1IMDA

Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
266
structure length
266
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL MONOPHOSPHATASE
publication title Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 83
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1imdA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1imdA02
1NUWA 1G0IA 4I3EA 1NV0A 1G0HA 1LBZA 1Q9DA 3IFAA 5J16A 4GWZA 1FBGA 5F24A 1IMDA 2Y5LA 1KA1A 3QMFA 5ET6A 2QVRA 2DDKA 1FPGA 4GWSA 1DBZA 4GBVA 1NV4A 4HE1A 1NUXA 5ET5A 1FRPA 3RYDA 2OX3A 3LV0A 4GX4A 1JP4A 5IZ3B 1FJ6A 4KXPA 4HXVA 4O7IA 4GX3A 4HE2A 4H45A 4GWXA 5A5LA 1D9QA 4AS4A 1FBDA 4QXDA 5EQ7A 3KC1A 1NUYA 2BJIA 5ESYA 2FBPA 1XI6A 1EYKA 1IMAA 1LBWA 1FBHA 4GWWA 1NV6A 5EQ9A 1FSAA 2JJKA 1RDZA 4GX6A 2Q74A 2WEFA 2QFLA 5EYGA 5T3JA 4AS5A 5I3SA 1IMEA 1BK4A 4IR8A 1KA0A 2GQ1A 1LBXA 1AWBA 5IZ1A 3KC0A 2HHMA 1DCUA 1FTAA 2P3VA 2OWZA 1FPJA 1K9YA 2CZIA 3IFCA 4PTKA 2QVVA 1NV1A 1LEVA 1RDXA 3LUZA 5EQ8A 3A29A 1FBEA 2PCRA 5DW8A 4GWYA 2P3NA 2R8TA 2F3DA 1YXIA 3BIGA 4I3YA 5EQAA 1IMCA 2Q8MA 1K9ZA 1RDYA 2VT5A 1YYZA 5IZ3A 1INPA 1NV2A 4GWUA 4I40A 1FBFA 1NV7A 5ET8A 2CZHA 1VDWA 1DK4A 2CZKA 4FBPA 3T0JA 1FPDA 1FPBA 4MJOA 4G61A 2Y5KA 1FBCA 1IMFA 1IMBA 3BIHA 3FBPA 1SPIA 1LBVA 3RPLB 4HE0A 1KZ8A 1NV5A 4N81A 1NV3A 5FBPA 2FIEA 2FIXA 2WBBA 1FPFA 2FVZA 1EYIA 1YZ0A 1CNQA 1FPIA 5EYHA 5LDZA 3D1RA 1EYJA 3B8BA 3KBZA 1FPLA 1FPKA 1QGXA 1FPEA 3RPLA 1FBPA 2QVUA 1NI9A 4H46A 5ET7A 1NUZA 1LBYA 2WBDA 3ROJA 1FJ9A 2F3BA 2FHYA 4GBWA
chains in the Genus database with same CATH superfamily
2UVIA 4I9DA 2UYFA 2OWSA 2DDKA 1FPGA 3H6UA 1B3LA 1Y4CA 2ZNTA 2I3VA 5JK4A 3RYDA 4Q30B 1NMUA 4NE4A 3E13X 3FJGA 4HE2A 2QJEA 4YU0A 3EN3A 4JXIA 4H5GA 2WKYA 1HSJA 4OANA 1O64A 4C1TA 4PFTA 4EQ7A 3PPNA 2XXUA 1VE4A 1FSAA 1N84A 3RY3A 3PUVE 3O28A 3IJOB 4ZEIA 3B6TA 3TEPA 4GIZA 4ZECA 1JW1A 2OWZA 2ZNUA 3IOUA 3MZBA 1RDXA 3OEKA 4FE8A 1NNPA 3FGSA 1Q35A 2KR0A 4PETA 1ZBMA 3VLUA 1B4ZA 4X48A 3CVGA 4H67A 1INPA 4DI4B 1B3HA 5CC2A 1B7HA 1JEVA 3T0JA 3R26A 3GBAA 5M2VA 1IZ1A 2I3WA 3N26A 1NNKA 1SYHA 1XC1A 4G8HA 1A8EA 1DOTA 3W9WA 1NNTA 1MRPA 2P0SA 5FHNA 1H76A 3TQWA 4UACA 3I3VA 3U8QA 4NF4A 5CMBA 1Q9DA 3K2DA 1ZKBA 4BDRA 2QRYA 4LZ5A 1YAEA 5EHMA 4NQ8A 4O94A 3QUJA 3KN7A 5L9OA 1B58A 3TKDA 5IZ3B 4PGNA 1FJ6A 5H8NA 4C1UA 3JYRA 1FQDA 4QRZA 5JTYB 3RTFB 3RLFE 3G3FA 3SEXA 2ZYNA 2XWOA 2PMSA 1A54A 1DTZA 1R1NA 1XHYA 4JVDA 3ONMA 3UORA 3KC0A 2DE4A 4LZ7A 2ZYKA 1LLSA 1FBEA 5KCJA 2A5TA 3IORA 3Q25A 4MNCA 4XKPA 3CFZA 2B4LA 1SW4A 3PUXE 1Y3NA 1BTJA 3PTYA 3H7MA 1IXCA 5IKBA 1B5IA 5CBRA 1H43A 2I4BA 5I58B 2YPNA 4BDLA 2O84X 4KHZE 4FEDA 3UA8A 1DSNA 4F31B 1UIVA 1SW2A 1LBVA 2YLNA 4PQJA 2OPEA 1SI0A 3WAFA 4PDDA 1KZ8A 2F36A 2DWAA 3S9MC 2I0CA 3TTLA 3NOHA 3FJMA 1AIVA 1QUIA 1FPLA 1JW4A 2XHDA 1POTA 4HCYA 2QVUA 2YJPA 5FTHA 4DE8A 3VXBA 1NUZA 2PFYA 3I5OA 5A5XA 4PAKA 1GGGA 4PCDA 1FQFA 4YB7A 3DP6A 2OBGA 5AA4A 4U4XA 5ET5A 3DP8A 3EF7A 2E1SA 3B6QA 1US5A 3RTWB 5J1DA 3LUYA 1D4NA 4X04A 1B6HA 5H8HB 1Y1MA 2Z23A 1FTKA 4IGRA 4JB7A 4R6HA 4POXA 3BFTA 1MXVA 3PUZE 4N13A 1R9LA 4HCWA 1LEVA 2NXOA 4OVQA 3THIA 2VGQA 3CRBA 5K2YA 2CEYA 4IY6A 5DTBA 4YB5A 3CG3A 1BIYA 2ESNA 3LBSA 4LATA 1DK4A 1GR2A 2H98A 3HPIA 4DCXA 4ZS9A 3RPLB 4RXLA 2ONSA 3C36A 2H25A 2FIEA 1I6AA 3IB0A 3W15C 2HAVA 3B8BA 4P1EA 1MH4A 4FIMA 2ZZWA 4FECA 1JW5A 1DMBA 3FXRA 4QSDA 4NMYA 1FJ9A 3FVGA 4GBWA 2B3BA 1NUWA 1JVYA 5J16A 1CE2A 2XWKA 2VPOA 4N17A 5ELVA 4HE1A 2H5YA 4P3LA 4MHFA 2A5SA 1BLFA 5I56B 4GX4A 2V84A 1UIUA 4RY1A 4DXBA 3PU5A 1OQGA 1D9QA 2IA4A 4AB5A 4NF8B 3UP9A 4E0XA 2DXRA 4GWWA 2JJKA 4LZ8A 3KOTA 5CBSA 2R6GE 4YKJA 5I3SA 4KCDA 2O7UA 3M3LA 4MAGA 4LQ2A 2XWVA 1L5TA 5TP9A 2F3DA 4Z0IA 2R9JA 5JEIA 4IY5A 2HEUA 2Q8MA 4X1DA 3PUWE 4R72A 5H8FB 4RA1A 1LGBC 4HS7A 5CRYA 3K1NA 3V83A 1MY2A 2NVUB 4DXCA 2FYIA 3G3KA 1VR5A 1FBCA 3IOVA 3U65A 2FIXA 3DP4A 5LTCA 1MH3A 3QAXA 4PE3A 2QMXA 2XD3A 4KYDA 3D1RA 3C4MA 2NWJA 5CMKA 1Y1ZA 4IO2A 2QS2A 3MP6A 3TPAA 4P9KA 4JVCA 5F1QA 2VHAA 1LBZA 4N6PA 3S4UA 4OENA 2QVRA 3T9UA 1ELJA 2B65A 2UVGA 1RKMA 5CM6A 1MPBA 3GBBA 3KGCA 4GX3A 5KDTB 1NKXA 4QFLA 5DEXA 4GWXA 4TQUQ 1B3EA 2I49A 2IEEA 4OFLA 5TPAB 5ITPA 1SYIA 3M3FA 1SVXB 1R9QA 4IO5A 4G4PA 1BK4A 4ZZEA 1FQAA 2DWIA 1I6QA 4OWDA 1TFAA 4M4GA 3SESA 5DW8A 3HHFA 2R8TA 3FXUA 1YXIA 1RYXA 1MXXA 1PBPA 5HM4B 1IMCA 1BP5A 1ZJLA 2Y7RA 3O6HA 3T22A 1Q1KA 3TZAA 1P1NA 1NV7A 4F39A 1D9YA 1YTVA 4RK2A 3TCHA 4FBPA 4BDQA 3OO9A 4G61A 2Y5KA 4O8MA 4QFOA 3G7WA 3R7XA 1CB6A 1USYH 4HE0A 4OERA 5I57A 4XKNA 4R9GA 4NF5B 1FPKA 4PDHA 4E0WA 5DVIA 4GVOA 3CSGA 4U1OA 3IO4A 2ONKE 1MM6A 4ELQA 3IFAA 2ZZVA 2VD2A 1LFIA 3DM0A 5DT6A 4H1XA 3E9XA 3C32A 1NV4A 3SERA 1F9BA 1NH7A 1KWHA 3TTMA 2Z22A 3IB2A 3FV2A 4O3CA 3BBRA 3ISPA 2RINA 1NUYA 4MX6A 5AA2A 2XXKA 4JVIA 3IR1A 1B0HA 4Q5TA 4OETA 4UABA 4X8RA 1P1UA 3TELA 1HSLA 1P99A 3G3GA 3T96B 1B1XA 1P1QA 2QFLA 1IMEA 4K3FA 3ECRA 4R6YA 4IO7A 4EQBA 4PFBA 5IZ1A 4KQPA 1MXYA 1LAFE 3SDFA 2O1LA 3OSRA 4UA8A 3PUYE 2DE3A 2QS4A 4I1DA 2DVCA 3BIGA 3KEIA 3VVDA 1QVSA 1P1WA 3GZGA 1B3FA 1XVXA 3RUMA 4F18A 2HZLA 5L9SA 2G29A 2RCAA 1URGA 3E4RA 1M5CA 4Q8RA 1OLAA 3C9HA 2Y7WA 5H8QB 1FPBA 2Y84A 4EF2A 3LSLA 4QHQA 1B5HA 2XXHA 3MZ9A 4O7MA 4XIGQ 3T93B 2F6GA 4OEUA 4N81A 4U23A 1IUDA 2GRVA 3IB1A 4OZ9A 1YZ0A 2PT1A 3H3GA 1EYJA 2QMWA 2OJTA 3LSFB 3U72A 1WODA 2MKZA 3FVOA 4F3BA 1S50A 4IGTA 4ELOA 4G2ZA 4LQ5A 2I0BA 3GLBA 1RYOA 4PE5B 4P1LA 3RQTA 1NV0A 4IB2A 4F19A 4TLLB 5CMCA 1IMDA 3HO7A 1PB8A 1MXZA 2XXWA 4OXVA 4F1VA 4GQOA 4KXPA 3IK6B 2H99A 3FVNA 3T9XB 4ELRA 4MLQA 1LCTA 2RKMA 2O69A 4QXDA 3BKIB 2AYSA 2FBPA 5I2NB 3T1BA 2CMOA 1PC3A 5EQ9A 2VPNA 4P11A 1IQ7A 1N7XA 4AS5A 4GD5A 3G3JA 1KA0A 4KYSA 3UK4A 5JTYA 4KPTA 1DTGA 1FPJA 2UYEA 2QVVA 4OESA 4ELPA 4OEVA 2DWJA 4GL8A 3FZVA 3N94A 2Z8FA 2KLFA 3O29A 1ATGA 4PFIA 3EQ1A 4G77A 3MWBA 4OFOA 3H03A 2PYYA 1XVYA 3B6WA 4LUBA 3IX1A 3CR9A 1B40A 4WEDA 2DS9A 3MVWA 1NV3A 5I58A 1OVTA 1AH5A 1US4A 4MIJA 4DDDA 4EXKA 1TT1A 4N4UA 1MDP1 5LDZA 3K6VA 2OZZA 1TXFA 4XXUA 2Q8JA 3Q28A 3CIJA 2OWTA 4M1VA 1G0IA 4RK9A 2ONRA 2V3TA 3G3HA 3V5AA 3B50A 2F8DA 4PC9A 1KA1A 2Q88A 2L5VA 3VE1B 1S9TA 2Y7IA 2HXRA 4RJZA 4PFRA 3IJXB 3MC2A 3KSXA 3QYTA 4EUOA 2QL3A 5I2KB 1LAHE 4GFRA 3D4GA 1Z7ME 2F34A 1LBWA 3S9LC 1PBQA 2GHAA 1UTBB 4MEVA 1MY3A 5EYGA 2GQ1A 3U92A 4YKIA 2V25A 2P2AA 3K6WA 1FTJA 1HSEA 4DLDA 3KSJA 4NTLA 3FASA 3K6XA 3B7DA 3H6WA 2XXYA 2ANJA 2REJA 3PPOA 1FCKA 5A5XB 3ZS6A 4QSCA 5I5PA 4U22A 1I6BA 5ICQA 3OO6A 1ZIUA 1DPEA 3OO7A 1SQYA 3Q26A 2QPQA 3OXNA 4N07A 2Q2AA 3RPWA 1IMFA 1IMBA 1II5A 3TUSA 1AMFA 3CFLA 3CHGA 3PD9A 4EDPA 1B1HA 1FPFA 3LSXA 4U1ZA 3OSQA 4G8MA 4XF5A 3T9HB 3QIMA 1B7ZA 4TLMB 3RPLA 3SEWA 5I59B 2RC7A 5A5LA 2DVZA 5CI5A 1GTKA 1LAGE 2FA7A 3MSTA 3GXAA 3FD3A 3VDFA 1ZTYA 4GRKA 4WXJA 2Y7KA 4BLAA 1JP4A 2AIXA 4KCCA 2F35A 4O7IA 4RNSA 4H45A 2O7IA 1D9VA 3PMXA 4AS4A 3AXFA 3IL1B 5TU0A 4DCYA 1SW5A 5I56A 1MG1A 4IR8A 2VD3A 4YICA 3RN8A 4NF8A 4R6KA 2M8CA 1MY4A 2W7YA 3LUZA 5EQ8A 4RPOA 4U4SA 1MPCA 3ZKLA 3KN3A 4N91A 5B7DA 2XX9A 5HPQA 1QJMA 3H4ZA 3QK6A 3TMGA 4ZEDA 1R6ZA 5F7VA 3PMVA 4P56A 1PDAA 4NF0A 4I40A 1LBBA 1MXWA 1FBFA 4MF3A 4MCOA 2XXIA 2I48A 2Q89A 1FTMA 3BIHA 1FQEA 3PMWA 5LOMA 4R74A 2V3UA 1TWYA 5H8FA 2VOZA 4IO6A 2GFEA 3O2AA 1QULA 2FVZA 1Y9UA 2CEXA 5B70A 4BDOA 1CNQA 3OD7A 4YKPA 4OYVA 1A7LA 2X7PA 1A55A 4P8BA 1URDA 4FORA 3W9VA 1J1NA 5IGAA 3VLWA 4ZEKA 1LSTA 1GVCA 3TTNA 1O7TA 2GHBA 3QMFA 2PVUA 4F1UA 1NUXA 4PFUA 3MVXA 1FRPA 4OMBA 3ZSFA 4F2OA 3KJTA 4HXVA 1ZLQA 1UTHB 2ZYMA 3SEVA 4FJPA 1ZU0A 1FW0A 4MFIA 5FTIA 4IO4A 5L9MA 1AL3A 3A3CA 3MVYA 4TOZA 3FXQA 1EU8A 4NN3A 4WEPA 4ZZAA 3ILUB 1A40A 2HXWA 2XWIA 1N04A 5KDTA 2RC9A 2THIA 3FUZA 2WEFA 1B52A 3A3UA 3N6TA 2F97A 4PBHA 3E79A 1EZPA 5FHMA 5AE4A 5TPAA 3IFCA 2WYKA 1PB7A 2O1MA 4ESWA 2XXPA 2P3NA 2LAOA 3MUQA 1LFHA 1QW0A 4H5FA 2PFZA 4YMAA 2ZYOA 4EF1A 3LSWA 1NV2A 5ET8A 4G8NA 5L8DA 3SZPA 4XKQA 3C35A 2F7AA 4OQOA 4XEQA 3FIRA 3S9NC 4XKRA 2OCUA 3CSBA 3K02A 4PP0A 4NF6B 1IXIA 1A99A 3M8UA 4MBPA 3MPLA 3F11A 1D3KA 3C31A 5H8SA 3P7IA 4QFPA 1B0LA 4JSOA 1M5BA 3GYYA 2X7QA 2F3BA 3C34A 2HFBA 4GWZA 5F24A 4GF8A 2Y5LA 2XX8A 3JZJA 4NF5A 2B3FA 2V4CA 2XXXA 1IXHA 3G3IA 4QSEA 1PEBA 4P0GA 3LV0A 4HTGA 1B5JA 3IOTA 1B7UA 5AA1A 3T9VA 3MBPA 4X1BA 4GXSB 3O6IA 4N8GA 2BJIA 5K2XA 3K00A 5AA2D 4GXAA 4G68B 2I58A 1NV6A 4LA9A 1RDZA 1Y3QA 1JQFA 3TODA 3PPQA 4DIGA 2H4IA 3V89B 3MPKA 3CI8A 1LBXA 4YAHX 3QSLA 2Q9TA 3Q29A 2OPDA 2HHMA 1FTAA 2P3VA 4YKKA 5IAIA 2ALUA 4PTKA 2D5WA 4RYAA 4NAPA 4GWYA 3V8XB 3CFXA 1AOVA 1Z7NE 1EZ9A 2F7BA 1RDYA 1XT8A 3L6GA 2PX1A 3TCGA 4HW8A 3H06B 4KI0E 1SW1A 3USDA 4PAFA 3HFUA 1N7WA 2F7CA 3M3KA 4PGPA 1USYE 1MPDA 1NV5A 1UQWA 1H45A 3O6GA 5AA2B 4FATA 3EHSA 1EYIA 3KOSA 1S7YA 1FPIA 5H8QA 1LAXA 3OENA 3E3KA 2PBWA 2HAUA 1JVXA 1YCJA 4ZEBA 5ET7A 3HN0A 3PPRA 4R2BA 4OA4A 4KFQA 2WBDA 1EZOA 1QUKA 5IM2A 2HZKA 2FHYA 4F3SA 4I3EA 1G0HA 4I8CA 3Q27A 3TTKA 4LVQA 1DBZA 4O3AA 3O97A 4NWCA 3OEMA 4ONYA 3TFLA 1EH3A 2D3IA 1QUJA 3K1MA 3DLNA 4F1YA 5BWJA 4Z7EA 2NUVA 3PGFA 1QKBA 5ITOA 1IMAA 3U93A 2DYXA 4IO3A 1NL5A 4OVJA 3LC8A 4R75A 4F29A 5EHSA 1MS7A 3KJ7A 4BDNA 5I2NA 1I69A 1K9YA 1NV1A 2OLBA 4NGUA 3A09A 1N3XA 3UGWA 3FATA 2DWHA 3K6UA 3RNNA 2B4MA 3MZ1A 1VSOA 2Z8DA 4POWA 5IZ3A 1JETA 1MQJA 4THIA 4JWOA 3T66A 3TDJA 1Y3PA 3FBPA 1H44A 3UN6A 2DQVA 4BDMA 2REGA 4NF4B 3HCQA 1Y20A 4MLVA 3KBZA 4DZ1A 1H3DA 4QBAA 1FPEA 2E0SA 1NI9A 1SI1A 4G68C 3D4CA 1M5DA 2GH9A 3MW0A 4LONB 5H8NB 1MY1A 2RF1A 2F5XA 2Q2CA 4NHBA 3ILTB 5ET6A 3HHGA 1MY0A 5KZTA 3OELA 4YB6A 4JWXA 3ZKKA 2OX3A 5I7IA 2BJJX 2I4CA 2I6EA 3WAEA 1WVJA 3KN8A 2WX9A 1IITA 3S2VA 2VP1A 3EPEA 3MQ9A 1OVBA 2XD2A 4QFKA 2FNCA 1JEUA 2QS3A 4XFEA 2F6PA 3JV9A 2UVHA 5KCJB 2A5TB 2XA5A 4KYEA 3BFUA 5I2KA 3C33A 1LB8A 4OHNA 3SKPA 4N6DA 2ABHA 2V93A 3KG2A 1DCUA 3PV0E 4F22A 1BKAA 4C0RA 2XXRA 1UTBA 1ZMGA 4ND9A 4AQ4A 4ECFA 4F2QA 4FEBA 3VLVA 2Z8EA 5EQAA 4ZEFA 1YYZA 1M5FA 1OQHA 4GWUA 2XXVA 3I6VA 4KR5A 5DVFA 1MXUA 2H9BA 5H8HA 2CZKA 1NFTA 4I62A 2NOOA 4FAJA 2R71A 1N3WA 2KQZA 3MP1A 5CMMA 4N8YA 3IOWA 3K0VA 3KBRA 3N6UA 4DI3D 5EYHA 5AA4B 1B3GA 2DP8A 4OFJA 2P1SA 4H46A 1OMPA 4EXLA 3K1PA 1LBYA 1FQCA 4LP2B 3ROJA 1B51A 5T3JA 3MYUA 1XS5A 1FBGA 4PFWA 2O68A 1OIBA 4GWSA 1SD3A 5I59A 2F78A 4MNPA 1N0TA 2DSFA 2O6AA 2DOJA 2ZNSA 4NG7A 3E78A 3FV1A 3QXMA 3CG1A 1JNFA 4O3BA 5ESYA 4NWDA 4ZE9A 4OVRA 3RT8A 4N15A 2ZZXA 4YZZA 3SEYA 3EHUA 2DXYA 1T0KA 3A29A 3IO6A 3EHTA 1FTOA 3O9PA 4I3YA 3LR1A 3MP8A 1XOCA 4X9TA 2VT5A 4KD5A 2HQ0A 3K01A 3VXCA 2XXTA 4JDFA 1LFGA 5ISUA 2CZHA 2V3QA 2ZMBA 1VDWA 4NEDA 5FHOA 2ZXTA 1PB9A 1SPIA 1B2HA 4H65A 5I84A 3N5LA 4ZDMA 2UVJA 1GV8A 4QF9A 1IEJA 4ISUA 4AB6A 5AA3A 1LB9A 1POY1 1SDXA 3MAMA 2RC8A 2X26A 4LN5A 4GBVA 3FJ7A 4PBQA 4GWOA 3OO8A 3HV1A 1MM7A 2QSXA 3TTRA 4P0IA 1IIWA 5BUUA 1ANFA 5HBCA 1FBDA 1MDQA 3MJNA 4NX1A 1XI6A 1EYKA 5TP9B 2D21A 3MVZA 2Q74A 1UTHA 1VFEA 3HSTA 4R73A 2DE2A 5DVJA 3VV5A 2CZLA 1MQGA 4Q0CA 1VFDA 4U21A 2CZIA 4PF6A 3FXBA 1TFDA 3U1OA 1B4HA 5IZZA 4H8IA 4ESXA 2HCAA 3PD8A 2WYPA 3L6HA 4MH5A 3FVKA 3IAZA 1LCFA 1MQIA 3U94A 1URSA 4WKMA 4JBZA 4DXUA 3VFJA 4QFNA 4RPNA 3VVFA 4U2RA 4PFYA 3S9EA 3K4UA 2HPGA 1YPNA 4OVPA 4ZE8A 5DYHA 4L17A 2XX7A 2RCBA 4MMPA 3RGYA 1O63A 1FBPA 2O51A 3H6TA 1FQBA 4OVSA 3TQLA 4NF6A 4PF8A 5DEXB 3EKIA 2XXQA 1B46A 3H6VA 4EQ9A 4N6KA 4H8JA 4GOTA 1A8FA 3TCFA 1IXGA 4JWYA 1M5EA 5EQ7A 3KC1A 3R6UA 1SBPA 4GL0A 2QS1A 3TAJA 2AL5A 2G93A 4MNIA 4YMBA 1FBHA 2PT2A 2UXAA 1MQDA 3PPPA 5ICTA 4GX6A 1AWBA 3ODBA 4G68A 1LBCA 4H6DA 4PAIA 2PCRA 3SEUA 4JSDA 1Y4TA 1MQHA 4XTCQ 1K9ZA 2Y7PA 3KZGA 3TYHA 1NNFA 3DELB 4P47A 4R2FA 5I57B 1NH8A 1B05A 2AL4A 1FPDA 1B32A 4MJOA 1FTLA 4F3PA 5EYFA 2OK2A 1OLCA 1DPPA 4GLIA 4R9FA 5FBPA 3SETA 4OVTA 1P1OA 2WBBA 3VVEA 3OMBA 3KFMA 1B9JA 3O66A 1QKAA 1WDNA 3UIFA 3RT6B 1QGXA 4OTEA 4F3GA 3QUFA 4H0WA 3OOAA 1N76A
chains in the Genus database with same CATH topology
4P9KA 2F5XA 4JVCA 1LBZA 2DVZA 4NHBA 3MSTA 5ET6A 2QVRA 2DDKA 1FPGA 5JK4A 3RYDA 5CM6A 2OX3A 5I7IA 1JP4A 4O7IA 4GX3A 4HE2A 4H45A 2WX9A 4GWXA 4AS4A 4OANA 4XFEA 1FSAA 2XA5A 1BK4A 4IR8A 4YICA 4N6DA 1DCUA 2OWZA 3LUZA 5EQ8A 1RDXA 5DW8A 2R8TA 4N91A 2KR0A 1YXIA 4PETA 5EQAA 1IMCA 1YYZA 4P56A 4NF0A 1INPA 4GWUA 4DI4B 4I40A 1FBFA 1NV7A 4MCOA 2CZKA 4FBPA 3T0JA 2KQZA 4G61A 2Y5KA 4O8MA 3BIHA 4N8YA 4HE0A 2FVZA 2CEXA 1CNQA 4DI3D 5EYHA 3W9WA 1FPKA 4PDHA 4H46A 4P8BA 1LBYA 3ROJA 3W9VA 5IGAA 5T3JA 3MYUA 1Q9DA 3IFAA 1FBGA 2ZZVA 3QMFA 4GWSA 4F1UA 4NQ8A 4O94A 1NV4A 1NUXA 1FRPA 4MNPA 5IZ3B 4PGNA 1FJ6A 4HXVA 3ISPA 4NG7A 3E78A 1NUYA 4MX6A 2XXKA 5ESYA 4JVIA 4X8RA 4UABA 4NN3A 2XWOA 4OVRA 2XWIA 4N15A 2WEFA 2QFLA 2ZZXA 1IMEA 4PBHA 3E79A 4JVDA 4YZZA 4PFBA 5IZ1A 3KC0A 2DE4A 3IFCA 2WYKA 3A29A 1FBEA 2DE3A 2P3NA 4MNCA 2B4LA 3BIGA 4I3YA 3PTYA 2PFZA 4X9TA 2VT5A 1NV2A 4F18A 2HZLA 5ET8A 2CZHA 2V3QA 1VDWA 3SZPA 1FPBA 1SPIA 1LBVA 4O7MA 4XEQA 4PDDA 1KZ8A 4N81A 1YZ0A 3NOHA 1EYJA 1FPLA 2MKZA 4HCYA 2QVUA 1NUZA 2PFYA 3GYYA 4P1LA 2F3BA 4PAKA 1NV0A 4PCDA 4F19A 4GWZA 5F24A 1IMDA 2Y5LA 2V4CA 4LN5A 4GBVA 5ET5A 4F1VA 4PBQA 3LV0A 4KXPA 5J1DA 4X04A 1FBDA 4QXDA 4N8GA 2BJIA 2FBPA 4NX1A 3T1BA 1XI6A 1EYKA 1NV6A 5EQ9A 2VPNA 1RDZA 4AS5A 2Q74A 1KA0A 2DE2A 1LBXA 4HCWA 2Q9TA 2HHMA 1FTAA 2P3VA 1FPJA 2CZIA 4PTKA 4PF6A 2QVVA 1LEVA 3FXBA 4NAPA 4GWYA 5IZZA 4OVQA 2CEYA 2WYPA 1RDYA 4PFIA 4PAFA 3HFUA 1DK4A 4PGPA 3RPLB 1NV5A 1NV3A 2FIEA 2HPGA 4OVPA 4MIJA 1EYIA 4N4UA 1FPIA 5LDZA 3B8BA 4P1EA 4MMPA 2ZZWA 1FBPA 5ET7A 4OA4A 2WBDA 4OVSA 5IM2A 4M1VA 1FJ9A 2HZKA 2FHYA 4GBWA 1NUWA 1G0IA 4I3EA 1G0HA 5J16A 4PF8A 3EKIA 3B50A 4PC9A 1KA1A 2L5VA 2XWKA 2VPOA 1DBZA 4N17A 2HXRA 4HE1A 4N6KA 4PFRA 4P3LA 4MHFA 4GX4A 1D9QA 5EQ7A 3KC1A 4MNIA 1IMAA 1LBWA 1FBHA 4GWWA 2JJKA 4MEVA 4GX6A 5EYGA 5I3SA 2GQ1A 1AWBA 4MAGA 1K9YA 1NV1A 2XWVA 4PAIA 2PCRA 4NGUA 2F3DA 2B4MA 2Q8MA 5I5PA 1K9ZA 5IZ3A 4P47A 2QPQA 1FPDA 4MJOA 1FBCA 1IMFA 1IMBA 3FBPA 3CHGA 5FBPA 3U65A 4OVTA 2FIXA 5LTCA 2WBBA 1FPFA 4XF5A 4PE3A 3D1RA 3KBZA 4QBAA 1QGXA 1FPEA 3RPLA 1NI9A 5A5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NUW A;  1G0I A;  4I3E A;  1NV0 A;  1G0H A;  1LBZ A;  1Q9D A;  3IFA A;  5J16 A;  4GWZ A;  1FBG A;  5F24 A;  1IMD A;  2Y5L A;  1KA1 A;  3QMF A;  5ET6 A;  2QVR A;  2DDK A;  1FPG A;  4GWS A;  1DBZ A;  4GBV A;  1NV4 A;  4HE1 A;  1NUX A;  5ET5 A;  1FRP A;  3RYD A;  2OX3 A;  3LV0 A;  4GX4 A;  1JP4 A;  5IZ3 B;  1FJ6 A;  4KXP A;  4HXV A;  4O7I A;  4GX3 A;  4HE2 A;  4H45 A;  4GWX A;  5A5L A;  1D9Q A;  4AS4 A;  1FBD A;  4QXD A;  5EQ7 A;  3KC1 A;  1NUY A;  2BJI A;  5ESY A;  2FBP A;  1XI6 A;  1EYK A;  1IMA A;  1LBW A;  1FBH A;  4GWW A;  1NV6 A;  5EQ9 A;  1FSA A;  2JJK A;  1RDZ A;  4GX6 A;  2Q74 A;  2WEF A;  2QFL A;  5EYG A;  5T3J A;  4AS5 A;  5I3S A;  1IME A;  1BK4 A;  4IR8 A;  1KA0 A;  2GQ1 A;  1LBX A;  1AWB A;  5IZ1 A;  3KC0 A;  2HHM A;  1DCU A;  1FTA A;  2P3V A;  2OWZ A;  1FPJ A;  1K9Y A;  2CZI A;  3IFC A;  4PTK A;  2QVV A;  1NV1 A;  1LEV A;  1RDX A;  3LUZ A;  5EQ8 A;  3A29 A;  1FBE A;  2PCR A;  5DW8 A;  4GWY A;  2P3N A;  2R8T A;  2F3D A;  1YXI A;  3BIG A;  4I3Y A;  5EQA A;  1IMC A;  2Q8M A;  1K9Z A;  1RDY A;  2VT5 A;  1YYZ A;  5IZ3 A;  1INP A;  1NV2 A;  4GWU A;  4I40 A;  1FBF A;  1NV7 A;  5ET8 A;  2CZH A;  1VDW A;  1DK4 A;  2CZK A;  4FBP A;  3T0J A;  1FPD A;  1FPB A;  4MJO A;  4G61 A;  2Y5K A;  1FBC A;  1IMF A;  1IMB A;  3BIH A;  3FBP A;  1SPI A;  1LBV A;  3RPL B;  4HE0 A;  1KZ8 A;  1NV5 A;  4N81 A;  1NV3 A;  5FBP A;  2FIE A;  2FIX A;  2WBB A;  1FPF A;  2FVZ A;  1EYI A;  1YZ0 A;  1CNQ A;  1FPI A;  5EYH A;  5LDZ A;  3D1R A;  1EYJ A;  3B8B A;  3KBZ A;  1FPL A;  1FPK A;  1QGX A;  1FPE A;  3RPL A;  1FBP A;  2QVU A;  1NI9 A;  4H46 A;  5ET7 A;  1NUZ A;  1LBY A;  2WBD A;  3ROJ A;  1FJ9 A;  2F3B A;  2FHY A;  4GBW A; 
#chains in the Genus database with same CATH topology
 2UVI A;  4I9D A;  2UYF A;  2OWS A;  2DDK A;  1FPG A;  3H6U A;  1B3L A;  1Y4C A;  2ZNT A;  2I3V A;  5JK4 A;  3RYD A;  4Q30 B;  1NMU A;  4NE4 A;  3E13 X;  3FJG A;  4HE2 A;  2QJE A;  4YU0 A;  3EN3 A;  4JXI A;  4H5G A;  2WKY A;  1HSJ A;  4OAN A;  1O64 A;  4C1T A;  4PFT A;  4EQ7 A;  3PPN A;  2XXU A;  1VE4 A;  1FSA A;  1N84 A;  3RY3 A;  3PUV E;  3O28 A;  3IJO B;  4ZEI A;  3B6T A;  3TEP A;  4GIZ A;  4ZEC A;  1JW1 A;  2OWZ A;  2ZNU A;  3IOU A;  3MZB A;  1RDX A;  3OEK A;  4FE8 A;  1NNP A;  3FGS A;  1Q35 A;  2KR0 A;  4PET A;  1ZBM A;  3VLU A;  1B4Z A;  4X48 A;  3CVG A;  4H67 A;  1INP A;  4DI4 B;  1B3H A;  5CC2 A;  1B7H A;  1JEV A;  3T0J A;  3R26 A;  3GBA A;  5M2V A;  1IZ1 A;  2I3W A;  3N26 A;  1NNK A;  1SYH A;  1XC1 A;  4G8H A;  1A8E A;  1DOT A;  3W9W A;  1NNT A;  1MRP A;  2P0S A;  5FHN A;  1H76 A;  3TQW A;  4UAC A;  3I3V A;  3U8Q A;  4NF4 A;  5CMB A;  1Q9D A;  3K2D A;  1ZKB A;  4BDR A;  2QRY A;  4LZ5 A;  1YAE A;  5EHM A;  4NQ8 A;  4O94 A;  3QUJ A;  3KN7 A;  5L9O A;  1B58 A;  3TKD A;  5IZ3 B;  4PGN A;  1FJ6 A;  5H8N A;  4C1U A;  3JYR A;  1FQD A;  4QRZ A;  5JTY B;  3RTF B;  3RLF E;  3G3F A;  3SEX A;  2ZYN A;  2XWO A;  2PMS A;  1A54 A;  1DTZ A;  1R1N A;  1XHY A;  4JVD A;  3ONM A;  3UOR A;  3KC0 A;  2DE4 A;  4LZ7 A;  2ZYK A;  1LLS A;  1FBE A;  5KCJ A;  2A5T A;  3IOR A;  3Q25 A;  4MNC A;  4XKP A;  3CFZ A;  2B4L A;  1SW4 A;  3PUX E;  1Y3N A;  1BTJ A;  3PTY A;  3H7M A;  1IXC A;  5IKB A;  1B5I A;  5CBR A;  1H43 A;  2I4B A;  5I58 B;  2YPN A;  4BDL A;  2O84 X;  4KHZ E;  4FED A;  3UA8 A;  1DSN A;  4F31 B;  1UIV A;  1SW2 A;  1LBV A;  2YLN A;  4PQJ A;  2OPE A;  1SI0 A;  3WAF A;  4PDD A;  1KZ8 A;  2F36 A;  2DWA A;  3S9M C;  2I0C A;  3TTL A;  3NOH A;  3FJM A;  1AIV A;  1QUI A;  1FPL A;  1JW4 A;  2XHD A;  1POT A;  4HCY A;  2QVU A;  2YJP A;  5FTH A;  4DE8 A;  3VXB A;  1NUZ A;  2PFY A;  3I5O A;  5A5X A;  4PAK A;  1GGG A;  4PCD A;  1FQF A;  4YB7 A;  3DP6 A;  2OBG A;  5AA4 A;  4U4X A;  5ET5 A;  3DP8 A;  3EF7 A;  2E1S A;  3B6Q A;  1US5 A;  3RTW B;  5J1D A;  3LUY A;  1D4N A;  4X04 A;  1B6H A;  5H8H B;  1Y1M A;  2Z23 A;  1FTK A;  4IGR A;  4JB7 A;  4R6H A;  4POX A;  3BFT A;  1MXV A;  3PUZ E;  4N13 A;  1R9L A;  4HCW A;  1LEV A;  2NXO A;  4OVQ A;  3THI A;  2VGQ A;  3CRB A;  5K2Y A;  2CEY A;  4IY6 A;  5DTB A;  4YB5 A;  3CG3 A;  1BIY A;  2ESN A;  3LBS A;  4LAT A;  1DK4 A;  1GR2 A;  2H98 A;  3HPI A;  4DCX A;  4ZS9 A;  3RPL B;  4RXL A;  2ONS A;  3C36 A;  2H25 A;  2FIE A;  1I6A A;  3IB0 A;  3W15 C;  2HAV A;  3B8B A;  4P1E A;  1MH4 A;  4FIM A;  2ZZW A;  4FEC A;  1JW5 A;  1DMB A;  3FXR A;  4QSD A;  4NMY A;  1FJ9 A;  3FVG A;  4GBW A;  2B3B A;  1NUW A;  1JVY A;  5J16 A;  1CE2 A;  2XWK A;  2VPO A;  4N17 A;  5ELV A;  4HE1 A;  2H5Y A;  4P3L A;  4MHF A;  2A5S A;  1BLF A;  5I56 B;  4GX4 A;  2V84 A;  1UIU A;  4RY1 A;  4DXB A;  3PU5 A;  1OQG A;  1D9Q A;  2IA4 A;  4AB5 A;  4NF8 B;  3UP9 A;  4E0X A;  2DXR A;  4GWW A;  2JJK A;  4LZ8 A;  3KOT A;  5CBS A;  2R6G E;  4YKJ A;  5I3S A;  4KCD A;  2O7U A;  3M3L A;  4MAG A;  4LQ2 A;  2XWV A;  1L5T A;  5TP9 A;  2F3D A;  4Z0I A;  2R9J A;  5JEI A;  4IY5 A;  2HEU A;  2Q8M A;  4X1D A;  3PUW E;  4R72 A;  5H8F B;  4RA1 A;  1LGB C;  4HS7 A;  5CRY A;  3K1N A;  3V83 A;  1MY2 A;  2NVU B;  4DXC A;  2FYI A;  3G3K A;  1VR5 A;  1FBC A;  3IOV A;  3U65 A;  2FIX A;  3DP4 A;  5LTC A;  1MH3 A;  3QAX A;  4PE3 A;  2QMX A;  2XD3 A;  4KYD A;  3D1R A;  3C4M A;  2NWJ A;  5CMK A;  1Y1Z A;  4IO2 A;  2QS2 A;  3MP6 A;  3TPA A;  4P9K A;  4JVC A;  5F1Q A;  2VHA A;  1LBZ A;  4N6P A;  3S4U A;  4OEN A;  2QVR A;  3T9U A;  1ELJ A;  2B65 A;  2UVG A;  1RKM A;  5CM6 A;  1MPB A;  3GBB A;  3KGC A;  4GX3 A;  5KDT B;  1NKX A;  4QFL A;  5DEX A;  4GWX A;  4TQU Q;  1B3E A;  2I49 A;  2IEE A;  4OFL A;  5TPA B;  5ITP A;  1SYI A;  3M3F A;  1SVX B;  1R9Q A;  4IO5 A;  4G4P A;  1BK4 A;  4ZZE A;  1FQA A;  2DWI A;  1I6Q A;  4OWD A;  1TFA A;  4M4G A;  3SES A;  5DW8 A;  3HHF A;  2R8T A;  3FXU A;  1YXI A;  1RYX A;  1MXX A;  1PBP A;  5HM4 B;  1IMC A;  1BP5 A;  1ZJL A;  2Y7R A;  3O6H A;  3T22 A;  1Q1K A;  3TZA A;  1P1N A;  1NV7 A;  4F39 A;  1D9Y A;  1YTV A;  4RK2 A;  3TCH A;  4FBP A;  4BDQ A;  3OO9 A;  4G61 A;  2Y5K A;  4O8M A;  4QFO A;  3G7W A;  3R7X A;  1CB6 A;  1USY H;  4HE0 A;  4OER A;  5I57 A;  4XKN A;  4R9G A;  4NF5 B;  1FPK A;  4PDH A;  4E0W A;  5DVI A;  4GVO A;  3CSG A;  4U1O A;  3IO4 A;  2ONK E;  1MM6 A;  4ELQ A;  3IFA A;  2ZZV A;  2VD2 A;  1LFI A;  3DM0 A;  5DT6 A;  4H1X A;  3E9X A;  3C32 A;  1NV4 A;  3SER A;  1F9B A;  1NH7 A;  1KWH A;  3TTM A;  2Z22 A;  3IB2 A;  3FV2 A;  4O3C A;  3BBR A;  3ISP A;  2RIN A;  1NUY A;  4MX6 A;  5AA2 A;  2XXK A;  4JVI A;  3IR1 A;  1B0H A;  4Q5T A;  4OET A;  4UAB A;  4X8R A;  1P1U A;  3TEL A;  1HSL A;  1P99 A;  3G3G A;  3T96 B;  1B1X A;  1P1Q A;  2QFL A;  1IME A;  4K3F A;  3ECR A;  4R6Y A;  4IO7 A;  4EQB A;  4PFB A;  5IZ1 A;  4KQP A;  1MXY A;  1LAF E;  3SDF A;  2O1L A;  3OSR A;  4UA8 A;  3PUY E;  2DE3 A;  2QS4 A;  4I1D A;  2DVC A;  3BIG A;  3KEI A;  3VVD A;  1QVS A;  1P1W A;  3GZG A;  1B3F A;  1XVX A;  3RUM A;  4F18 A;  2HZL A;  5L9S A;  2G29 A;  2RCA A;  1URG A;  3E4R A;  1M5C A;  4Q8R A;  1OLA A;  3C9H A;  2Y7W A;  5H8Q B;  1FPB A;  2Y84 A;  4EF2 A;  3LSL A;  4QHQ A;  1B5H A;  2XXH A;  3MZ9 A;  4O7M A;  4XIG Q;  3T93 B;  2F6G A;  4OEU A;  4N81 A;  4U23 A;  1IUD A;  2GRV A;  3IB1 A;  4OZ9 A;  1YZ0 A;  2PT1 A;  3H3G A;  1EYJ A;  2QMW A;  2OJT A;  3LSF B;  3U72 A;  1WOD A;  2MKZ A;  3FVO A;  4F3B A;  1S50 A;  4IGT A;  4ELO A;  4G2Z A;  4LQ5 A;  2I0B A;  3GLB A;  1RYO A;  4PE5 B;  4P1L A;  3RQT A;  1NV0 A;  4IB2 A;  4F19 A;  4TLL B;  5CMC A;  1IMD A;  3HO7 A;  1PB8 A;  1MXZ A;  2XXW A;  4OXV A;  4F1V A;  4GQO A;  4KXP A;  3IK6 B;  2H99 A;  3FVN A;  3T9X B;  4ELR A;  4MLQ A;  1LCT A;  2RKM A;  2O69 A;  4QXD A;  3BKI B;  2AYS A;  2FBP A;  5I2N B;  3T1B A;  2CMO A;  1PC3 A;  5EQ9 A;  2VPN A;  4P11 A;  1IQ7 A;  1N7X A;  4AS5 A;  4GD5 A;  3G3J A;  1KA0 A;  4KYS A;  3UK4 A;  5JTY A;  4KPT A;  1DTG A;  1FPJ A;  2UYE A;  2QVV A;  4OES A;  4ELP A;  4OEV A;  2DWJ A;  4GL8 A;  3FZV A;  3N94 A;  2Z8F A;  2KLF A;  3O29 A;  1ATG A;  4PFI A;  3EQ1 A;  4G77 A;  3MWB A;  4OFO A;  3H03 A;  2PYY A;  1XVY A;  3B6W A;  4LUB A;  3IX1 A;  3CR9 A;  1B40 A;  4WED A;  2DS9 A;  3MVW A;  1NV3 A;  5I58 A;  1OVT A;  1AH5 A;  1US4 A;  4MIJ A;  4DDD A;  4EXK A;  1TT1 A;  4N4U A;  1MDP 1;  5LDZ A;  3K6V A;  2OZZ A;  1TXF A;  4XXU A;  2Q8J A;  3Q28 A;  3CIJ A;  2OWT A;  4M1V A;  1G0I A;  4RK9 A;  2ONR A;  2V3T A;  3G3H A;  3V5A A;  3B50 A;  2F8D A;  4PC9 A;  1KA1 A;  2Q88 A;  2L5V A;  3VE1 B;  1S9T A;  2Y7I A;  2HXR A;  4RJZ A;  4PFR A;  3IJX B;  3MC2 A;  3KSX A;  3QYT A;  4EUO A;  2QL3 A;  5I2K B;  1LAH E;  4GFR A;  3D4G A;  1Z7M E;  2F34 A;  1LBW A;  3S9L C;  1PBQ A;  2GHA A;  1UTB B;  4MEV A;  1MY3 A;  5EYG A;  2GQ1 A;  3U92 A;  4YKI A;  2V25 A;  2P2A A;  3K6W A;  1FTJ A;  1HSE A;  4DLD A;  3KSJ A;  4NTL A;  3FAS A;  3K6X A;  3B7D A;  3H6W A;  2XXY A;  2ANJ A;  2REJ A;  3PPO A;  1FCK A;  5A5X B;  3ZS6 A;  4QSC A;  5I5P A;  4U22 A;  1I6B A;  5ICQ A;  3OO6 A;  1ZIU A;  1DPE A;  3OO7 A;  1SQY A;  3Q26 A;  2QPQ A;  3OXN A;  4N07 A;  2Q2A A;  3RPW A;  1IMF A;  1IMB A;  1II5 A;  3TUS A;  1AMF A;  3CFL A;  3CHG A;  3PD9 A;  4EDP A;  1B1H A;  1FPF A;  3LSX A;  4U1Z A;  3OSQ A;  4G8M A;  4XF5 A;  3T9H B;  3QIM A;  1B7Z A;  4TLM B;  3RPL A;  3SEW A;  5I59 B;  2RC7 A;  5A5L A;  2DVZ A;  5CI5 A;  1GTK A;  1LAG E;  2FA7 A;  3MST A;  3GXA A;  3FD3 A;  3VDF A;  1ZTY A;  4GRK A;  4WXJ A;  2Y7K A;  4BLA A;  1JP4 A;  2AIX A;  4KCC A;  2F35 A;  4O7I A;  4RNS A;  4H45 A;  2O7I A;  1D9V A;  3PMX A;  4AS4 A;  3AXF A;  3IL1 B;  5TU0 A;  4DCY A;  1SW5 A;  5I56 A;  1MG1 A;  4IR8 A;  2VD3 A;  4YIC A;  3RN8 A;  4NF8 A;  4R6K A;  2M8C A;  1MY4 A;  2W7Y A;  3LUZ A;  5EQ8 A;  4RPO A;  4U4S A;  1MPC A;  3ZKL A;  3KN3 A;  4N91 A;  5B7D A;  2XX9 A;  5HPQ A;  1QJM A;  3H4Z A;  3QK6 A;  3TMG A;  4ZED A;  1R6Z A;  5F7V A;  3PMV A;  4P56 A;  1PDA A;  4NF0 A;  4I40 A;  1LBB A;  1MXW A;  1FBF A;  4MF3 A;  4MCO A;  2XXI A;  2I48 A;  2Q89 A;  1FTM A;  3BIH A;  1FQE A;  3PMW A;  5LOM A;  4R74 A;  2V3U A;  1TWY A;  5H8F A;  2VOZ A;  4IO6 A;  2GFE A;  3O2A A;  1QUL A;  2FVZ A;  1Y9U A;  2CEX A;  5B70 A;  4BDO A;  1CNQ A;  3OD7 A;  4YKP A;  4OYV A;  1A7L A;  2X7P A;  1A55 A;  4P8B A;  1URD A;  4FOR A;  3W9V A;  1J1N A;  5IGA A;  3VLW A;  4ZEK A;  1LST A;  1GVC A;  3TTN A;  1O7T A;  2GHB A;  3QMF A;  2PVU A;  4F1U A;  1NUX A;  4PFU A;  3MVX A;  1FRP A;  4OMB A;  3ZSF A;  4F2O A;  3KJT A;  4HXV A;  1ZLQ A;  1UTH B;  2ZYM A;  3SEV A;  4FJP A;  1ZU0 A;  1FW0 A;  4MFI A;  5FTI A;  4IO4 A;  5L9M A;  1AL3 A;  3A3C A;  3MVY A;  4TOZ A;  3FXQ A;  1EU8 A;  4NN3 A;  4WEP A;  4ZZA A;  3ILU B;  1A40 A;  2HXW A;  2XWI A;  1N04 A;  5KDT A;  2RC9 A;  2THI A;  3FUZ A;  2WEF A;  1B52 A;  3A3U A;  3N6T A;  2F97 A;  4PBH A;  3E79 A;  1EZP A;  5FHM A;  5AE4 A;  5TPA A;  3IFC A;  2WYK A;  1PB7 A;  2O1M A;  4ESW A;  2XXP A;  2P3N A;  2LAO A;  3MUQ A;  1LFH A;  1QW0 A;  4H5F A;  2PFZ A;  4YMA A;  2ZYO A;  4EF1 A;  3LSW A;  1NV2 A;  5ET8 A;  4G8N A;  5L8D A;  3SZP A;  4XKQ A;  3C35 A;  2F7A A;  4OQO A;  4XEQ A;  3FIR A;  3S9N C;  4XKR A;  2OCU A;  3CSB A;  3K02 A;  4PP0 A;  4NF6 B;  1IXI A;  1A99 A;  3M8U A;  4MBP A;  3MPL A;  3F11 A;  1D3K A;  3C31 A;  5H8S A;  3P7I A;  4QFP A;  1B0L A;  4JSO A;  1M5B A;  3GYY A;  2X7Q A;  2F3B A;  3C34 A;  2HFB A;  4GWZ A;  5F24 A;  4GF8 A;  2Y5L A;  2XX8 A;  3JZJ A;  4NF5 A;  2B3F A;  2V4C A;  2XXX A;  1IXH A;  3G3I A;  4QSE A;  1PEB A;  4P0G A;  3LV0 A;  4HTG A;  1B5J A;  3IOT A;  1B7U A;  5AA1 A;  3T9V A;  3MBP A;  4X1B A;  4GXS B;  3O6I A;  4N8G A;  2BJI A;  5K2X A;  3K00 A;  5AA2 D;  4GXA A;  4G68 B;  2I58 A;  1NV6 A;  4LA9 A;  1RDZ A;  1Y3Q A;  1JQF A;  3TOD A;  3PPQ A;  4DIG A;  2H4I A;  3V89 B;  3MPK A;  3CI8 A;  1LBX A;  4YAH X;  3QSL A;  2Q9T A;  3Q29 A;  2OPD A;  2HHM A;  1FTA A;  2P3V A;  4YKK A;  5IAI A;  2ALU A;  4PTK A;  2D5W A;  4RYA A;  4NAP A;  4GWY A;  3V8X B;  3CFX A;  1AOV A;  1Z7N E;  1EZ9 A;  2F7B A;  1RDY A;  1XT8 A;  3L6G A;  2PX1 A;  3TCG A;  4HW8 A;  3H06 B;  4KI0 E;  1SW1 A;  3USD A;  4PAF A;  3HFU A;  1N7W A;  2F7C A;  3M3K A;  4PGP A;  1USY E;  1MPD A;  1NV5 A;  1UQW A;  1H45 A;  3O6G A;  5AA2 B;  4FAT A;  3EHS A;  1EYI A;  3KOS A;  1S7Y A;  1FPI A;  5H8Q A;  1LAX A;  3OEN A;  3E3K A;  2PBW A;  2HAU A;  1JVX A;  1YCJ A;  4ZEB A;  5ET7 A;  3HN0 A;  3PPR A;  4R2B A;  4OA4 A;  4KFQ A;  2WBD A;  1EZO A;  1QUK A;  5IM2 A;  2HZK A;  2FHY A;  4F3S A;  4I3E A;  1G0H A;  4I8C A;  3Q27 A;  3TTK A;  4LVQ A;  1DBZ A;  4O3A A;  3O97 A;  4NWC A;  3OEM A;  4ONY A;  3TFL A;  1EH3 A;  2D3I A;  1QUJ A;  3K1M A;  3DLN A;  4F1Y A;  5BWJ A;  4Z7E A;  2NUV A;  3PGF A;  1QKB A;  5ITO A;  1IMA A;  3U93 A;  2DYX A;  4IO3 A;  1NL5 A;  4OVJ A;  3LC8 A;  4R75 A;  4F29 A;  5EHS A;  1MS7 A;  3KJ7 A;  4BDN A;  5I2N A;  1I69 A;  1K9Y A;  1NV1 A;  2OLB A;  4NGU A;  3A09 A;  1N3X A;  3UGW A;  3FAT A;  2DWH A;  3K6U A;  3RNN A;  2B4M A;  3MZ1 A;  1VSO A;  2Z8D A;  4POW A;  5IZ3 A;  1JET A;  1MQJ A;  4THI A;  4JWO A;  3T66 A;  3TDJ A;  1Y3P A;  3FBP A;  1H44 A;  3UN6 A;  2DQV A;  4BDM A;  2REG A;  4NF4 B;  3HCQ A;  1Y20 A;  4MLV A;  3KBZ A;  4DZ1 A;  1H3D A;  4QBA A;  1FPE A;  2E0S A;  1NI9 A;  1SI1 A;  4G68 C;  3D4C A;  1M5D A;  2GH9 A;  3MW0 A;  4LON B;  5H8N B;  1MY1 A;  2RF1 A;  2F5X A;  2Q2C A;  4NHB A;  3ILT B;  5ET6 A;  3HHG A;  1MY0 A;  5KZT A;  3OEL A;  4YB6 A;  4JWX A;  3ZKK A;  2OX3 A;  5I7I A;  2BJJ X;  2I4C A;  2I6E A;  3WAE A;  1WVJ A;  3KN8 A;  2WX9 A;  1IIT A;  3S2V A;  2VP1 A;  3EPE A;  3MQ9 A;  1OVB A;  2XD2 A;  4QFK A;  2FNC A;  1JEU A;  2QS3 A;  4XFE A;  2F6P A;  3JV9 A;  2UVH A;  5KCJ B;  2A5T B;  2XA5 A;  4KYE A;  3BFU A;  5I2K A;  3C33 A;  1LB8 A;  4OHN A;  3SKP A;  4N6D A;  2ABH A;  2V93 A;  3KG2 A;  1DCU A;  3PV0 E;  4F22 A;  1BKA A;  4C0R A;  2XXR A;  1UTB A;  1ZMG A;  4ND9 A;  4AQ4 A;  4ECF A;  4F2Q A;  4FEB A;  3VLV A;  2Z8E A;  5EQA A;  4ZEF A;  1YYZ A;  1M5F A;  1OQH A;  4GWU A;  2XXV A;  3I6V A;  4KR5 A;  5DVF A;  1MXU A;  2H9B A;  5H8H A;  2CZK A;  1NFT A;  4I62 A;  2NOO A;  4FAJ A;  2R71 A;  1N3W A;  2KQZ A;  3MP1 A;  5CMM A;  4N8Y A;  3IOW A;  3K0V A;  3KBR A;  3N6U A;  4DI3 D;  5EYH A;  5AA4 B;  1B3G A;  2DP8 A;  4OFJ A;  2P1S A;  4H46 A;  1OMP A;  4EXL A;  3K1P A;  1LBY A;  1FQC A;  4LP2 B;  3ROJ A;  1B51 A;  5T3J A;  3MYU A;  1XS5 A;  1FBG A;  4PFW A;  2O68 A;  1OIB A;  4GWS A;  1SD3 A;  5I59 A;  2F78 A;  4MNP A;  1N0T A;  2DSF A;  2O6A A;  2DOJ A;  2ZNS A;  4NG7 A;  3E78 A;  3FV1 A;  3QXM A;  3CG1 A;  1JNF A;  4O3B A;  5ESY A;  4NWD A;  4ZE9 A;  4OVR A;  3RT8 A;  4N15 A;  2ZZX A;  4YZZ A;  3SEY A;  3EHU A;  2DXY A;  1T0K A;  3A29 A;  3IO6 A;  3EHT A;  1FTO A;  3O9P A;  4I3Y A;  3LR1 A;  3MP8 A;  1XOC A;  4X9T A;  2VT5 A;  4KD5 A;  2HQ0 A;  3K01 A;  3VXC A;  2XXT A;  4JDF A;  1LFG A;  5ISU A;  2CZH A;  2V3Q A;  2ZMB A;  1VDW A;  4NED A;  5FHO A;  2ZXT A;  1PB9 A;  1SPI A;  1B2H A;  4H65 A;  5I84 A;  3N5L A;  4ZDM A;  2UVJ A;  1GV8 A;  4QF9 A;  1IEJ A;  4ISU A;  4AB6 A;  5AA3 A;  1LB9 A;  1POY 1;  1SDX A;  3MAM A;  2RC8 A;  2X26 A;  4LN5 A;  4GBV A;  3FJ7 A;  4PBQ A;  4GWO A;  3OO8 A;  3HV1 A;  1MM7 A;  2QSX A;  3TTR A;  4P0I A;  1IIW A;  5BUU A;  1ANF A;  5HBC A;  1FBD A;  1MDQ A;  3MJN A;  4NX1 A;  1XI6 A;  1EYK A;  5TP9 B;  2D21 A;  3MVZ A;  2Q74 A;  1UTH A;  1VFE A;  3HST A;  4R73 A;  2DE2 A;  5DVJ A;  3VV5 A;  2CZL A;  1MQG A;  4Q0C A;  1VFD A;  4U21 A;  2CZI A;  4PF6 A;  3FXB A;  1TFD A;  3U1O A;  1B4H A;  5IZZ A;  4H8I A;  4ESX A;  2HCA A;  3PD8 A;  2WYP A;  3L6H A;  4MH5 A;  3FVK A;  3IAZ A;  1LCF A;  1MQI A;  3U94 A;  1URS A;  4WKM A;  4JBZ A;  4DXU A;  3VFJ A;  4QFN A;  4RPN A;  3VVF A;  4U2R A;  4PFY A;  3S9E A;  3K4U A;  2HPG A;  1YPN A;  4OVP A;  4ZE8 A;  5DYH A;  4L17 A;  2XX7 A;  2RCB A;  4MMP A;  3RGY A;  1O63 A;  1FBP A;  2O51 A;  3H6T A;  1FQB A;  4OVS A;  3TQL A;  4NF6 A;  4PF8 A;  5DEX B;  3EKI A;  2XXQ A;  1B46 A;  3H6V A;  4EQ9 A;  4N6K A;  4H8J A;  4GOT A;  1A8F A;  3TCF A;  1IXG A;  4JWY A;  1M5E A;  5EQ7 A;  3KC1 A;  3R6U A;  1SBP A;  4GL0 A;  2QS1 A;  3TAJ A;  2AL5 A;  2G93 A;  4MNI A;  4YMB A;  1FBH A;  2PT2 A;  2UXA A;  1MQD A;  3PPP A;  5ICT A;  4GX6 A;  1AWB A;  3ODB A;  4G68 A;  1LBC A;  4H6D A;  4PAI A;  2PCR A;  3SEU A;  4JSD A;  1Y4T A;  1MQH A;  4XTC Q;  1K9Z A;  2Y7P A;  3KZG A;  3TYH A;  1NNF A;  3DEL B;  4P47 A;  4R2F A;  5I57 B;  1NH8 A;  1B05 A;  2AL4 A;  1FPD A;  1B32 A;  4MJO A;  1FTL A;  4F3P A;  5EYF A;  2OK2 A;  1OLC A;  1DPP A;  4GLI A;  4R9F A;  5FBP A;  3SET A;  4OVT A;  1P1O A;  2WBB A;  3VVE A;  3OMB A;  3KFM A;  1B9J A;  3O66 A;  1QKA A;  1WDN A;  3UIF A;  3RT6 B;  1QGX A;  4OTE A;  4F3G A;  3QUF A;  4H0W A;  3OOA A;  1N76 A; 
#chains in the Genus database with same CATH homology
 4P9K A;  2F5X A;  4JVC A;  1LBZ A;  2DVZ A;  4NHB A;  3MST A;  5ET6 A;  2QVR A;  2DDK A;  1FPG A;  5JK4 A;  3RYD A;  5CM6 A;  2OX3 A;  5I7I A;  1JP4 A;  4O7I A;  4GX3 A;  4HE2 A;  4H45 A;  2WX9 A;  4GWX A;  4AS4 A;  4OAN A;  4XFE A;  1FSA A;  2XA5 A;  1BK4 A;  4IR8 A;  4YIC A;  4N6D A;  1DCU A;  2OWZ A;  3LUZ A;  5EQ8 A;  1RDX A;  5DW8 A;  2R8T A;  4N91 A;  2KR0 A;  1YXI A;  4PET A;  5EQA A;  1IMC A;  1YYZ A;  4P56 A;  4NF0 A;  1INP A;  4GWU A;  4DI4 B;  4I40 A;  1FBF A;  1NV7 A;  4MCO A;  2CZK A;  4FBP A;  3T0J A;  2KQZ A;  4G61 A;  2Y5K A;  4O8M A;  3BIH A;  4N8Y A;  4HE0 A;  2FVZ A;  2CEX A;  1CNQ A;  4DI3 D;  5EYH A;  3W9W A;  1FPK A;  4PDH A;  4H46 A;  4P8B A;  1LBY A;  3ROJ A;  3W9V A;  5IGA A;  5T3J A;  3MYU A;  1Q9D A;  3IFA A;  1FBG A;  2ZZV A;  3QMF A;  4GWS A;  4F1U A;  4NQ8 A;  4O94 A;  1NV4 A;  1NUX A;  1FRP A;  4MNP A;  5IZ3 B;  4PGN A;  1FJ6 A;  4HXV A;  3ISP A;  4NG7 A;  3E78 A;  1NUY A;  4MX6 A;  2XXK A;  5ESY A;  4JVI A;  4X8R A;  4UAB A;  4NN3 A;  2XWO A;  4OVR A;  2XWI A;  4N15 A;  2WEF A;  2QFL A;  2ZZX A;  1IME A;  4PBH A;  3E79 A;  4JVD A;  4YZZ A;  4PFB A;  5IZ1 A;  3KC0 A;  2DE4 A;  3IFC A;  2WYK A;  3A29 A;  1FBE A;  2DE3 A;  2P3N A;  4MNC A;  2B4L A;  3BIG A;  4I3Y A;  3PTY A;  2PFZ A;  4X9T A;  2VT5 A;  1NV2 A;  4F18 A;  2HZL A;  5ET8 A;  2CZH A;  2V3Q A;  1VDW A;  3SZP A;  1FPB A;  1SPI A;  1LBV A;  4O7M A;  4XEQ A;  4PDD A;  1KZ8 A;  4N81 A;  1YZ0 A;  3NOH A;  1EYJ A;  1FPL A;  2MKZ A;  4HCY A;  2QVU A;  1NUZ A;  2PFY A;  3GYY A;  4P1L A;  2F3B A;  4PAK A;  1NV0 A;  4PCD A;  4F19 A;  4GWZ A;  5F24 A;  1IMD A;  2Y5L A;  2V4C A;  4LN5 A;  4GBV A;  5ET5 A;  4F1V A;  4PBQ A;  3LV0 A;  4KXP A;  5J1D A;  4X04 A;  1FBD A;  4QXD A;  4N8G A;  2BJI A;  2FBP A;  4NX1 A;  3T1B A;  1XI6 A;  1EYK A;  1NV6 A;  5EQ9 A;  2VPN A;  1RDZ A;  4AS5 A;  2Q74 A;  1KA0 A;  2DE2 A;  1LBX A;  4HCW A;  2Q9T A;  2HHM A;  1FTA A;  2P3V A;  1FPJ A;  2CZI A;  4PTK A;  4PF6 A;  2QVV A;  1LEV A;  3FXB A;  4NAP A;  4GWY A;  5IZZ A;  4OVQ A;  2CEY A;  2WYP A;  1RDY A;  4PFI A;  4PAF A;  3HFU A;  1DK4 A;  4PGP A;  3RPL B;  1NV5 A;  1NV3 A;  2FIE A;  2HPG A;  4OVP A;  4MIJ A;  1EYI A;  4N4U A;  1FPI A;  5LDZ A;  3B8B A;  4P1E A;  4MMP A;  2ZZW A;  1FBP A;  5ET7 A;  4OA4 A;  2WBD A;  4OVS A;  5IM2 A;  4M1V A;  1FJ9 A;  2HZK A;  2FHY A;  4GBW A;  1NUW A;  1G0I A;  4I3E A;  1G0H A;  5J16 A;  4PF8 A;  3EKI A;  3B50 A;  4PC9 A;  1KA1 A;  2L5V A;  2XWK A;  2VPO A;  1DBZ A;  4N17 A;  2HXR A;  4HE1 A;  4N6K A;  4PFR A;  4P3L A;  4MHF A;  4GX4 A;  1D9Q A;  5EQ7 A;  3KC1 A;  4MNI A;  1IMA A;  1LBW A;  1FBH A;  4GWW A;  2JJK A;  4MEV A;  4GX6 A;  5EYG A;  5I3S A;  2GQ1 A;  1AWB A;  4MAG A;  1K9Y A;  1NV1 A;  2XWV A;  4PAI A;  2PCR A;  4NGU A;  2F3D A;  2B4M A;  2Q8M A;  5I5P A;  1K9Z A;  5IZ3 A;  4P47 A;  2QPQ A;  1FPD A;  4MJO A;  1FBC A;  1IMF A;  1IMB A;  3FBP A;  3CHG A;  5FBP A;  3U65 A;  4OVT A;  2FIX A;  5LTC A;  2WBB A;  1FPF A;  4XF5 A;  4PE3 A;  3D1R A;  3KBZ A;  4QBA A;  1QGX A;  1FPE A;  3RPL A;  1NI9 A;  5A5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...