  1EYI A;  2GHB A;  3IK6 B;  1SVX B;  1FJ9 A;  4OHN A;  4NF5 B;  1FBG A;  1LB8 A;  3EHS A;  5JTY A;  4R9G A;  1ELJ A;  4LUB A;  2XXP A;  3S2V A;  5HBC A;  5ICQ A;  3DLN A;  3OO7 A;  4G2Z A;  2UVJ A;  1Y20 A;  4QF9 A;  2PBW A;  3MUQ A;  2KR0 A;  3PMX A;  1WOD A;  2PFY A;  3TEP A;  3CI8 A;  3MVW A;  4MMP A;  3HPI A;  1BLF A;  1EYJ A;  2YLN A;  4TQU Q;  1SW5 A;  2QMX A;  4KQP A;  3KOT A;  4PF6 A;  2F34 A;  2AL5 A;  2XX8 A;  2V4C A;  3LSF B;  4KYE A;  1DSN A;  2HZL A;  2YPN A;  1AMF A;  3BFT A;  2O7U A;  3EQ1 A;  4BDO A;  2F35 A;  1GGG A;  2H25 A;  2Q8M A;  4ZEI A;  4DXB A;  2P2A A;  4QFP A;  3OSQ A;  4F22 A;  4NF4 B;  1LCT A;  2XHD A;  1L5T A;  1URG A;  1FPK A;  1XHY A;  1AH5 A;  3T1B A;  2ZNT A;  3DM0 A;  1OVB A;  2NVU B;  2H4I A;  2QFL A;  3DP4 A;  1CNQ A;  3L6G A;  1B3G A;  4ZEK A;  5AA2 B;  1B52 A;  3FXB A;  1A7L A;  1LBB A;  1PEB A;  3HCQ A;  4Z7E A;  4EUO A;  3QIM A;  3K6U A;  5EYF A;  3ZKL A;  1M5D A;  4MNC A;  4DE8 A;  3IFC A;  2Z22 A;  4ZDM A;  4KYS A;  1Y3N A;  1LAG E;  5CMK A;  1LB9 A;  4QSE A;  2RCA A;  1J1N A;  1B7H A;  2I0C A;  3ILT B;  2PT1 A;  1JVX A;  3M3K A;  1DPP A;  1US5 A;  1RDY A;  1JW5 A;  3C32 A;  3TQL A;  2OWS A;  1DBZ A;  4HCY A;  2VD3 A;  3M3L A;  4OVT A;  4Q8R A;  2DWJ A;  3O29 A;  2CZI A;  1NNT A;  1KA0 A;  1BP5 A;  3I3V A;  2D5W A;  2GH9 A;  2OZZ A;  3R6U A;  1YCJ A;  2ZZV A;  3I5O A;  1SW1 A;  1MY0 A;  3KN8 A;  3VXB A;  3MQ9 A;  1P1W A;  3C36 A;  3FAS A;  4YU0 A;  2R6G E;  2Q74 A;  4HS7 A;  4YMB A;  3MWB A;  4KFQ A;  5HPQ A;  4P3L A;  3KOS A;  2XXK A;  3FIR A;  1FBE A;  3B6W A;  4GWW A;  4OQO A;  1I69 A;  3RPW A;  2P3N A;  3G3G A;  1VR5 A;  3IB1 A;  3K1P A;  2Y5K A;  3PPN A;  3OO9 A;  5FBP A;  3CRB A;  2R8T A;  3LUY A;  4NF6 A;  4ELO A;  4YMA A;  4PAF A;  2WBB A;  1JW4 A;  4LON B;  3EF7 A;  4YZZ A;  2RC7 A;  3Q29 A;  3T9U A;  3TZA A;  1MXU A;  4IGR A;  3CSG A;  2FBP A;  3Q25 A;  5IGA A;  5CBR A;  3MBP A;  2Y84 A;  4M4G A;  2OWZ A;  5L8D A;  4PTK A;  1N0T A;  1B3L A;  4GX6 A;  4R6K A;  1XC1 A;  1FBF A;  3LUZ A;  4GBW A;  1N76 A;  3L6H A;  4LQ2 A;  3E3K A;  2QS3 A;  3EN3 A;  2RIN A;  4F18 A;  1JEU A;  1B5J A;  4PGN A;  4F3B A;  4PFW A;  3TCG A;  3VLU A;  1BK4 A;  2V3Q A;  4PFR A;  3VVD A;  3O9P A;  4DCX A;  2WYP A;  5KDT A;  2Q2C A;  3GXA A;  4JVI A;  2XD3 A;  5IAI A;  1B6H A;  3ONM A;  3VVE A;  4H8I A;  3C34 A;  3BIH A;  2NWJ A;  1AIV A;  1CE2 A;  1B4Z A;  2QVR A;  3SDF A;  1GVC A;  2ZMB A;  1O63 A;  4AB6 A;  3LSL A;  1H43 A;  4H1X A;  3KC1 A;  4MFI A;  5CMM A;  4E0X A;  4FEB A;  2RCB A;  1FPF A;  2PMS A;  1DK4 A;  1S9T A;  1IQ7 A;  2DDK A;  3KGC A;  4HTG A;  3O28 A;  1S7Y A;  4MIJ A;  1FJ6 A;  2OPE A;  5I59 B;  3KBZ A;  5L9M A;  3B50 A;  3CG3 A;  2OLB A;  1IIW A;  4X48 A;  1DTG A;  1FTA A;  1D9Y A;  4H0W A;  4R2F A;  1FQA A;  1IME A;  2Z8E A;  1QJM A;  1ZIU A;  4ELR A;  3GYY A;  1IZ1 A;  3SET A;  1NNP A;  2QVV A;  1DPE A;  3E79 A;  3WAE A;  4X1B A;  3K02 A;  2ZNU A;  5FHO A;  1MQJ A;  5FHM A;  3ODB A;  1I6B A;  2I58 A;  1YZ0 A;  4NX1 A;  4DIG A;  3SEU A;  2B4M A;  3MW0 A;  2XXR A;  1USY E;  3G3F A;  3S9L C;  1OIB A;  1D3K A;  1IXH A;  5JK4 A;  2QRY A;  4UA8 A;  4R75 A;  4ZZE A;  4I1D A;  4BDR A;  4OZ9 A;  4N8Y A;  4XEQ A;  4U23 A;  1FW0 A;  5TP9 A;  1NNK A;  1TFD A;  4IO6 A;  1AWB A;  5H8H B;  2HZK A;  3PU5 A;  4EQB A;  5H8Q A;  3MVX A;  2B3F A;  4P8B A;  4XKP A;  2HXW A;  2XXV A;  5IZ1 A;  5I3S A;  3OEL A;  4ZEF A;  4IY6 A;  4P1E A;  3SES A;  4Q0C A;  1POT A;  2DXY A;  5TPA A;  3Q28 A;  4OA4 A;  2XX7 A;  2OX3 A;  4GBV A;  1NV5 A;  2ZXT A;  2D21 A;  1MPD A;  4MHF A;  1FPB A;  4MF3 A;  4NF6 B;  1ZMG A;  4HE1 A;  1LLS A;  3A09 A;  4N4U A;  4U1Z A;  2DQV A;  4H5G A;  1NUX A;  2VOZ A;  4OWD A;  4LZ5 A;  3O6G A;  1A99 A;  3AXF A;  5K2X A;  5FHN A;  3T0J A;  1HSL A;  2H99 A;  1MXZ A;  4PFY A;  5LTC A;  3W9V A;  3UOR A;  1VDW A;  3HHF A;  1NUZ A;  1PDA A;  1LBZ A;  4P0I A;  4IGT A;  1GR2 A;  4JWO A;  3FXQ A;  4LN5 A;  3UP9 A;  4ZEC A;  4GLI A;  1Y9U A;  4FAT A;  3U72 A;  2DXR A;  2XD2 A;  5ET5 A;  4KCC A;  3CVG A;  4RNS A;  3K6X A;  3MVZ A;  2B3B A;  5H8F A;  1EYK A;  1Q1K A;  3QSL A;  3IFA A;  2XWI A;  4PFB A;  4RPO A;  3MST A;  1P1N A;  4X8R A;  2ZYK A;  3VFJ A;  3FUZ A;  5B7D A;  1SI1 A;  1Y1M A;  1MQH A;  3G7W A;  3SEY A;  1TWY A;  4FAJ A;  3TPA A;  1FQB A;  4G8N A;  4C1U A;  4XKN A;  3OSR A;  1JP4 A;  4G4P A;  4ZS9 A;  5TP9 B;  1LBW A;  3D4C A;  2I0B A;  1MRP A;  2HPG A;  1KZ8 A;  1VSO A;  4U2R A;  1K9Y A;  1F9B A;  1FTO A;  2M8C A;  4DCY A;  1WVJ A;  2F36 A;  3H06 B;  4BDQ A;  3PPP A;  1XOC A;  3USD A;  1NNF A;  4NN3 A;  1TXF A;  2RC9 A;  3VLV A;  1MXX A;  4ND9 A;  4KXP A;  3KJ7 A;  4U4S A;  3E78 A;  2QJE A;  1LBC A;  5F1Q A;  3ROJ A;  3Q27 A;  3U93 A;  4H45 A;  3FJ7 A;  4GFR A;  5ET7 A;  2O84 X;  2PX1 A;  3SEV A;  2A5T A;  4GVO A;  1MQI A;  2FA7 A;  4H5F A;  1A40 A;  2O51 A;  5DVJ A;  2H9B A;  2FIX A;  4OET A;  1QUJ A;  3W15 C;  4QFO A;  3ISP A;  5DVI A;  3ZSF A;  1MXW A;  4FE8 A;  2Y7W A;  4OMB A;  3MAM A;  4G68 B;  3GBB A;  3O6I A;  2RF1 A;  3U1O A;  5I57 B;  3KC0 A;  1B3H A;  4OVQ A;  1B7U A;  4XTC Q;  3SEX A;  3FVG A;  3FJG A;  5ESY A;  1USY H;  3BBR A;  3PD9 A;  3K6W A;  4O94 A;  4PF8 A;  2UVG A;  2X7Q A;  2VD2 A;  4FIM A;  1A55 A;  2GHA A;  4ELP A;  5B70 A;  1NV7 A;  3IJX B;  4P9K A;  4JB7 A;  2UXA A;  1SPI A;  3IR1 A;  1A8F A;  3PPR A;  5DEX B;  2Q89 A;  1B3E A;  4PCD A;  1LFH A;  3ZS6 A;  2XXH A;  2NXO A;  1UTB B;  1NUW A;  1VFE A;  4PFT A;  2G93 A;  1NV3 A;  5AA4 A;  4PFI A;  3PUV E;  4M1V A;  4H67 A;  4DDD A;  2UVI A;  4YB6 A;  4NF8 A;  3TTR A;  4MJO A;  4YKK A;  3FJM A;  3W9W A;  2HXR A;  2QSX A;  2MKZ A;  3K4U A;  5I59 A;  1PBP A;  1H44 A;  4OVS A;  5L9O A;  1FQF A;  2H5Y A;  3PUX E;  4N8G A;  5IM2 A;  1LAF E;  4R73 A;  1JQF A;  4DLD A;  4F31 B;  5AE4 A;  1POY 1;  3P7I A;  5H8H A;  2HHM A;  1PB7 A;  1O7T A;  2VPN A;  4F2Q A;  1DOT A;  4ESW A;  4GXA A;  5I58 A;  2REJ A;  1OVT A;  2OWT A;  3K1M A;  1US4 A;  2ZYM A;  4IO5 A;  4Q5T A;  1MH4 A;  3EHT A;  3QUJ A;  1N3X A;  3LSX A;  4O7I A;  2PFZ A;  4F39 A;  4HE2 A;  3IAZ A;  5CM6 A;  2F3B A;  1FPE A;  1NV6 A;  4PE5 B;  5HM4 B;  4LAT A;  2F3D A;  5JEI A;  5EHS A;  4KR5 A;  3E4R A;  3CFZ A;  1MG1 A;  1Z7N E;  1QVS A;  4IO4 A;  4R9F A;  1MY4 A;  1M5E A;  4IO3 A;  4OAN A;  1RYO A;  4OEN A;  3D1R A;  4NF8 B;  2QVU A;  3OEM A;  1KA1 A;  4NG7 A;  3GBA A;  5F24 A;  3PPQ A;  2QL3 A;  5EQA A;  2ZYN A;  1ZTY A;  1D9V A;  3G3K A;  2XXU A;  3S9M C;  1IXG A;  5DT6 A;  4G77 A;  2REG A;  1YTV A;  3BFU A;  4QFK A;  4WEP A;  3T22 A;  3TOD A;  1FPJ A;  1LFG A;  3FBP A;  1N7X A;  3MZ9 A;  3GLB A;  1FTK A;  1B46 A;  3K2D A;  4F19 A;  1B1X A;  1G0I A;  2Q9T A;  3KG2 A;  3TTK A;  4H65 A;  4P11 A;  5KCJ A;  4YIC A;  4YKP A;  1MDP 1;  1B40 A;  1QGX A;  5AA2 A;  3UIF A;  5I2K A;  4PGP A;  4X9T A;  1FPL A;  4EQ7 A;  5I2K B;  3TTM A;  3KBR A;  4F1Y A;  4AS4 A;  3FXU A;  4TOZ A;  2W7Y A;  5EQ9 A;  2Q2A A;  3HFU A;  4U1O A;  4Q30 B;  4MNI A;  4MLV A;  3LR1 A;  1B5H A;  3H03 A;  3B6Q A;  2QS1 A;  3OEN A;  4NTL A;  1IEJ A;  1N04 A;  1G0H A;  2X7P A;  4QBA A;  4XKR A;  4R74 A;  3UK4 A;  4P56 A;  4FED A;  4WXJ A;  1R6Z A;  2DS9 A;  2UVH A;  4NWC A;  1VE4 A;  4N17 A;  4XF5 A;  1Y3P A;  3IO6 A;  3LC8 A;  3RY3 A;  1M5F A;  3K00 A;  4PDH A;  1PB8 A;  1VFD A;  1URD A;  3F11 A;  4NGU A;  5KDT B;  1YAE A;  2GRV A;  4PBH A;  1XT8 A;  3KFM A;  3RLF E;  2DE3 A;  4N91 A;  3IJO B;  3RYD A;  4ZE9 A;  2F6P A;  5I2N A;  2VHA A;  4DXU A;  5ICT A;  4H6D A;  2WKY A;  3MP8 A;  1B4H A;  1B5I A;  1WDN A;  4WED A;  2B4L A;  5CI5 A;  3IOT A;  1CB6 A;  1NUY A;  4QXD A;  1EZO A;  2HEU A;  4ELQ A;  1ANF A;  3T93 B;  2ZZX A;  4IO7 A;  5ELV A;  1B51 A;  1LAX A;  3N94 A;  4LA9 A;  4PAK A;  3O97 A;  4EXK A;  4GWZ A;  2QPQ A;  4TLL B;  2XXX A;  4F3P A;  1MM7 A;  2XX9 A;  2ZNS A;  1MXV A;  1FQC A;  3EKI A;  4G8M A;  2G29 A;  2IEE A;  1T0K A;  1R1N A;  3QUF A;  3V89 B;  1XVX A;  4NF5 A;  2O69 A;  3FGS A;  1FRP A;  1SD3 A;  1PB9 A;  2XWO A;  2O1L A;  2CZH A;  2Y7P A;  1P1U A;  5IKB A;  1B2H A;  2ABH A;  3H3G A;  4N6P A;  5ITO A;  5DEX A;  2I3V A;  4GWU A;  4WKM A;  4MH5 A;  3RUM A;  3THI A;  2FVZ A;  3U92 A;  4X1D A;  4GD5 A;  4OER A;  3MPL A;  5FTI A;  2D3I A;  3T66 A;  3VDF A;  1QKB A;  5AA3 A;  2XXT A;  3QYT A;  1FPG A;  3T96 B;  1FBP A;  4YB7 A;  5DTB A;  2CEY A;  3MYU A;  4MLQ A;  1SW4 A;  3FVN A;  4IO2 A;  2BJI A;  4XKQ A;  1NL5 A;  3TDJ A;  4GIZ A;  1MQG A;  1LBV A;  3IOU A;  2Y7I A;  1NV1 A;  4IR8 A;  3PUZ E;  3M3F A;  2JJK A;  4NED A;  1R9Q A;  3KEI A;  2ALU A;  1INP A;  5BUU A;  4NQ8 A;  1MM6 A;  1ZLQ A;  4GF8 A;  2AYS A;  4PP0 A;  2V25 A;  4FEC A;  4QHQ A;  5H8S A;  3OOA A;  3OO6 A;  3T9V A;  2FYI A;  4TLM B;  3KN7 A;  4EQ9 A;  1BKA A;  3ILU B;  4RXL A;  1XVY A;  1GV8 A;  1FSA A;  3JZJ A;  1A8E A;  2CZK A;  2Y7R A;  1ZJL A;  1FPD A;  1FCK A;  2I4B A;  2F5X A;  4KYD A;  4ISU A;  1MH3 A;  2DP8 A;  1Q35 A;  4ZZA A;  1TT1 A;  4MAG A;  4IB2 A;  3RGY A;  5I5P A;  3T9X B;  2ZZW A;  4F29 A;  2XXW A;  1B05 A;  4OYV A;  1LEV A;  4GWS A;  2F7A A;  3DP8 A;  4HW8 A;  2FIE A;  2O1M A;  2VPO A;  4DXC A;  3CIJ A;  1LBX A;  3TTN A;  2XWV A;  1JVY A;  2ONK E;  2F97 A;  2XXI A;  3FXR A;  2ONS A;  4GOT A;  3C31 A;  4N07 A;  4O8M A;  5F7V A;  4THI A;  1RDZ A;  2R9J A;  3CR9 A;  1BIY A;  4JWY A;  2L5V A;  1JW1 A;  3MP6 A;  2A5T B;  1EZ9 A;  5IZ3 A;  4OFL A;  4PQJ A;  4ECF A;  1UQW A;  4K3F A;  3HV1 A;  3U65 A;  1LST A;  3GZG A;  3KSJ A;  1FQE A;  1EU8 A;  2E0S A;  3KN3 A;  3M8U A;  1UIV A;  3TEL A;  1PBQ A;  4F3G A;  4GXS B;  3QXM A;  4BDN A;  1LCF A;  1MY2 A;  3FVO A;  4GL0 A;  2HAV A;  3C33 A;  4QRZ A;  3TQW A;  2E1S A;  3IOR A;  3RTF B;  4MNP A;  3MPK A;  2VGQ A;  2I49 A;  5ISU A;  3PGF A;  4UAC A;  1FBD A;  4I8C A;  3K6V A;  3RQT A;  1YXI A;  4R2B A;  2OJT A;  1RYX A;  4AS5 A;  1HSE A;  1GTK A;  1NV2 A;  3IOW A;  3CFL A;  4MX6 A;  2QS2 A;  3BKI B;  1FQD A;  4OEU A;  3C4M A;  1HSJ A;  1SYH A;  2CEX A;  3G3H A;  1B3F A;  1NV0 A;  1SDX A;  4LQ5 A;  4G68 A;  2FNC A;  1ZBM A;  4LZ8 A;  5I7I A;  1S50 A;  3ZKK A;  3MP1 A;  1DCU A;  1D4N A;  2B65 A;  4P1L A;  5EHM A;  3PUY E;  1UTB A;  3PTY A;  3TFL A;  3UA8 A;  4KHZ E;  4P0G A;  1B0L A;  2V3T A;  4LP2 B;  3V8X B;  3RT6 B;  2UYE A;  3DP6 A;  5I57 A;  4PET A;  1JNF A;  4DI3 D;  1QUK A;  5EYH A;  4POX A;  1Y3Q A;  3RTW B;  4OVJ A;  4DZ1 A;  4GL8 A;  1B32 A;  2CMO A;  5CC2 A;  3KSX A;  4JWX A;  1LFI A;  3H7M A;  3K0V A;  1OQH A;  3OMB A;  4UAB A;  2F7C A;  2YJP A;  5A5L A;  4BDL A;  2Q88 A;  1IMD A;  1H3D A;  3N26 A;  4O3A A;  3UN6 A;  5EYG A;  4MEV A;  2AIX A;  1PC3 A;  2DVZ A;  4LZ7 A;  4RY1 A;  4DI4 B;  1A54 A;  1P1Q A;  3JYR A;  2ZYO A;  1MS7 A;  4JVD A;  1O64 A;  2KQZ A;  2IA4 A;  4I40 A;  1N3W A;  3TMG A;  3OD7 A;  5LDZ A;  2OBG A;  3IL1 B;  2XA5 A;  1XI6 A;  3PPO A;  4HXV A;  2XXY A;  3SER A;  1LGB C;  1II5 A;  2OK2 A;  4NE4 A;  4O3C A;  2V3U A;  4NMY A;  4GX4 A;  2UYF A;  2I6E A;  3CHG A;  4JBZ A;  1FBC A;  5IZZ A;  3QMF A;  4RJZ A;  1IXI A;  4YAH X;  3H6V A;  1IIT A;  4ZE8 A;  1MDQ A;  1ZU0 A;  4PAI A;  2GQ1 A;  3V5A A;  4AB5 A;  1NH8 A;  1FTL A;  3MJN A;  3B8B A;  3E9X A;  4QFN A;  3IB0 A;  4ESX A;  4OTE A;  1AL3 A;  4G8H A;  4JSD A;  3SKP A;  4XIG Q;  1DTZ A;  4EF2 A;  2DWI A;  5J1D A;  1Z7M E;  1I6A A;  4JVC A;  4QFL A;  3FD3 A;  2Y7K A;  5TPA B;  1FTM A;  5IZ3 B;  3H6U A;  3HO7 A;  1MPC A;  5KCJ B;  3FVK A;  3RPL A;  1QUI A;  5K2Y A;  4C0R A;  4GRK A;  2LAO A;  2HAU A;  1EZP A;  4U22 A;  1D9Q A;  3HN0 A;  1MY1 A;  1OLA A;  4OFO A;  1QKA A;  4N6K A;  4GWY A;  2H98 A;  5BWJ A;  1KWH A;  4GWX A;  4GX3 A;  1LBY A;  4KD5 A;  3VV5 A;  2DVC A;  1R9L A;  4LVQ A;  5I56 A;  3S9N C;  3OEK A;  4BDM A;  5I56 B;  5CMC A;  3TAJ A;  4I3E A;  4N81 A;  2F8D A;  3PMV A;  1B58 A;  3TCH A;  5AA2 D;  1IMA A;  3LSW A;  5DW8 A;  3CFX A;  2O7I A;  3BIG A;  3OO8 A;  1K9Z A;  4I9D A;  1MY3 A;  3LBS A;  3K01 A;  4R6H A;  3IB2 A;  4OES A;  3DEL B;  3MZ1 A;  5CMB A;  3MC2 A;  2XWK A;  3CSB A;  2RC8 A;  4PC9 A;  2NUV A;  3A3C A;  3PMW A;  1SW2 A;  2DOJ A;  4F3S A;  1NMU A;  3B6T A;  5J16 A;  3PD8 A;  3G3I A;  4FBP A;  2HFB A;  2F78 A;  3OXN A;  3MVY A;  3PUW E;  4XFE A;  2O6A A;  2THI A;  5H8F B; 
#chains in the Genus database with same CATH homology
 2PCR A;  1RDZ A;  1JP4 A;  4MHF A;  1NUW A;  4NGU A;  2VT5 A;  4P47 A;  1LBW A;  3FXB A;  2DDK A;  1EYI A;  4PAF A;  1FPB A;  2WBB A;  2L5V A;  4PBH A;  2HPG A;  4PET A;  1FPG A;  1FJ6 A;  1KZ8 A;  1NV3 A;  5EQA A;  3RPL B;  4MIJ A;  1FBP A;  2WBD A;  1K9Y A;  3KBZ A;  4PFI A;  2DE3 A;  3B50 A;  4M1V A;  4YZZ A;  4HE1 A;  5EYH A;  2CEY A;  4N4U A;  1FJ9 A;  1FBG A;  3MYU A;  4N91 A;  5IZ3 A;  5J1D A;  4JVC A;  3A29 A;  1FTA A;  4MJO A;  4MNC A;  3W9W A;  3IFC A;  2BJI A;  2FBP A;  2HXR A;  3RYD A;  4GBV A;  4N15 A;  4X04 A;  5IGA A;  2MKZ A;  1FPJ A;  5IZ3 B;  4HCW A;  3FBP A;  4NN3 A;  3U65 A;  1IME A;  1IMF A;  1LBV A;  1NUX A;  4UAB A;  5A5L A;  4OVS A;  2OWZ A;  1NV1 A;  3NOH A;  4PTK A;  4IR8 A;  3RPL A;  4KXP A;  2DE4 A;  4F19 A;  2JJK A;  1IMD A;  2WX9 A;  1NI9 A;  4GX6 A;  3GYY A;  1G0I A;  2KR0 A;  4N8G A;  5IM2 A;  2Q9T A;  3E78 A;  5EYG A;  2B4L A;  2QVV A;  4MEV A;  2PFY A;  1FBF A;  1NUY A;  1D9Q A;  1RDY A;  3LUZ A;  4GBW A;  4QXD A;  3T0J A;  1INP A;  2WEF A;  2DVZ A;  3E79 A;  4DI4 B;  4G61 A;  4NQ8 A;  3SZP A;  3ROJ A;  5LTC A;  4N6K A;  4GWY A;  4H45 A;  2HHM A;  2Y5L A;  2WYK A;  2ZZX A;  5ET7 A;  4JVD A;  3W9V A;  4YIC A;  1DBZ A;  4HCY A;  4MNP A;  2VPN A;  4OVT A;  4GWX A;  4MMP A;  4GX3 A;  2KQZ A;  4F18 A;  4PAK A;  1EYJ A;  1IMC A;  1LBY A;  1FBD A;  2CZI A;  1YZ0 A;  1VDW A;  1NUZ A;  4GWZ A;  1QGX A;  1KA0 A;  4I40 A;  1YXI A;  5EQ7 A;  2QPQ A;  4NX1 A;  1LBZ A;  2B4M A;  2FIX A;  4AS5 A;  4PGP A;  1NV2 A;  4PGN A;  3ISP A;  2FHY A;  5LDZ A;  4MX6 A;  1FPI A;  4X9T A;  1FPL A;  5T3J A;  4F1V A;  3EKI A;  4I3E A;  4LN5 A;  4N81 A;  2XA5 A;  4OVP A;  4PF6 A;  1XI6 A;  1BK4 A;  2V3Q A;  4PFR A;  1FSA A;  4AS4 A;  2V4C A;  2ZZV A;  2CZK A;  4HXV A;  5JK4 A;  2DE2 A;  4O7M A;  2WYP A;  4MCO A;  1FPD A;  1IMA A;  1FRP A;  5EQ9 A;  5ET5 A;  5ET6 A;  3HFU A;  3KC0 A;  5DW8 A;  4O7I A;  2F5X A;  2XWO A;  2CZH A;  2HZL A;  2PFZ A;  4N8Y A;  4MNI A;  1Q9D A;  1YYZ A;  4JVI A;  4XEQ A;  4HE2 A;  4I3Y A;  4N6D A;  2CEX A;  3BIG A;  4GX4 A;  2F3B A;  1FPE A;  1K9Z A;  4OVQ A;  4DI3 D;  5CM6 A;  1NV0 A;  1NV6 A;  1EYK A;  4NHB A;  2Q74 A;  4H46 A;  1AWB A;  2Q8M A;  4NF0 A;  2HZK A;  3CHG A;  1G0H A;  4MAG A;  3IFA A;  2XWI A;  4PFB A;  3BIH A;  5ESY A;  5F24 A;  3MST A;  4PBQ A;  4QBA A;  2F3D A;  4P8B A;  4P3L A;  5I7I A;  2XXK A;  4X8R A;  5I5P A;  2XWK A;  4O94 A;  4PF8 A;  1FBC A;  1IMB A;  1DCU A;  5ET8 A;  4PC9 A;  4GWU A;  4P56 A;  5IZZ A;  1RDX A;  3QMF A;  5IZ1 A;  2ZZW A;  1FBE A;  1LEV A;  2QVR A;  4P1L A;  4GWW A;  5I3S A;  4PDD A;  4GWS A;  4NAP A;  4PE3 A;  1FPK A;  4O8M A;  1NV7 A;  2P3N A;  4OAN A;  4HE0 A;  3PTY A;  2FIE A;  2P3V A;  4N17 A;  4OVR A;  4P1E A;  4P9K A;  4XF5 A;  2FVZ A;  2VPO A;  1NV4 A;  5J16 A;  3D1R A;  4PAI A;  5EQ8 A;  2GQ1 A;  3T1B A;  1SPI A;  2QVU A;  1LBX A;  2Y5K A;  3KC1 A;  4PDH A;  2XWV A;  4FBP A;  1KA1 A;  1FBH A;  4OA4 A;  4PCD A;  3B8B A;  4NG7 A;  2OX3 A;  1FPF A;  2QFL A;  5FBP A;  4XFE A;  4F1U A;  1CNQ A;  1DK4 A;  1NV5 A;  3LV0 A;  2R8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...