1IMDA

Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
266
structure length
266
Chain Sequence
b'WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL MONOPHOSPHATASE
publication title Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 83
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1imdA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1imdA02
2CZIA 5IZ1A 1NV1A 2R8TA 1AWBA 2QFLA 3B8BA 4G61A 5ESYA 1VDWA 4H45A 5EQ8A 4MJOA 2FVZA 1XI6A 3RPLB 3KC1A 1LBYA 5EQ7A 5LDZA 1NV3A 2F3DA 4O7IA 1Q9DA 1FSAA 4PTKA 4AS4A 5T3JA 2BJIA 1LBXA 3BIGA 1FBGA 4H46A 1NV5A 3QMFA 1JP4A 1YYZA 1YXIA 1G0IA 1DK4A 4GX4A 4FBPA 1DBZA 1QGXA 1RDXA 2CZHA 5F24A 4GBWA 2FBPA 3BIHA 5EYHA 4HE0A 1LBVA 1IMEA 2GQ1A 1G0HA 1IMFA 1FPIA 2Y5LA 2P3VA 3KC0A 4GBVA 2WBBA 2HHMA 1IMDA 1RDYA 3LV0A 3RYDA 1FBEA 4I3YA 1YZ0A 5A5LA 3KBZA 1NV2A 3IFAA 1FRPA 1NV7A 4GX6A 1NI9A 4GWXA 2Q8MA 1FJ6A 1INPA 5EYGA 2WBDA 5EQAA 1NV4A 1NUYA 2VT5A 2FIXA 4GWWA 5J16A 3LUZA 2QVUA 4AS5A 3D1RA 1FBDA 2OX3A 1DCUA 4I3EA 1D9QA 5IZ3A 1FJ9A 1FPBA 1BK4A 5I3SA 4GWYA 4HE1A 1IMBA 2JJKA 1LEVA 4GWZA 1FPEA 5FBPA 2DDKA 4QXDA 2FHYA 1KZ8A 1LBZA 5ET8A 1SPIA 4GWUA 1FBCA 1FPLA 5ET6A 1FPFA 1NUZA 2WEFA 2Y5KA 1IMCA 1FPJA 1FPGA 1NUWA 1RDZA 4N81A 1K9ZA 2CZKA 3A29A 1FPDA 1EYKA 5IZ3B 4GWSA 4HE2A 2OWZA 4KXPA 5DW8A 2PCRA 4I40A 1LBWA 5ET5A 3FBPA 4HXVA 5EQ9A 1FBFA 1FTAA 3T0JA 1NUXA 5ET7A 2FIEA 1IMAA 4GX3A 1NV6A 2F3BA 2P3NA 1EYIA 1K9YA 1NV0A 1FBPA 2Q74A 2QVVA 3ROJA 1FPKA 3IFCA 3RPLA 4IR8A 1KA0A 1EYJA 2QVRA 1KA1A 1CNQA 1FBHA
chains in the Genus database with same CATH superfamily
1US4A 4PDDA 3OEMA 4PF6A 4OZ9A 1LBYA 1TXFA 2F3DA 5H8FA 1H43A 3LSWA 1G0IA 4P47A 5BUUA 1IEJA 3PPQA 4IY5A 4R2BA 1IMDA 4UA8A 2XXIA 3IFAA 2XX7A 2Q8MA 2H9BA 4XKQA 3LSLA 5I7IA 4NF8A 2WBDA 2WX9A 1B0HA 2RF1A 5FTHA 5J16A 2QVUA 3E78A 4NE4A 4N17A 1FJ9A 2O51A 1N76A 4ZZEA 3S9EA 3TCHA 4MBPA 4N6DA 4GRKA 3PPPA 1LBZA 3IOUA 4R74A 4IO7A 1KWHA 4N13A 5FHOA 4G77A 1B4ZA 4PFTA 4DXBA 4YU0A 3VE1B 4RPOA 4P0IA 1P1QA 5EQ9A 3BKIB 2QSXA 4GX3A 3W15C 1MQJA 1EZ9A 4ZS9A 1NV0A 3PU5A 2OLBA 2Y84A 4OVPA 5DEXB 1FBHA 1GGGA 2PFZA 4DXCA 4H6DA 3K02A 3RNNA 2R8TA 1EU8A 3KC1A 3C36A 1FTOA 1NV3A 4YKPA 4FEDA 3KBRA 4GL8A 3TTRA 4R72A 5EHMA 4ONYA 3HSTA 5EYFA 4O7MA 4NG7A 3U72A 3OOAA 4KHZE 4IO3A 3JYRA 5JK4A 3IORA 1Y3NA 3RLFE 3GBBA 1DPPA 3MZBA 3E3KA 3M3FA 4FAJA 3TPAA 4F3PA 5TP9A 2Z8FA 4LATA 1FW0A 1JEUA 1B7ZA 3KOSA 1PC3A 3LC8A 4PCDA 1P1UA 2D3IA 3LSXA 1F9BA 2E1SA 1SD3A 2G93A 2XXQA 5FHMA 4AS5A 1GV8A 1OLAA 2DYXA 1QJMA 5I3SA 3MP8A 5TPAB 1QUJA 1FBCA 1TWYA 3FXQA 1Y1MA 2VD3A 5EHSA 4P1EA 4GXSB 4JVIA 4E0XA 4G4PA 4MNIA 4NF5A 3OMBA 2D21A 1IXGA 5ET7A 4FIMA 1ZU0A 1A55A 1M5DA 2V3UA 3HCQA 3RPLA 2DWIA 3UIFA 1Y3PA 4DDDA 4OYVA 3MVXA 2XA5A 1B51A 1HSEA 1B3GA 1EH3A 1I6AA 4WEPA 1MY4A 2VPNA 4FECA 4RA1A 3IO4A 1MXVA 2ANJA 4AS4A 3N5LA 4P9KA 2I49A 4GX4A 2Y7PA 4OHNA 3FXBA 2CZHA 3PUVE 1B4HA 1TFDA 4PBQA 5A5XB 4NWCA 1R1NA 3LUYA 4G68C 2Y7WA 2ZNSA 4MLQA 4DCXA 4NF4A 3Q29A 4UACA 4EDPA 3G3KA 3K1MA 2CEYA 3EHTA 3Q26A 1SI0A 4IGTA 4Q5TA 5EQAA 3T93B 1H3DA 1MY3A 1DCUA 1ELJA 4OENA 2GHAA 3VVEA 2F6PA 3OO9A 4X1BA 3FV2A 2H4IA 1FPJA 1FCKA 3UK4A 5JEIA 4GFRA 3CHGA 3A29A 4JXIA 3QSLA 3HV1A 4GWSA 4X8RA 1UIUA 2GFEA 5ELVA 3PD8A 2B4LA 1IMAA 3PTYA 1B1XA 4GF8A 3QUJA 1LGBC 2Q74A 1LCTA 4NF6A 4LONB 1DMBA 4JVCA 1QKAA 3TTMA 2XXPA 5FHNA 3IJOB 1O7TA 2A5TA 3SESA 4AB6A 1Z7NE 3IAZA 3C33A 5DTBA 3DM0A 3ZKKA 3T66A 1AOVA 3TEPA 4GWOA 1B3LA 2OJTA 2QL3A 3QIMA 1FQBA 3FVOA 1URSA 3OD7A 1OQGA 4MNCA 2D5WA 1B52A 4POXA 1VFDA 2F97A 2F5XA 5IM2A 3TFLA 3VV5A 2UYFA 4F1YA 3MBPA 2UVGA 3IB2A 3OO7A 1D9VA 4GX6A 4DZ1A 4ELPA 1EZOA 1OQHA 3HN0A 3U94A 1DOTA 1P1OA 2ZYOA 4GWWA 3UA8A 2OWSA 2RINA 2WKYA 4G8MA 1GR2A 5I57B 2I3VA 3K6XA 3PMWA 3PUXE 4YMAA 1FQEA 4ZDMA 3DP8A 4N81A 5LOMA 4GQOA 3T9HB 1URGA 2M8CA 3H06B 4HCWA 3C4MA 3JV9A 1A40A 1FBFA 3EF7A 3RTWB 2Y7KA 1ZJLA 3SEXA 2Z8DA 3IOVA 3OXNA 4H8JA 3IJXB 5CI5A 1PB9A 2XXUA 1NH8A 5HPQA 4YB7A 5I59B 3ROJA 4Z7EA 4GXAA 2UVJA 2Y7RA 1NNTA 3SKPA 4FEBA 3MC2A 5H8QA 3CSGA 4LQ2A 4F22A 1VE4A 4RNSA 4FORA 4JSOA 5AA2B 3O66A 5KCJB 3TUSA 1Y9UA 3N6TA 4R2FA 5I56B 3U93A 2BJIA 1LBXA 1A8EA 3EKIA 2DE3A 2REGA 4Q30B 2YJPA 3MZ1A 4MHFA 2FBPA 3O6HA 5EYHA 3MJNA 4UABA 3PMVA 4P11A 2WYPA 4LA9A 2DXYA 2X26A 4EQ9A 1NV2A 4F31B 1PBQA 3V89B 5JTYA 2VGQA 4U1ZA 3CFXA 4MEVA 4KPTA 1BTJA 4G8NA 1OIBA 4I1DA 3FJGA 4ZEIA 5IZ3A 2X7QA 1AH5A 3CSBA 3V83A 1FPEA 3Q25A 4YKKA 4PP0A 5ET8A 3CI8A 2VPOA 1FPDA 4F18A 1MXWA 1SW1A 2PT1A 2CZLA 4OXVA 3OSRA 3L6HA 4OVJA 3SZPA 2OBGA 2HAUA 3FBPA 2NUVA 4KCCA 4Z0IA 1LCFA 3FGSA 3H3GA 5I5PA 3KZGA 3T1BA 4DIGA 4ELRA 2QPQA 1MY1A 3KG2A 1KA1A 1JEVA 4GL0A 4IO2A 1SDXA 3RQTA 3KEIA 2HAVA 1B1HA 2HZKA 3MW0A 4U4XA 1JETA 4O7IA 4EF2A 1XS5A 3BIGA 2X7PA 1VR5A 3PPNA 4X1DA 3DELB 4F29A 3T96B 2V4CA 1JVXA 1GVCA 2XXKA 3K01A 4K3FA 1N7WA 4DXUA 2GHBA 2WBBA 4LUBA 4TLLB 2O1MA 3H6TA 4MF3A 1NNKA 4ESWA 4OERA 1SBPA 2DWJA 4U22A 1USYH 1B6HA 1O63A 4P8BA 5EYGA 1TT1A 3E79A 4BDOA 3K1NA 3H6VA 1N84A 2F7CA 2QMXA 3LUZA 2G29A 5BWJA 1RYXA 2HQ0A 4ZEFA 5M2VA 4GD5A 2Y7IA 1BKAA 1Y1ZA 3FXRA 1MQGA 4QXDA 4RYAA 3TZAA 2B3BA 2Y5KA 2F7BA 4OVQA 2REJA 2ZMBA 4EXLA 3SEYA 4KXPA 1LBWA 4P56A 1NNFA 2PYYA 3CIJA 4JWOA 1LFIA 3SETA 3U92A 2XXYA 5CM6A 3CFZA 5CMBA 1S50A 1S9TA 1URDA 1MM6A 2B3FA 3A3UA 4IR8A 1KA0A 5CMCA 5DVIA 2CZIA 5IZ1A 4GIZA 4X9TA 4LN5A 5HM4B 3UORA 1JW4A 3M3KA 1DSNA 4H45A 3R26A 5CC2A 1POTA 2ONKE 4R9GA 4PTKA 3P7IA 3WAFA 4OMBA 2DS9A 1CE2A 4KYDA 4F19A 4P3LA 3O6GA 4OEUA 3RN8A 1FTJA 3KC0A 3H7MA 1PB7A 3IOTA 4I3YA 5A5LA 1B5JA 3IB1A 1JVYA 4QBAA 3K00A 5I58A 2RC8A 1HSLA 2F35A 2ZZXA 4TLMB 4XFEA 3B7DA 3TYHA 1N7XA 1MS7A 1P1WA 3TODA 1NUYA 1LB9A 3HHGA 3QXMA 1L5TA 3D1RA 5DEXA 1FPBA 2F8DA 1I69A 4QFNA 4I8CA 4NX1A 1DPEA 3ILTB 5ICQA 4P0GA 5H8HB 4YKIA 4LQ5A 2DOJA 2ZXTA 2O1LA 1IZ1A 1S7YA 1YCJA 3C35A 1UQWA 1BIYA 3RUMA 4OETA 1D9YA 1FTAA 3MP1A 4QHQA 2Q88A 3FVGA 3U8QA 4H1XA 4BDLA 3SDFA 2V93A 2XXWA 2XXRA 4JB7A 2ALUA 3FXUA 1CNQA 4U4SA 4F39A 3GXAA 2DVCA 4R6KA 3VXBA 1Q35A 4RK9A 4QFKA 1VDWA 4ELQA 2XXHA 1FQFA 2I58A 2FVZA 3RPLB 1BP5A 3IL1B 2PX1A 3QYTA 3BFUA 3B50A 1MH4A 2QRYA 3PGFA 4OQOA 1JP4A 1YYZA 1M5FA 3QUFA 3I5OA 5TPAA 1UTBB 5F1QA 3Q28A 4JDFA 1D4NA 1Q1KA 4LVQA 4F3BA 1LBVA 5L9SA 2P3VA 4ND9A 4GBVA 2Z8EA 3G3FA 4FATA 2Q9TA 2FA7A 4IO5A 4ISUA 1XVYA 3FV1A 2Q8JA 4NF4B 1FQCA 4MIJA 3FD3A 3MUQA 2H99A 4PFBA 4DI3D 2O6AA 4HE1A 2NOOA 4XXUA 4LZ8A 4YAHX 4RK2A 4YICA 2AYSA 3PV0E 4BLAA 2FHYA 1QULA 4XEQA 3T22A 1NUZA 2WEFA 1UTHB 1FPGA 5I2KA 5ISUA 4OVTA 3FATA 4I40A 4H0WA 5AA4A 1UIVA 3ODBA 4HXVA 4GOTA 5CRYA 1IQ7A 1MY0A 3G3JA 3LSFB 5AA2D 4ESXA 2P2AA 3I3VA 2ZYMA 4C1TA 1JW1A 2QJEA 3GZGA 4TQUQ 2OWTA 4E0WA 4MNPA 4Q0CA 4KYEA 4XKRA 2LAOA 1NH7A 3MVWA 2V25A 3N94A 3H4ZA 3KOTA 1JW5A 4NF6B 1A7LA 1Q9DA 2DE2A 4ELOA 2NVUB 2HCAA 3QMFA 3FJ7A 1ANFA 4G68A 1B3EA 2DWAA 2DQVA 3M3LA 2O68A 1RKMA 1RDYA 4XF5A 5CBRA 3G3IA 2HFBA 1A54A 1B2HA 2R6GE 3USDA 2WYKA 1VSOA 1LSTA 1PBPA 2O7UA 3C9HA 3BBRA 1R9LA 2HZLA 2OX3A 1D9QA 2KQZA 1YPNA 1Z7ME 5I2NA 4DI4B 5FBPA 1SI1A 2CZKA 4GLIA 2OWZA 2P0SA 2XWOA 3K1PA 1IUDA 2RKMA 1OVBA 4ZE9A 5H8NA 2OZZA 1ZIUA 2OPEA 1EZPA 3O97A 3EN3A 1NV6A 3QK6A 1MXZA 1EYIA 4PQJA 4LP2B 4YKJA 4F2OA 1H45A 3E13X 4WKMA 3VFJA 2QVRA 4MCOA 4ZEBA 3SERA 4KQPA 3RY3A 5KZTA 3FVKA 2ZYNA 3H6UA 1AWBA 4FJPA 1D3KA 4OWDA 2MKZA 5H8SA 5EQ7A 3S9LC 4NQ8A 3E9XA 4DE8A 3MAMA 2Q2AA 4QRZA 1SVXB 3CG3A 4N8GA 3EHSA 3IX1A 1IXCA 4OEVA 4WXJA 4KR5A 4I62A 4KFQA 4OESA 1NFTA 3FJMA 1QUKA 2R71A 4U21A 3L6GA 3U1OA 1MXUA 3Q27A 4PFWA 3MPLA 3RYDA 3ONMA 2ABHA 3TQWA 3C31A 3RPWA 3G7WA 3T9XB 3SEVA 2O84X 3KJTA 1B5HA 1NI9A 5I59A 4YB5A 1ATGA 2H25A 1SYHA 5JTYB 1LAHE 4YB6A 3KJ7A 2QS3A 1IMBA 1MXXA 3MQ9A 4HTGA 1MY2A 3ISPA 3DP6A 3OENA 2RCAA 3VDFA 5CMKA 1J1NA 1K9ZA 1MQHA 1EYKA 5IZ3B 4NGUA 4IO6A 3CR9A 5I56A 3DLNA 4LZ7A 4N15A 3PD9A 4POWA 2XXTA 1LBBA 4PAFA 4XIGQ 1NUXA 1IIWA 1LBCA 4ZE8A 4HCYA 4PAKA 2XWIA 1QGXA 5FTIA 2XXVA 3KSXA 3B8BA 1MPCA 3K4UA 4OFOA 4MJOA 1B7UA 1NNPA 1XOCA 2XWVA 3A09A 5B7DA 2XHDA 2QMWA 4H46A 1ZTYA 2RC9A 3W9WA 5KDTB 4BDMA 1O64A 3BIHA 2ZZVA 4XKNA 1IMEA 1B46A 1QKBA 4YMBA 3WAEA 2R9JA 4WEDA 1QUIA 5L9OA 3ZSFA 3K6WA 1FRPA 3K2DA 2ZYKA 1LB8A 1P1NA 1B3FA 3LBSA 3C34A 1SQYA 5K2YA 5H8FB 3TQLA 1B05A 1JQFA 2VP1A 4H5FA 4I3EA 4Q8RA 4KYSA 1BK4A 3KN3A 3UN6A 1KZ8A 4GWUA 4PFUA 1IMCA 1CB6A 1B9JA 2DSFA 1H44A 4RPNA 2AL5A 2NXOA 2HPGA 2CMOA 2Q89A 4KCDA 1MH3A 3O2AA 3VVFA 3T0JA 4JSDA 1FTMA 1N0TA 4NF8B 1XVXA 1N04A 2B65A 2QS2A 1MRPA 2XD3A 2YLNA 3JZJA 4N4UA 5K2XA 4MLVA 1NV1A 4JVDA 4KD5A 3R7XA 2O7IA 3MZ9A 4G61A 4EQ7A 3N26A 2QS4A 4EQBA 1IXIA 4H67A 3G3GA 3FVNA 1AMFA 2F34A 4ZECA 3T9VA 1B5IA 2UXAA 4EF1A 1DK4A 2I0BA 2AL4A 3TTLA 1M5CA 1G0HA 1MQIA 1B3HA 1FQAA 3HPIA 1A8FA 1B0LA 2H98A 1M5BA 4MFIA 3S4UA 4IGRA 4RJZA 5CBSA 1N3XA 1H76A 3KBZA 3IB0A 1NV7A 3KN8A 3FUZA 3OEKA 1FBDA 5I58B 5IZZA 2QS1A 4MAGA 3VVDA 1P99A 4NEDA 4MMPA 3V5AA 2KR0A 3M8UA 4H8IA 2GRVA 3RT8A 3H03A 4O94A 1RDZA 3ECRA 5TU0A 2I0CA 5B70A 4HE2A 2L5VA 4DCYA 5AA1A 4QSDA 5TP9B 1LAXA 4KI0E 4YZZA 4NMYA 3TCGA 2UVIA 1DTZA 1A99A 4U23A 3F11A 2W7YA 1MQDA 3RGYA 3PUYE 3N6UA 3D4GA 3EQ1A 1MPDA 2F78A 3TTKA 2XXXA 4BDRA 4OFLA 5ICTA 1IITA 3A3CA 4IO4A 3OSQA 4G8HA 5L8DA 4QFPA 4OANA 4N6PA 2ZZWA 3PPOA 1PDAA 5LDZA 4O8MA 4IB2A 2OPDA 1ZMGA 5LTCA 1FBGA 3OO8A 4PE5B 4NF5B 4OVSA 3MSTA 4R6YA 4FBPA 2HXRA 3MWBA 5DVJA 3TKDA 4X48A 5F24A 3QAXA 4R73A 3CRBA 4LZ5A 2XX9A 3B6TA 5H8HA 2Y5LA 1GTKA 4P1LA 4OFJA 3LV0A 3FASA 1FTLA 2PVUA 4PETA 5DYHA 3VLWA 2HEUA 4M4GA 1LFHA 4C0RA 5IGAA 4DLDA 1JNFA 3PUWE 1NMUA 2F7AA 1SW5A 1SYIA 3IOWA 3RTFB 3NOHA 3O9PA 4NWDA 3R6UA 3S9NC 1Y4CA 1R9QA 3V8XB 2DDKA 3MYUA 4F1UA 1SPIA 1Y3QA 1SW2A 1FPLA 1AL3A 4NAPA 3VLVA 4G2ZA 3EHUA 3FZVA 4H5GA 5DW8A 3HFUA 4EUOA 4X04A 1US5A 2VD2A 1R6ZA 2AIXA 3TELA 3G3HA 1BLFA 4R6HA 1UTBA 5I2KB 1B7HA 2HXWA 3OO6A 1HSJA 2F3BA 2PT2A 3K6UA 1FBPA 5AA4B 3UGWA 1FPKA 5IAIA 3KSJA 4TOZA 3D4CA 3CFLA 1LAFE 4HW8A 3CG1A 2QFLA 3K6VA 4OA4A 1OVTA 5ESYA 2DVZA 1ZKBA 5DT6A 2I48A 1XI6A 4PDHA 3E4RA 2PBWA 2DXRA 2E0SA 4N8YA 1AIVA 3PPRA 4O3BA 3RT6B 4C1UA 5A5XA 4QFLA 5DVFA 2PMSA 1Y4TA 4BDNA 1II5A 2IEEA 4THIA 4PGPA 1RDXA 3KN7A 3TCFA 3S9MC 4GVOA 1UTHA 4HE0A 2OK2A 3GBAA 4N91A 2ONRA 1MG1A 1XHYA 4BDQA 4NF0A 4G68B 1YZ0A 5I84A 3TAJA 2IA4A 2A5TB 3IR1A 4GWXA 1FQDA 1FJ6A 4ZZAA 4EXKA 4GWYA 4H65A 4F1VA 2JJKA 2F36A 1T0KA 2YPNA 3K0VA 4JWYA 3FIRA 5ITOA 4O3CA 4AQ4A 5I2NB 1WVJA 2GH9A 2RCBA 4ZEDA 3O6IA 1MDP1 1QW0A 1YAEA 2PFYA 4PFRA 5AA3A 2XX8A 2ONSA 3VLUA 3B6QA 2P3NA 1K9YA 3MPKA 5J1DA 3THIA 3IFCA 4IY6A 1MPBA 4F3GA 5H8NB 1EYJA 3DP4A 4NTLA 1VFEA 1FTKA 1USYE 3GYYA 2ZNTA 4NHBA 4PGNA 3MVYA 1FSAA 2B4MA 3TDJA 5T3JA 1Y20A 3IO6A 2I4BA 1NV5A 1YXIA 2DE4A 3ZS6A 3PMXA 3SEWA 2A5SA 4PC9A 2OCUA 3GLBA 2KLFA 4GBWA 2DWHA 5HBCA 3KGCA 3O28A 3OELA 1IMFA 2V84A 1FPIA 4QSCA 1DTGA 1YTVA 2ESNA 3CVGA 4PFIA 4N07A 5H8QB 5I57A 2UYEA 4MH5A 5L9MA 1MXYA 3HO7A 4QF9A 4JBZA 1NV4A 1POY1 2VT5A 1LLSA 3S2VA 4RXLA 2Q2CA 2VHAA 1ZBMA 4F2QA 4M1VA 5AE4A 1I6BA 1LEVA 2V3TA 4QFOA 3SEUA 3O29A 1OLCA 1I6QA 3ILUB 4O3AA 3IK6B 4NN3A 2THIA 2CEXA 3VXCA 4ZEKA 5CMMA 3EPEA 4XKPA 3I6VA 4R75A 1B40A 3BFTA 3MVZA 1PB8A 3T9UA 5AA2A 5KCJA 2BJJX 1MM7A 5IKBA 3PUZE 3AXFA 1WODA 3LR1A 2O69A 2RC7A 1XT8A 2XWKA 4N6KA 2H5YA 1TFAA 5EQ8A 2NWJA 4MX6A 4AB5A 3MP6A 2Z22A 3TTNA 4OTEA 3ZKLA 2Z23A 4I9DA 1DBZA 2VOZA 3C32A 1B58A 4PFYA 1N3WA 1SW4A 2GQ1A 2HHMA 3KFMA 2I3WA 3W9VA 4JWXA 1FBEA 1NKXA 1IXHA 2FNCA 1LFGA 1LAGE 2UVHA 1B32A 4HS7A 1M5EA 2DP8A 1INPA 1QVSA 4U1OA 1MDQA 1XC1A 1OMPA 2I6EA 4FE8A 2FIXA 1WDNA 4OVRA 3U65A 4U2RA 3UP9A 4PF8A 4F3SA 4L17A 2V3QA 1RYOA 2ZNUA 4GWZA 2I4CA 4PBHA 4ECFA 2F6GA 5ET6A 4RY1A 3B6WA 1FPFA 4XTCQ 5F7VA 5ITPA 1NUWA 2P1SA 2PCRA 3TMGA 2XD2A 5ET5A 3H6WA 5KDTA 3HHFA 2FIEA 4PAIA 4PE3A 1ZLQA 4QSEA 2QVVA 1NL5A 1PEBA 2FYIA 4R9FA
chains in the Genus database with same CATH topology
4MNPA 4PDDA 4PF6A 4OANA 2ZZWA 1LBYA 5LDZA 2F3DA 4O8MA 1Q9DA 2DE2A 5LTCA 2BJIA 1LBXA 3EKIA 1FBGA 3QMFA 1G0IA 4OVSA 2DE3A 4P47A 3MSTA 4FBPA 2HXRA 5F24A 4MHFA 2FBPA 5EYHA 2Y5LA 4P1LA 4UABA 1IMDA 1RDYA 3LV0A 2WYPA 4XF5A 4PETA 1NV2A 3IFAA 2WYKA 2Q8MA 5IGAA 5I7IA 2WBDA 2WX9A 4MEVA 5J16A 2QVUA 2HZLA 3E78A 4N17A 2OX3A 1D9QA 5IZ3A 3NOHA 2KQZA 1FJ9A 4DI4B 5FBPA 1FPEA 4N6DA 2DDKA 3MYUA 4F1UA 1LBZA 5ET8A 1SPIA 1FPLA 4NAPA 2VPOA 2CZKA 1FPDA 4F18A 2OWZA 5DW8A 2XWOA 3HFUA 4X04A 3SZPA 3FBPA 5EQ9A 5I5PA 4GX3A 1NV6A 2F3BA 1EYIA 3T1BA 1NV0A 1FBPA 1FPKA 2QPQA 4OVPA 2QVRA 1KA1A 4MCOA 1FBHA 2PFZA 2R8TA 1AWBA 2QFLA 4OA4A 5ESYA 2DVZA 2MKZA 2HZKA 1XI6A 3KC1A 4PDHA 5EQ7A 1NV3A 4NQ8A 4O7IA 4N8YA 3BIGA 4N8GA 4O7MA 4PGPA 2V4CA 4NG7A 1RDXA 2XXKA 4HE0A 5JK4A 4N91A 2WBBA 3RYDA 4NF0A 1YZ0A 4PCDA 1NI9A 4GWXA 4P8BA 1FJ6A 5EYGA 3E79A 3LUZA 4AS5A 5I3SA 4GWYA 4F1VA 1IMBA 2JJKA 4QXDA 1FBCA 3ISPA 2Y5KA 4OVQA 1K9ZA 4P1EA 1EYKA 5IZ3B 4NGUA 4KXPA 1LBWA 4JVIA 4P56A 4MNIA 2PFYA 4PFRA 4N15A 4PAFA 1NUXA 5ET7A 2P3NA 5CM6A 1K9YA 5J1DA 4HCYA 3IFCA 3RPLA 4IR8A 4PAKA 1KA0A 2XWIA 1EYJA 1QGXA 2CZIA 5IZ1A 2XA5A 4X9TA 4LN5A 3GYYA 3B8BA 4H45A 4NHBA 4MJOA 4PGNA 2XWVA 2VPNA 1FSAA 4PTKA 2B4MA 4AS4A 5T3JA 4P9KA 4H46A 1NV5A 1YXIA 2DE4A 4GX4A 4PC9A 3W9WA 3FXBA 2CZHA 4F19A 4P3LA 4GBWA 3BIHA 2ZZVA 4PBQA 1IMEA 1IMFA 1FPIA 3KC0A 4PFIA 4I3YA 5A5LA 4QBAA 1FRPA 2CEYA 2ZZXA 4XFEA 5EQAA 1NV4A 1NUYA 2VT5A 3D1RA 1DCUA 4I3EA 1FPBA 1BK4A 4M1VA 1LEVA 1KZ8A 4NX1A 4GWUA 1IMCA 1FPJA 3CHGA 3A29A 4NN3A 4GWSA 4X8RA 2CEXA 2B4LA 2HPGA 1FTAA 3T0JA 1IMAA 3PTYA 2Q74A 4N4UA 1CNQA 4JVCA 1NV1A 4JVDA 2XWKA 4N6KA 4G61A 1VDWA 5EQ8A 2FVZA 3RPLB 4MX6A 3B50A 1JP4A 1YYZA 1DK4A 1DBZA 4MNCA 1LBVA 2GQ1A 1G0HA 2P3VA 2F5XA 5IM2A 4GBVA 2HHMA 3W9VA 1FBEA 2Q9TA 3KBZA 1NV7A 4GX6A 1INPA 2FIXA 4GWWA 4MIJA 1FBDA 4OVRA 4PFBA 5IZZA 3U65A 4DI3D 4MAGA 4PF8A 2V3QA 4MMPA 4HE1A 4GWZA 4PBHA 4YICA 2KR0A 2FHYA 4XEQA 5ET6A 1FPFA 1NUZA 2WEFA 4O94A 1RDZA 1FPGA 1NUWA 4N81A 4OVTA 4HE2A 2L5VA 2PCRA 4I40A 5ET5A 4YZZA 4HCWA 4HXVA 1FBFA 2FIEA 4PAIA 4PE3A 2QVVA 3ROJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZI A;  5IZ1 A;  1NV1 A;  2R8T A;  1AWB A;  2QFL A;  3B8B A;  4G61 A;  5ESY A;  1VDW A;  4H45 A;  5EQ8 A;  4MJO A;  2FVZ A;  1XI6 A;  3RPL B;  3KC1 A;  1LBY A;  5EQ7 A;  5LDZ A;  1NV3 A;  2F3D A;  4O7I A;  1Q9D A;  1FSA A;  4PTK A;  4AS4 A;  5T3J A;  2BJI A;  1LBX A;  3BIG A;  1FBG A;  4H46 A;  1NV5 A;  3QMF A;  1JP4 A;  1YYZ A;  1YXI A;  1G0I A;  1DK4 A;  4GX4 A;  4FBP A;  1DBZ A;  1QGX A;  1RDX A;  2CZH A;  5F24 A;  4GBW A;  2FBP A;  3BIH A;  5EYH A;  4HE0 A;  1LBV A;  1IME A;  2GQ1 A;  1G0H A;  1IMF A;  1FPI A;  2Y5L A;  2P3V A;  3KC0 A;  4GBV A;  2WBB A;  2HHM A;  1IMD A;  1RDY A;  3LV0 A;  3RYD A;  1FBE A;  4I3Y A;  1YZ0 A;  5A5L A;  3KBZ A;  1NV2 A;  3IFA A;  1FRP A;  1NV7 A;  4GX6 A;  1NI9 A;  4GWX A;  2Q8M A;  1FJ6 A;  1INP A;  5EYG A;  2WBD A;  5EQA A;  1NV4 A;  1NUY A;  2VT5 A;  2FIX A;  4GWW A;  5J16 A;  3LUZ A;  2QVU A;  4AS5 A;  3D1R A;  1FBD A;  2OX3 A;  1DCU A;  4I3E A;  1D9Q A;  5IZ3 A;  1FJ9 A;  1FPB A;  1BK4 A;  5I3S A;  4GWY A;  4HE1 A;  1IMB A;  2JJK A;  1LEV A;  4GWZ A;  1FPE A;  5FBP A;  2DDK A;  4QXD A;  2FHY A;  1KZ8 A;  1LBZ A;  5ET8 A;  1SPI A;  4GWU A;  1FBC A;  1FPL A;  5ET6 A;  1FPF A;  1NUZ A;  2WEF A;  2Y5K A;  1IMC A;  1FPJ A;  1FPG A;  1NUW A;  1RDZ A;  4N81 A;  1K9Z A;  2CZK A;  3A29 A;  1FPD A;  1EYK A;  5IZ3 B;  4GWS A;  4HE2 A;  2OWZ A;  4KXP A;  5DW8 A;  2PCR A;  4I40 A;  1LBW A;  5ET5 A;  3FBP A;  4HXV A;  5EQ9 A;  1FBF A;  1FTA A;  3T0J A;  1NUX A;  5ET7 A;  2FIE A;  1IMA A;  4GX3 A;  1NV6 A;  2F3B A;  2P3N A;  1EYI A;  1K9Y A;  1NV0 A;  1FBP A;  2Q74 A;  2QVV A;  3ROJ A;  1FPK A;  3IFC A;  3RPL A;  4IR8 A;  1KA0 A;  1EYJ A;  2QVR A;  1KA1 A;  1CNQ A;  1FBH A; 
#chains in the Genus database with same CATH topology
 1US4 A;  4PDD A;  3OEM A;  4PF6 A;  4OZ9 A;  1LBY A;  1TXF A;  2F3D A;  5H8F A;  1H43 A;  3LSW A;  1G0I A;  4P47 A;  5BUU A;  1IEJ A;  3PPQ A;  4IY5 A;  4R2B A;  1IMD A;  4UA8 A;  2XXI A;  3IFA A;  2XX7 A;  2Q8M A;  2H9B A;  4XKQ A;  3LSL A;  5I7I A;  4NF8 A;  2WBD A;  2WX9 A;  1B0H A;  2RF1 A;  5FTH A;  5J16 A;  2QVU A;  3E78 A;  4NE4 A;  4N17 A;  1FJ9 A;  2O51 A;  1N76 A;  4ZZE A;  3S9E A;  3TCH A;  4MBP A;  4N6D A;  4GRK A;  3PPP A;  1LBZ A;  3IOU A;  4R74 A;  4IO7 A;  1KWH A;  4N13 A;  5FHO A;  4G77 A;  1B4Z A;  4PFT A;  4DXB A;  4YU0 A;  3VE1 B;  4RPO A;  4P0I A;  1P1Q A;  5EQ9 A;  3BKI B;  2QSX A;  4GX3 A;  3W15 C;  1MQJ A;  1EZ9 A;  4ZS9 A;  1NV0 A;  3PU5 A;  2OLB A;  2Y84 A;  4OVP A;  5DEX B;  1FBH A;  1GGG A;  2PFZ A;  4DXC A;  4H6D A;  3K02 A;  3RNN A;  2R8T A;  1EU8 A;  3KC1 A;  3C36 A;  1FTO A;  1NV3 A;  4YKP A;  4FED A;  3KBR A;  4GL8 A;  3TTR A;  4R72 A;  5EHM A;  4ONY A;  3HST A;  5EYF A;  4O7M A;  4NG7 A;  3U72 A;  3OOA A;  4KHZ E;  4IO3 A;  3JYR A;  5JK4 A;  3IOR A;  1Y3N A;  3RLF E;  3GBB A;  1DPP A;  3MZB A;  3E3K A;  3M3F A;  4FAJ A;  3TPA A;  4F3P A;  5TP9 A;  2Z8F A;  4LAT A;  1FW0 A;  1JEU A;  1B7Z A;  3KOS A;  1PC3 A;  3LC8 A;  4PCD A;  1P1U A;  2D3I A;  3LSX A;  1F9B A;  2E1S A;  1SD3 A;  2G93 A;  2XXQ A;  5FHM A;  4AS5 A;  1GV8 A;  1OLA A;  2DYX A;  1QJM A;  5I3S A;  3MP8 A;  5TPA B;  1QUJ A;  1FBC A;  1TWY A;  3FXQ A;  1Y1M A;  2VD3 A;  5EHS A;  4P1E A;  4GXS B;  4JVI A;  4E0X A;  4G4P A;  4MNI A;  4NF5 A;  3OMB A;  2D21 A;  1IXG A;  5ET7 A;  4FIM A;  1ZU0 A;  1A55 A;  1M5D A;  2V3U A;  3HCQ A;  3RPL A;  2DWI A;  3UIF A;  1Y3P A;  4DDD A;  4OYV A;  3MVX A;  2XA5 A;  1B51 A;  1HSE A;  1B3G A;  1EH3 A;  1I6A A;  4WEP A;  1MY4 A;  2VPN A;  4FEC A;  4RA1 A;  3IO4 A;  1MXV A;  2ANJ A;  4AS4 A;  3N5L A;  4P9K A;  2I49 A;  4GX4 A;  2Y7P A;  4OHN A;  3FXB A;  2CZH A;  3PUV E;  1B4H A;  1TFD A;  4PBQ A;  5A5X B;  4NWC A;  1R1N A;  3LUY A;  4G68 C;  2Y7W A;  2ZNS A;  4MLQ A;  4DCX A;  4NF4 A;  3Q29 A;  4UAC A;  4EDP A;  3G3K A;  3K1M A;  2CEY A;  3EHT A;  3Q26 A;  1SI0 A;  4IGT A;  4Q5T A;  5EQA A;  3T93 B;  1H3D A;  1MY3 A;  1DCU A;  1ELJ A;  4OEN A;  2GHA A;  3VVE A;  2F6P A;  3OO9 A;  4X1B A;  3FV2 A;  2H4I A;  1FPJ A;  1FCK A;  3UK4 A;  5JEI A;  4GFR A;  3CHG A;  3A29 A;  4JXI A;  3QSL A;  3HV1 A;  4GWS A;  4X8R A;  1UIU A;  2GFE A;  5ELV A;  3PD8 A;  2B4L A;  1IMA A;  3PTY A;  1B1X A;  4GF8 A;  3QUJ A;  1LGB C;  2Q74 A;  1LCT A;  4NF6 A;  4LON B;  1DMB A;  4JVC A;  1QKA A;  3TTM A;  2XXP A;  5FHN A;  3IJO B;  1O7T A;  2A5T A;  3SES A;  4AB6 A;  1Z7N E;  3IAZ A;  3C33 A;  5DTB A;  3DM0 A;  3ZKK A;  3T66 A;  1AOV A;  3TEP A;  4GWO A;  1B3L A;  2OJT A;  2QL3 A;  3QIM A;  1FQB A;  3FVO A;  1URS A;  3OD7 A;  1OQG A;  4MNC A;  2D5W A;  1B52 A;  4POX A;  1VFD A;  2F97 A;  2F5X A;  5IM2 A;  3TFL A;  3VV5 A;  2UYF A;  4F1Y A;  3MBP A;  2UVG A;  3IB2 A;  3OO7 A;  1D9V A;  4GX6 A;  4DZ1 A;  4ELP A;  1EZO A;  1OQH A;  3HN0 A;  3U94 A;  1DOT A;  1P1O A;  2ZYO A;  4GWW A;  3UA8 A;  2OWS A;  2RIN A;  2WKY A;  4G8M A;  1GR2 A;  5I57 B;  2I3V A;  3K6X A;  3PMW A;  3PUX E;  4YMA A;  1FQE A;  4ZDM A;  3DP8 A;  4N81 A;  5LOM A;  4GQO A;  3T9H B;  1URG A;  2M8C A;  3H06 B;  4HCW A;  3C4M A;  3JV9 A;  1A40 A;  1FBF A;  3EF7 A;  3RTW B;  2Y7K A;  1ZJL A;  3SEX A;  2Z8D A;  3IOV A;  3OXN A;  4H8J A;  3IJX B;  5CI5 A;  1PB9 A;  2XXU A;  1NH8 A;  5HPQ A;  4YB7 A;  5I59 B;  3ROJ A;  4Z7E A;  4GXA A;  2UVJ A;  2Y7R A;  1NNT A;  3SKP A;  4FEB A;  3MC2 A;  5H8Q A;  3CSG A;  4LQ2 A;  4F22 A;  1VE4 A;  4RNS A;  4FOR A;  4JSO A;  5AA2 B;  3O66 A;  5KCJ B;  3TUS A;  1Y9U A;  3N6T A;  4R2F A;  5I56 B;  3U93 A;  2BJI A;  1LBX A;  1A8E A;  3EKI A;  2DE3 A;  2REG A;  4Q30 B;  2YJP A;  3MZ1 A;  4MHF A;  2FBP A;  3O6H A;  5EYH A;  3MJN A;  4UAB A;  3PMV A;  4P11 A;  2WYP A;  4LA9 A;  2DXY A;  2X26 A;  4EQ9 A;  1NV2 A;  4F31 B;  1PBQ A;  3V89 B;  5JTY A;  2VGQ A;  4U1Z A;  3CFX A;  4MEV A;  4KPT A;  1BTJ A;  4G8N A;  1OIB A;  4I1D A;  3FJG A;  4ZEI A;  5IZ3 A;  2X7Q A;  1AH5 A;  3CSB A;  3V83 A;  1FPE A;  3Q25 A;  4YKK A;  4PP0 A;  5ET8 A;  3CI8 A;  2VPO A;  1FPD A;  4F18 A;  1MXW A;  1SW1 A;  2PT1 A;  2CZL A;  4OXV A;  3OSR A;  3L6H A;  4OVJ A;  3SZP A;  2OBG A;  2HAU A;  3FBP A;  2NUV A;  4KCC A;  4Z0I A;  1LCF A;  3FGS A;  3H3G A;  5I5P A;  3KZG A;  3T1B A;  4DIG A;  4ELR A;  2QPQ A;  1MY1 A;  3KG2 A;  1KA1 A;  1JEV A;  4GL0 A;  4IO2 A;  1SDX A;  3RQT A;  3KEI A;  2HAV A;  1B1H A;  2HZK A;  3MW0 A;  4U4X A;  1JET A;  4O7I A;  4EF2 A;  1XS5 A;  3BIG A;  2X7P A;  1VR5 A;  3PPN A;  4X1D A;  3DEL B;  4F29 A;  3T96 B;  2V4C A;  1JVX A;  1GVC A;  2XXK A;  3K01 A;  4K3F A;  1N7W A;  4DXU A;  2GHB A;  2WBB A;  4LUB A;  4TLL B;  2O1M A;  3H6T A;  4MF3 A;  1NNK A;  4ESW A;  4OER A;  1SBP A;  2DWJ A;  4U22 A;  1USY H;  1B6H A;  1O63 A;  4P8B A;  5EYG A;  1TT1 A;  3E79 A;  4BDO A;  3K1N A;  3H6V A;  1N84 A;  2F7C A;  2QMX A;  3LUZ A;  2G29 A;  5BWJ A;  1RYX A;  2HQ0 A;  4ZEF A;  5M2V A;  4GD5 A;  2Y7I A;  1BKA A;  1Y1Z A;  3FXR A;  1MQG A;  4QXD A;  4RYA A;  3TZA A;  2B3B A;  2Y5K A;  2F7B A;  4OVQ A;  2REJ A;  2ZMB A;  4EXL A;  3SEY A;  4KXP A;  1LBW A;  4P56 A;  1NNF A;  2PYY A;  3CIJ A;  4JWO A;  1LFI A;  3SET A;  3U92 A;  2XXY A;  5CM6 A;  3CFZ A;  5CMB A;  1S50 A;  1S9T A;  1URD A;  1MM6 A;  2B3F A;  3A3U A;  4IR8 A;  1KA0 A;  5CMC A;  5DVI A;  2CZI A;  5IZ1 A;  4GIZ A;  4X9T A;  4LN5 A;  5HM4 B;  3UOR A;  1JW4 A;  3M3K A;  1DSN A;  4H45 A;  3R26 A;  5CC2 A;  1POT A;  2ONK E;  4R9G A;  4PTK A;  3P7I A;  3WAF A;  4OMB A;  2DS9 A;  1CE2 A;  4KYD A;  4F19 A;  4P3L A;  3O6G A;  4OEU A;  3RN8 A;  1FTJ A;  3KC0 A;  3H7M A;  1PB7 A;  3IOT A;  4I3Y A;  5A5L A;  1B5J A;  3IB1 A;  1JVY A;  4QBA A;  3K00 A;  5I58 A;  2RC8 A;  1HSL A;  2F35 A;  2ZZX A;  4TLM B;  4XFE A;  3B7D A;  3TYH A;  1N7X A;  1MS7 A;  1P1W A;  3TOD A;  1NUY A;  1LB9 A;  3HHG A;  3QXM A;  1L5T A;  3D1R A;  5DEX A;  1FPB A;  2F8D A;  1I69 A;  4QFN A;  4I8C A;  4NX1 A;  1DPE A;  3ILT B;  5ICQ A;  4P0G A;  5H8H B;  4YKI A;  4LQ5 A;  2DOJ A;  2ZXT A;  2O1L A;  1IZ1 A;  1S7Y A;  1YCJ A;  3C35 A;  1UQW A;  1BIY A;  3RUM A;  4OET A;  1D9Y A;  1FTA A;  3MP1 A;  4QHQ A;  2Q88 A;  3FVG A;  3U8Q A;  4H1X A;  4BDL A;  3SDF A;  2V93 A;  2XXW A;  2XXR A;  4JB7 A;  2ALU A;  3FXU A;  1CNQ A;  4U4S A;  4F39 A;  3GXA A;  2DVC A;  4R6K A;  3VXB A;  1Q35 A;  4RK9 A;  4QFK A;  1VDW A;  4ELQ A;  2XXH A;  1FQF A;  2I58 A;  2FVZ A;  3RPL B;  1BP5 A;  3IL1 B;  2PX1 A;  3QYT A;  3BFU A;  3B50 A;  1MH4 A;  2QRY A;  3PGF A;  4OQO A;  1JP4 A;  1YYZ A;  1M5F A;  3QUF A;  3I5O A;  5TPA A;  1UTB B;  5F1Q A;  3Q28 A;  4JDF A;  1D4N A;  1Q1K A;  4LVQ A;  4F3B A;  1LBV A;  5L9S A;  2P3V A;  4ND9 A;  4GBV A;  2Z8E A;  3G3F A;  4FAT A;  2Q9T A;  2FA7 A;  4IO5 A;  4ISU A;  1XVY A;  3FV1 A;  2Q8J A;  4NF4 B;  1FQC A;  4MIJ A;  3FD3 A;  3MUQ A;  2H99 A;  4PFB A;  4DI3 D;  2O6A A;  4HE1 A;  2NOO A;  4XXU A;  4LZ8 A;  4YAH X;  4RK2 A;  4YIC A;  2AYS A;  3PV0 E;  4BLA A;  2FHY A;  1QUL A;  4XEQ A;  3T22 A;  1NUZ A;  2WEF A;  1UTH B;  1FPG A;  5I2K A;  5ISU A;  4OVT A;  3FAT A;  4I40 A;  4H0W A;  5AA4 A;  1UIV A;  3ODB A;  4HXV A;  4GOT A;  5CRY A;  1IQ7 A;  1MY0 A;  3G3J A;  3LSF B;  5AA2 D;  4ESX A;  2P2A A;  3I3V A;  2ZYM A;  4C1T A;  1JW1 A;  2QJE A;  3GZG A;  4TQU Q;  2OWT A;  4E0W A;  4MNP A;  4Q0C A;  4KYE A;  4XKR A;  2LAO A;  1NH7 A;  3MVW A;  2V25 A;  3N94 A;  3H4Z A;  3KOT A;  1JW5 A;  4NF6 B;  1A7L A;  1Q9D A;  2DE2 A;  4ELO A;  2NVU B;  2HCA A;  3QMF A;  3FJ7 A;  1ANF A;  4G68 A;  1B3E A;  2DWA A;  2DQV A;  3M3L A;  2O68 A;  1RKM A;  1RDY A;  4XF5 A;  5CBR A;  3G3I A;  2HFB A;  1A54 A;  1B2H A;  2R6G E;  3USD A;  2WYK A;  1VSO A;  1LST A;  1PBP A;  2O7U A;  3C9H A;  3BBR A;  1R9L A;  2HZL A;  2OX3 A;  1D9Q A;  2KQZ A;  1YPN A;  1Z7M E;  5I2N A;  4DI4 B;  5FBP A;  1SI1 A;  2CZK A;  4GLI A;  2OWZ A;  2P0S A;  2XWO A;  3K1P A;  1IUD A;  2RKM A;  1OVB A;  4ZE9 A;  5H8N A;  2OZZ A;  1ZIU A;  2OPE A;  1EZP A;  3O97 A;  3EN3 A;  1NV6 A;  3QK6 A;  1MXZ A;  1EYI A;  4PQJ A;  4LP2 B;  4YKJ A;  4F2O A;  1H45 A;  3E13 X;  4WKM A;  3VFJ A;  2QVR A;  4MCO A;  4ZEB A;  3SER A;  4KQP A;  3RY3 A;  5KZT A;  3FVK A;  2ZYN A;  3H6U A;  1AWB A;  4FJP A;  1D3K A;  4OWD A;  2MKZ A;  5H8S A;  5EQ7 A;  3S9L C;  4NQ8 A;  3E9X A;  4DE8 A;  3MAM A;  2Q2A A;  4QRZ A;  1SVX B;  3CG3 A;  4N8G A;  3EHS A;  3IX1 A;  1IXC A;  4OEV A;  4WXJ A;  4KR5 A;  4I62 A;  4KFQ A;  4OES A;  1NFT A;  3FJM A;  1QUK A;  2R71 A;  4U21 A;  3L6G A;  3U1O A;  1MXU A;  3Q27 A;  4PFW A;  3MPL A;  3RYD A;  3ONM A;  2ABH A;  3TQW A;  3C31 A;  3RPW A;  3G7W A;  3T9X B;  3SEV A;  2O84 X;  3KJT A;  1B5H A;  1NI9 A;  5I59 A;  4YB5 A;  1ATG A;  2H25 A;  1SYH A;  5JTY B;  1LAH E;  4YB6 A;  3KJ7 A;  2QS3 A;  1IMB A;  1MXX A;  3MQ9 A;  4HTG A;  1MY2 A;  3ISP A;  3DP6 A;  3OEN A;  2RCA A;  3VDF A;  5CMK A;  1J1N A;  1K9Z A;  1MQH A;  1EYK A;  5IZ3 B;  4NGU A;  4IO6 A;  3CR9 A;  5I56 A;  3DLN A;  4LZ7 A;  4N15 A;  3PD9 A;  4POW A;  2XXT A;  1LBB A;  4PAF A;  4XIG Q;  1NUX A;  1IIW A;  1LBC A;  4ZE8 A;  4HCY A;  4PAK A;  2XWI A;  1QGX A;  5FTI A;  2XXV A;  3KSX A;  3B8B A;  1MPC A;  3K4U A;  4OFO A;  4MJO A;  1B7U A;  1NNP A;  1XOC A;  2XWV A;  3A09 A;  5B7D A;  2XHD A;  2QMW A;  4H46 A;  1ZTY A;  2RC9 A;  3W9W A;  5KDT B;  4BDM A;  1O64 A;  3BIH A;  2ZZV A;  4XKN A;  1IME A;  1B46 A;  1QKB A;  4YMB A;  3WAE A;  2R9J A;  4WED A;  1QUI A;  5L9O A;  3ZSF A;  3K6W A;  1FRP A;  3K2D A;  2ZYK A;  1LB8 A;  1P1N A;  1B3F A;  3LBS A;  3C34 A;  1SQY A;  5K2Y A;  5H8F B;  3TQL A;  1B05 A;  1JQF A;  2VP1 A;  4H5F A;  4I3E A;  4Q8R A;  4KYS A;  1BK4 A;  3KN3 A;  3UN6 A;  1KZ8 A;  4GWU A;  4PFU A;  1IMC A;  1CB6 A;  1B9J A;  2DSF A;  1H44 A;  4RPN A;  2AL5 A;  2NXO A;  2HPG A;  2CMO A;  2Q89 A;  4KCD A;  1MH3 A;  3O2A A;  3VVF A;  3T0J A;  4JSD A;  1FTM A;  1N0T A;  4NF8 B;  1XVX A;  1N04 A;  2B65 A;  2QS2 A;  1MRP A;  2XD3 A;  2YLN A;  3JZJ A;  4N4U A;  5K2X A;  4MLV A;  1NV1 A;  4JVD A;  4KD5 A;  3R7X A;  2O7I A;  3MZ9 A;  4G61 A;  4EQ7 A;  3N26 A;  2QS4 A;  4EQB A;  1IXI A;  4H67 A;  3G3G A;  3FVN A;  1AMF A;  2F34 A;  4ZEC A;  3T9V A;  1B5I A;  2UXA A;  4EF1 A;  1DK4 A;  2I0B A;  2AL4 A;  3TTL A;  1M5C A;  1G0H A;  1MQI A;  1B3H A;  1FQA A;  3HPI A;  1A8F A;  1B0L A;  2H98 A;  1M5B A;  4MFI A;  3S4U A;  4IGR A;  4RJZ A;  5CBS A;  1N3X A;  1H76 A;  3KBZ A;  3IB0 A;  1NV7 A;  3KN8 A;  3FUZ A;  3OEK A;  1FBD A;  5I58 B;  5IZZ A;  2QS1 A;  4MAG A;  3VVD A;  1P99 A;  4NED A;  4MMP A;  3V5A A;  2KR0 A;  3M8U A;  4H8I A;  2GRV A;  3RT8 A;  3H03 A;  4O94 A;  1RDZ A;  3ECR A;  5TU0 A;  2I0C A;  5B70 A;  4HE2 A;  2L5V A;  4DCY A;  5AA1 A;  4QSD A;  5TP9 B;  1LAX A;  4KI0 E;  4YZZ A;  4NMY A;  3TCG A;  2UVI A;  1DTZ A;  1A99 A;  4U23 A;  3F11 A;  2W7Y A;  1MQD A;  3RGY A;  3PUY E;  3N6U A;  3D4G A;  3EQ1 A;  1MPD A;  2F78 A;  3TTK A;  2XXX A;  4BDR A;  4OFL A;  5ICT A;  1IIT A;  3A3C A;  4IO4 A;  3OSQ A;  4G8H A;  5L8D A;  4QFP A;  4OAN A;  4N6P A;  2ZZW A;  3PPO A;  1PDA A;  5LDZ A;  4O8M A;  4IB2 A;  2OPD A;  1ZMG A;  5LTC A;  1FBG A;  3OO8 A;  4PE5 B;  4NF5 B;  4OVS A;  3MST A;  4R6Y A;  4FBP A;  2HXR A;  3MWB A;  5DVJ A;  3TKD A;  4X48 A;  5F24 A;  3QAX A;  4R73 A;  3CRB A;  4LZ5 A;  2XX9 A;  3B6T A;  5H8H A;  2Y5L A;  1GTK A;  4P1L A;  4OFJ A;  3LV0 A;  3FAS A;  1FTL A;  2PVU A;  4PET A;  5DYH A;  3VLW A;  2HEU A;  4M4G A;  1LFH A;  4C0R A;  5IGA A;  4DLD A;  1JNF A;  3PUW E;  1NMU A;  2F7A A;  1SW5 A;  1SYI A;  3IOW A;  3RTF B;  3NOH A;  3O9P A;  4NWD A;  3R6U A;  3S9N C;  1Y4C A;  1R9Q A;  3V8X B;  2DDK A;  3MYU A;  4F1U A;  1SPI A;  1Y3Q A;  1SW2 A;  1FPL A;  1AL3 A;  4NAP A;  3VLV A;  4G2Z A;  3EHU A;  3FZV A;  4H5G A;  5DW8 A;  3HFU A;  4EUO A;  4X04 A;  1US5 A;  2VD2 A;  1R6Z A;  2AIX A;  3TEL A;  3G3H A;  1BLF A;  4R6H A;  1UTB A;  5I2K B;  1B7H A;  2HXW A;  3OO6 A;  1HSJ A;  2F3B A;  2PT2 A;  3K6U A;  1FBP A;  5AA4 B;  3UGW A;  1FPK A;  5IAI A;  3KSJ A;  4TOZ A;  3D4C A;  3CFL A;  1LAF E;  4HW8 A;  3CG1 A;  2QFL A;  3K6V A;  4OA4 A;  1OVT A;  5ESY A;  2DVZ A;  1ZKB A;  5DT6 A;  2I48 A;  1XI6 A;  4PDH A;  3E4R A;  2PBW A;  2DXR A;  2E0S A;  4N8Y A;  1AIV A;  3PPR A;  4O3B A;  3RT6 B;  4C1U A;  5A5X A;  4QFL A;  5DVF A;  2PMS A;  1Y4T A;  4BDN A;  1II5 A;  2IEE A;  4THI A;  4PGP A;  1RDX A;  3KN7 A;  3TCF A;  3S9M C;  4GVO A;  1UTH A;  4HE0 A;  2OK2 A;  3GBA A;  4N91 A;  2ONR A;  1MG1 A;  1XHY A;  4BDQ A;  4NF0 A;  4G68 B;  1YZ0 A;  5I84 A;  3TAJ A;  2IA4 A;  2A5T B;  3IR1 A;  4GWX A;  1FQD A;  1FJ6 A;  4ZZA A;  4EXK A;  4GWY A;  4H65 A;  4F1V A;  2JJK A;  2F36 A;  1T0K A;  2YPN A;  3K0V A;  4JWY A;  3FIR A;  5ITO A;  4O3C A;  4AQ4 A;  5I2N B;  1WVJ A;  2GH9 A;  2RCB A;  4ZED A;  3O6I A;  1MDP 1;  1QW0 A;  1YAE A;  2PFY A;  4PFR A;  5AA3 A;  2XX8 A;  2ONS A;  3VLU A;  3B6Q A;  2P3N A;  1K9Y A;  3MPK A;  5J1D A;  3THI A;  3IFC A;  4IY6 A;  1MPB A;  4F3G A;  5H8N B;  1EYJ A;  3DP4 A;  4NTL A;  1VFE A;  1FTK A;  1USY E;  3GYY A;  2ZNT A;  4NHB A;  4PGN A;  3MVY A;  1FSA A;  2B4M A;  3TDJ A;  5T3J A;  1Y20 A;  3IO6 A;  2I4B A;  1NV5 A;  1YXI A;  2DE4 A;  3ZS6 A;  3PMX A;  3SEW A;  2A5S A;  4PC9 A;  2OCU A;  3GLB A;  2KLF A;  4GBW A;  2DWH A;  5HBC A;  3KGC A;  3O28 A;  3OEL A;  1IMF A;  2V84 A;  1FPI A;  4QSC A;  1DTG A;  1YTV A;  2ESN A;  3CVG A;  4PFI A;  4N07 A;  5H8Q B;  5I57 A;  2UYE A;  4MH5 A;  5L9M A;  1MXY A;  3HO7 A;  4QF9 A;  4JBZ A;  1NV4 A;  1POY 1;  2VT5 A;  1LLS A;  3S2V A;  4RXL A;  2Q2C A;  2VHA A;  1ZBM A;  4F2Q A;  4M1V A;  5AE4 A;  1I6B A;  1LEV A;  2V3T A;  4QFO A;  3SEU A;  3O29 A;  1OLC A;  1I6Q A;  3ILU B;  4O3A A;  3IK6 B;  4NN3 A;  2THI A;  2CEX A;  3VXC A;  4ZEK A;  5CMM A;  3EPE A;  4XKP A;  3I6V A;  4R75 A;  1B40 A;  3BFT A;  3MVZ A;  1PB8 A;  3T9U A;  5AA2 A;  5KCJ A;  2BJJ X;  1MM7 A;  5IKB A;  3PUZ E;  3AXF A;  1WOD A;  3LR1 A;  2O69 A;  2RC7 A;  1XT8 A;  2XWK A;  4N6K A;  2H5Y A;  1TFA A;  5EQ8 A;  2NWJ A;  4MX6 A;  4AB5 A;  3MP6 A;  2Z22 A;  3TTN A;  4OTE A;  3ZKL A;  2Z23 A;  4I9D A;  1DBZ A;  2VOZ A;  3C32 A;  1B58 A;  4PFY A;  1N3W A;  1SW4 A;  2GQ1 A;  2HHM A;  3KFM A;  2I3W A;  3W9V A;  4JWX A;  1FBE A;  1NKX A;  1IXH A;  2FNC A;  1LFG A;  1LAG E;  2UVH A;  1B32 A;  4HS7 A;  1M5E A;  2DP8 A;  1INP A;  1QVS A;  4U1O A;  1MDQ A;  1XC1 A;  1OMP A;  2I6E A;  4FE8 A;  2FIX A;  1WDN A;  4OVR A;  3U65 A;  4U2R A;  3UP9 A;  4PF8 A;  4F3S A;  4L17 A;  2V3Q A;  1RYO A;  2ZNU A;  4GWZ A;  2I4C A;  4PBH A;  4ECF A;  2F6G A;  5ET6 A;  4RY1 A;  3B6W A;  1FPF A;  4XTC Q;  5F7V A;  5ITP A;  1NUW A;  2P1S A;  2PCR A;  3TMG A;  2XD2 A;  5ET5 A;  3H6W A;  5KDT A;  3HHF A;  2FIE A;  4PAI A;  4PE3 A;  1ZLQ A;  4QSE A;  2QVV A;  1NL5 A;  1PEB A;  2FYI A;  4R9F A; 
#chains in the Genus database with same CATH homology
 4MNP A;  4PDD A;  4PF6 A;  4OAN A;  2ZZW A;  1LBY A;  5LDZ A;  2F3D A;  4O8M A;  1Q9D A;  2DE2 A;  5LTC A;  2BJI A;  1LBX A;  3EKI A;  1FBG A;  3QMF A;  1G0I A;  4OVS A;  2DE3 A;  4P47 A;  3MST A;  4FBP A;  2HXR A;  5F24 A;  4MHF A;  2FBP A;  5EYH A;  2Y5L A;  4P1L A;  4UAB A;  1IMD A;  1RDY A;  3LV0 A;  2WYP A;  4XF5 A;  4PET A;  1NV2 A;  3IFA A;  2WYK A;  2Q8M A;  5IGA A;  5I7I A;  2WBD A;  2WX9 A;  4MEV A;  5J16 A;  2QVU A;  2HZL A;  3E78 A;  4N17 A;  2OX3 A;  1D9Q A;  5IZ3 A;  3NOH A;  2KQZ A;  1FJ9 A;  4DI4 B;  5FBP A;  1FPE A;  4N6D A;  2DDK A;  3MYU A;  4F1U A;  1LBZ A;  5ET8 A;  1SPI A;  1FPL A;  4NAP A;  2VPO A;  2CZK A;  1FPD A;  4F18 A;  2OWZ A;  5DW8 A;  2XWO A;  3HFU A;  4X04 A;  3SZP A;  3FBP A;  5EQ9 A;  5I5P A;  4GX3 A;  1NV6 A;  2F3B A;  1EYI A;  3T1B A;  1NV0 A;  1FBP A;  1FPK A;  2QPQ A;  4OVP A;  2QVR A;  1KA1 A;  4MCO A;  1FBH A;  2PFZ A;  2R8T A;  1AWB A;  2QFL A;  4OA4 A;  5ESY A;  2DVZ A;  2MKZ A;  2HZK A;  1XI6 A;  3KC1 A;  4PDH A;  5EQ7 A;  1NV3 A;  4NQ8 A;  4O7I A;  4N8Y A;  3BIG A;  4N8G A;  4O7M A;  4PGP A;  2V4C A;  4NG7 A;  1RDX A;  2XXK A;  4HE0 A;  5JK4 A;  4N91 A;  2WBB A;  3RYD A;  4NF0 A;  1YZ0 A;  4PCD A;  1NI9 A;  4GWX A;  4P8B A;  1FJ6 A;  5EYG A;  3E79 A;  3LUZ A;  4AS5 A;  5I3S A;  4GWY A;  4F1V A;  1IMB A;  2JJK A;  4QXD A;  1FBC A;  3ISP A;  2Y5K A;  4OVQ A;  1K9Z A;  4P1E A;  1EYK A;  5IZ3 B;  4NGU A;  4KXP A;  1LBW A;  4JVI A;  4P56 A;  4MNI A;  2PFY A;  4PFR A;  4N15 A;  4PAF A;  1NUX A;  5ET7 A;  2P3N A;  5CM6 A;  1K9Y A;  5J1D A;  4HCY A;  3IFC A;  3RPL A;  4IR8 A;  4PAK A;  1KA0 A;  2XWI A;  1EYJ A;  1QGX A;  2CZI A;  5IZ1 A;  2XA5 A;  4X9T A;  4LN5 A;  3GYY A;  3B8B A;  4H45 A;  4NHB A;  4MJO A;  4PGN A;  2XWV A;  2VPN A;  1FSA A;  4PTK A;  2B4M A;  4AS4 A;  5T3J A;  4P9K A;  4H46 A;  1NV5 A;  1YXI A;  2DE4 A;  4GX4 A;  4PC9 A;  3W9W A;  3FXB A;  2CZH A;  4F19 A;  4P3L A;  4GBW A;  3BIH A;  2ZZV A;  4PBQ A;  1IME A;  1IMF A;  1FPI A;  3KC0 A;  4PFI A;  4I3Y A;  5A5L A;  4QBA A;  1FRP A;  2CEY A;  2ZZX A;  4XFE A;  5EQA A;  1NV4 A;  1NUY A;  2VT5 A;  3D1R A;  1DCU A;  4I3E A;  1FPB A;  1BK4 A;  4M1V A;  1LEV A;  1KZ8 A;  4NX1 A;  4GWU A;  1IMC A;  1FPJ A;  3CHG A;  3A29 A;  4NN3 A;  4GWS A;  4X8R A;  2CEX A;  2B4L A;  2HPG A;  1FTA A;  3T0J A;  1IMA A;  3PTY A;  2Q74 A;  4N4U A;  1CNQ A;  4JVC A;  1NV1 A;  4JVD A;  2XWK A;  4N6K A;  4G61 A;  1VDW A;  5EQ8 A;  2FVZ A;  3RPL B;  4MX6 A;  3B50 A;  1JP4 A;  1YYZ A;  1DK4 A;  1DBZ A;  4MNC A;  1LBV A;  2GQ1 A;  1G0H A;  2P3V A;  2F5X A;  5IM2 A;  4GBV A;  2HHM A;  3W9V A;  1FBE A;  2Q9T A;  3KBZ A;  1NV7 A;  4GX6 A;  1INP A;  2FIX A;  4GWW A;  4MIJ A;  1FBD A;  4OVR A;  4PFB A;  5IZZ A;  3U65 A;  4DI3 D;  4MAG A;  4PF8 A;  2V3Q A;  4MMP A;  4HE1 A;  4GWZ A;  4PBH A;  4YIC A;  2KR0 A;  2FHY A;  4XEQ A;  5ET6 A;  1FPF A;  1NUZ A;  2WEF A;  4O94 A;  1RDZ A;  1FPG A;  1NUW A;  4N81 A;  4OVT A;  4HE2 A;  2L5V A;  2PCR A;  4I40 A;  5ET5 A;  4YZZ A;  4HCW A;  4HXV A;  1FBF A;  2FIE A;  4PAI A;  4PE3 A;  2QVV A;  3ROJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...