1IMJA

Crystal structure of the human ccg1/tafii250-interacting factor b (cib)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
208
structure length
208
Chain Sequence
AASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCG1-INTERACTING FACTOR B
publication title The crystal structure of CCG1/TAF(II)250-interacting factor B (CIB)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 58
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2001-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1imjA00
4A5SA 5ALJA 2XQIA 4K2AA 4BVJA 2W22A 5ALRA 3W9BA 1GKLA 4IH4A 5AKXA 3C6YA 1F6WA 2ZYHA 4N5IX 4XIIA 4YASA 2OLEA 1HL7A 4J0KA 1G4HA 2VAXA 3I1YA 5FOQA 5FLKA 3ESAA 3Q0TA 1WB6A 1K5PA 5YASA 4BE9A 3FBWA 4B81A 4QDTA 1QIMA 1GKKA 5AM2A 3WWOA 2XUDA 1CEXA 4FDMA 5F4ZA 2OGSA 4GLBA 2XMSA 5K3AA 2ACEA 1SCQA 1ZJ5A 3ED1A 3M3DA 3Q8WA 5HK9A 5KREA 1PFQA 5KBYA 2Y1KA 3O4HA 3M82A 4UBLA 3PUIA 3ILSA 1YS1X 3WKBA 4EY6A 3WL6A 2OGZA 3DQZA 4YK7A 1LZKA 1CUCA 3CN9A 5K5EA 5ALEA 5FV4A 4Q34A 4C6HA 2OQIA 3EBLA 1C7JA 1EA5A 1SC9A 2B4KA 4Y2TA 2PBLA 4TPKA 3FAKA 4X71A 4Y2JA 3ESCA 2PVSA 2G5PA 5IVDA 3LCRA 1AC5A 1YA8A 5ALVA 4M0FA 4EA6A 4L0CA 3STUA 2RONA 5FDFA 4OUKX 5C7YA 1CUZA 4H35A 2O7RA 1KU6A 4EB0A 2HA5A 2LIPA 1QIIA 2Z3WA 3ZPXA 2YYSA 4FNGA 2HADA 1VKHA 4Y2YA 1QONA 1XZGA 5D3KA 1A8QA 2QUAA 2B61A 3C45A 4N8EA 2AJCA 1BEZA 4EY7A 3I28A 5AIAA 4C4ZA 2FJPA 1YSCA 2GYWA 1MAHA 2ZSIA 2XUAA 5FPQA 3C43A 4DMFA 2GZRA 2O7VA 1EX9A 3B3QA 5JARA 1TK3A 3OURA 1WHSA 1ZGBA 1IMJA 3BJMA 4NMWA 1EHYA 3QPDA 3HLKA 5AKZA 1N8SA 3QM1A 1HBJA 3FLEA 3L1IA 4Y2UA 4K6GA 3IUJA 4H7IA 4BTVA 4DSAA 4J0IA 3GA7A 3CN7A 1FJ2A 1EDEA 3FCYA 5AK6A 2HU7A 1UZAA 4OYYA 3A70A 2XUIA 4INZA 3WL5A 3O4JA 2VF2A 5EI5A 3FLAA 2JGFA 3DKKA 2QXTA 5HF6A 1H2ZA 5A71A 3WMRA 3WK9A 2QT9A 4CI9A 4B9EA 4WDQA 1H2YA 5HZGA 2O2GA 1ZD5A 5AM1A 4B83A 3FSGA 3H2KA 3HXKA 1Q0ZA 3HI4A 5DNVA 3CCBA 1PJAA 4C01A 3H2IA 2G4LA 5HFNA 4AN0A 5EHQA 4LIPD 2RAUA 4FFWA 3LS2A 2FUKA 5AKYA 1IVYA 5CRIA 5ALIA 3S2ZA 5HQ3B 3DEAA 1GZ7A 1L7QA 2CBGA 3SC2A 4P08A 1KU0A 1BU8A 4H7FA 5JAUA 4O08A 1PV1A 4K6KA 2VQ6A 1GPNA 1YCDA 3H1AA 2WUDA 3FNBA 1TCBA 4QWWA 2O2IA 4U2EA 4PV7A 2ZYIA 3FOBA 2ZJFA 1HDEA 4OB8A 2HA7A 1WB5A 2Z8XA 5A7GA 2I3ZA 4B9AA 1MU0A 2PX6A 4H0CA 2GBFA 1DWOA 3B12A 4BDSA 4FOLA 1QJ4A 3C87A 2WIJA 3I2HA 4WDRA 1CLEA 1FSSA 4BVLA 4XVCA 3DLTA 2EDAA 3VVLA 3P2MA 4LKOA 3KWJA 4BZWA 4FBMA 1Z68A 2OCGA 4KACA 4GWLA 4UHEA 2HA2A 3DOIA 1BROA 5JD6A 5K3CA 1O6GA 3G8YA 5AOCA 4X91A 5A7HA 2QM0A 4AO7A 5E4JA 4BRZA 3H18A 1R1DA 2WU4A 4LYEA 1UOOA 3E4DA 1W6RA 4U2GA 1DTEA 4UBNA 1SOMA 3BJRA 4MYDA 2PSFA 2Q0XA 5C8XA 2XMQA 4J03A 4QDZA 3D2AA 1TIBA 5AHXA 4MWTA 3R3UA 5AI8A 3JWEA 3IBTA 1XKTA 1Y7HA 3FVRA 4PW0A 1XFDA 3AZQA 5BOVA 3EQ9A 5AKJA 4DIUA 3QBJA 1DT3A 2WJ4A 4KE9A 4AZ0A 3F96A 1QIGA 4KR0A 4L72A 1AMNA 1LPMA 3EF3A 1LLFA 3O4IA 1HPLA 4UUQA 1EH5A 1N5RA 5HF9A 2OCLA 1I6WA 1DX4A 3WJ1A 3R3YA 1ACLA 3VJKA 2XMCA 1E8NA 5DNUA 2V98A 1AZWA 1XROA 3VVMA 3V1NA 1IUPA 5AM0A 2WG2A 1CV2A 5KWIA 2PPLA 4GECA 2JGMA 4CG2A 4YPVA 5D6OA 2RHWA 3STXA 4BAGA 1ORVA 5HQ3A 1XRQA 2RHTA 4JUIA 4L3WA 5CXXA 4Y7DA 4ZXFA 4P93A 4ARBA 5LZ9A 1MTZA 4UHHA 4TVKA 2HDWA 3IUNA 4G8DA 1T4MA 1DX6A 5HFAA 1VE7A 1DT5A 5CT6A 6YASA 3AUKA 1YAJA 3HC7A 1TCCA 1VJ5A 4M0EA 1FFBA 4HXFB 3ZLVA 3WJ2A 4DLNA 1XLWA 3I6ZA 3F9CA 1JMKC 4RNCA 1CVLA 4PSCA 3H2GA 3BIXA 4Q05A 2WUEA 3PE6A 1XZJA 1QIFA 5FRDA 1YR2A 4H7HA 4X6YA 4BATA 3V48A 4KYVA 3R40A 4J3JA 1CUVA 1CUAA 1UFOA 5CW2A 5AKEA 5CT4A 2PSJA 5EIEA 1QFSA 1UK9A 1P0MA 2GYVA 5IVHA 3BL8A 3H2JA 4UHCA 3G0GA 4RPCA 3HJUA 1ORWA 4G1FA 1AUOA 1RP1A 3WA6A 4DNQA 2PUHA 5LZ5A 4N8SA 1IZ8A 1EB9A 3WK5A 3BIWA 3OPMA 1UK7A 2ZSHA 5HKAA 1CPYA 2QUBA 1XZDA 4UHFA 4IH9A 2ZJ7A 4Y2XA 5CT5A 1VZ3A 2IIVA 1JFRA 3WYDA 2D0DA 3QVMA 1TQHA 4QA9A 5ALYA 4ARAA 5HF5A 1ZICA 2JEZA 2XMZA 2OCKA 4MQMA 2R11A 1R3DA 3IB3A 1EI9A 1BCRA 3GUUA 2XMRA 3E0XA 1RYYA 2GZSA 3BXPA 3D2BA 1IUOA 3DDUA 4G4GA 3IDAA 1QO7A 2HIHA 3FYUB 5LZ8A 5DTJA 2AJBA 4U2CA 3TJMA 5EHZA 4X90A 1EINA 4Y2VA 1LPAB 2QOEA 3I2FA 3I2GA 5DWDA 3NUZA 5JZBA 3G02A 4KE7A 4BRSA 1ZGCA 5LIPA 1SCIA 2HRRA 3BDIA 1X2BA 3VJLA 2CZQA 4HXEB 1ZIXA 5K3BA 4X92A 3BF7A 5ALWA 1VA5A 3AIKA 5LYYA 4H7KA 3IVMA 1CUSA 1XRPA 3W04A 4J0CA 3G9TA 2BAGA 3G7NA 5CT9A 4K5QA 3W06A 1QOZA 2DQZA 2OAEA 2PL5A 4H7JA 4A23A 5FXMA 4DGQA 1EK1A 3L1HA 4G9EA 5ALNA 5AM5A 1M33A 1XZMA 2XUJA 2JGEA 4BC1A 1WB4A 5KWJA 3G9XA 2IITA 2HM7A 3C5WP 5HK8A 1XZKA 2ES4A 1VA4A 1C7IA 5E4YA 4UHDA 4ZREA 1E66A 2BGNA 2RIPA 3JYHA 3R3VA 4ZV7A 5AI6A 1TKRA 5CURA 3EQ7A 2OCIA 3KD2A 2WIFA 5EHXA 4JYMA 2VJBA 4HS9A 1J07A 4X7BA 3W05A 4JNCA 3V1MA 3WIOA 4Y2QA 1MX9A 2CJPA 2OQVA 5ALKA 5EGNA 2BUAA 1XQYA 1SFRA 4S0XA 1F0NA 3FCXA 4UBOA 1UOPA 2XUOA 3ESBA 4HVTA 5LLSA 1H23A 3HACA 1W1IA 2DHEA 1UKAA 4BCBA 2HRQA 3T4UA 4LHEA 1RWQA 2WSLA 2XUPA 1D07A 2OG1A 1ODTC 2HA3A 3U0VA 3TRDA 3ZV7A 1TAHA 3ICVA 5AI0A 3WYNA 3YASA 2WFZA 2VJDA 1ZJ4A 2WQZA 5LZ4A 5E4TA 2BKLA 3C6BA 4IQ4A 1GPKA 1P0PA 3LIPA 5EHNA 1CUDA 2WIKA 3K9BA 5AI9A 5JD5A 1XRLA 5ALHA 3WKCA 1CUBA 5CMLA 2RGUA 2VAVA 4Q3OA 4WCVA 3QPAA 1F0PA 5E2IA 3UMJA 5JIBA 4X00A 2QJWA 3GFFA 1DWPA 3WWDA 3WL8A 3W2TA 2C5GA 3NGMA 1TCAA 3GZJA 1A8UA 4G8BA 5CH8A 3FYUA 1JKMA 5HCUA 3KXPA 4X6XA 1XKLA 4B84A 4AX4A 4BZZA 1MX5A 4WJLA 4QEKA 5J3JA 3RLIA 1YB7A 2I03A 3VXKA 2DCMA 1AX9A 1CUFA 3F98A 3I6YA 4FLEA 3C8HA 1WM1A 4FLMA 3R3WA 5A6VA 5JANA 2HL6A 2ZYSA 4KAFA 4H7EA 1CUYA 3PFBA 3WWEA 3H04A 1FFDA 1EDDA 2XUGA 1XZCA 1DWQA 5JASA 4NS4A 3RARA 3QITA 2Z5GA 4OSEA 4OU5A 1LBTA 4JEIA 1WPXA 3DL4A 4QE3A 1ODCA 1THTA 3R3XA 4U2BA 4ROTA 3N2ZB 3LLCA 3QYJA 2QXUA 1FFEA 3JW8A 1XQXA 4KE8A 4NVRA 4WY5A 1JJBA 3NWOA 3FSGD 5AOAA 2JEYA 4E15A 5IVKA 1BCSA 1W76A 1AQLA 1GXSA 1ZIYA 3LIIA 1NU6A 4UBIA 2VT7A 1XRRA 3G9ZA 5AK5A 2PSDA 5CTAA 3FYTA 3D2CA 1UOQA 2WJ6A 3D4LA 4J0GA 4XX1A 4WFJA 2C5FA 4FBLA 5EFZA 5EIHA 3V1LA 3SX4A 2XT0A 4F5ZA 5AO9A 2JGJA 3KSRA 4EY8A 4GEGA 1XZEA 4N8DA 5AI4A 1ZI6A 5ALOA 5DYTA 5AKLA 4MEBA 3ESDA 1O6FA 3ZWQA 1G42A 3AZPA 4IH1A 4FHZA 3PI6A 2WU3A 3SK0A 3AFIA 2P8SA 1BRTA 3MUOA 1H2WA 3DYIA 3M83A 2HU5A 5JALA 5ALQA 5FPPA 4BC0A 4E46A 4G8CA 3BWXA 4B85A 3PFCA 3F8SA 4HRYA 4KAAA 4RE5A 2NW6A 4BB0A 2XUKA 2DHDA 2FX5A 5AJHA 3OG9A 5LKRA 3MGAA 2ZVDA 3A6ZA 4LXGA 1HKHA 4G4IA 2JBWA 1AURA 3QMVA 5AM3A 1Q0RA 4DNOA 1BE0A 2J4FA 5AK3A 5AI5A 1CRLA 1LZLA 1UKBA 1QIDA 3V9AA 2XQGA 2QR5A 3PDCA 2OAGA 1CUEA 1LPPA 2H7XA 2WHPB 3G9UA 4Y9SA 4AB1A 4Y2PA 1JJIA 2Y6VA 1ODSA 3WL7A 4AMYA 1E3QA 3A2NA 2Z8ZA 1Q83A 1F8UA 4MQLA 5CT8A 3I2KA 4H77A 2I78A 4AZ3A 4CIBA 2ONCA 3WKAA 2H9YA 1W52X 3K6KA 4PO3X 2BCEA 4MYSA 5JATA 3DKRA 5ALZA 4BDTA 1H22A 7YASA 4ZI5A 4DMCA 3HYSA 1EK2A 2Y2VA 1U2EA 4W63A 5DYWA 3IUQA 2BGRA 3G0DA 2ZJ6A 1QIEA 3IA2A 5JAHA 4B82A 1OXMA 3GBSA 5IVIA 1MNAA 1Y7IA 4EY4A 4AN1A 3A2LA 4ZGBA 5K3EA 1QE3A 4G4JA 2E3JA 1K4YA 1WPRA 5AP9A 2ACKA 2G5TA 5AKIA 3DOHA 1CUXA 4EY5A 2XE4A 2HA0A 3IULA 2WFLB 4D9JA 5AH0A 5ALDA 1R9MA 2QKYA 3G0CA 4L9AA 4H7DA 5AM4A 3WK8A 2C7BA 2WM2A 2QJRA 3FLBA 3KOOA 1CUJA 4V2IA 4CCWA 4J0JA 4UPDA 5ALFA 3FYUC 1N5MA 1JI3A 4A16A 4FTWA 2H7YA 4PQEA 1GQSA 2GYUA 5DYYA 3DJYA 3G0IA 2C4HA 2FJ0A 5D3ZA 4OU4A 5SYMA 4AO8A 4ITVA 2VJCA 1OCEA 2ZYRA 1UXOA 1WCYA 4OD0A 3R41A 4E11A 3RKSA 2R8BA 2VTVA 1MO2A 5T4HA 3WKDA 1DQYA 4Y2RA 4DYHA 4B0OA 4GI1A 2OXEA 4C87A 3D0KA 1E5TA 2PU5A 4GHWA 4M0MA 2K2QB 4B7ZA 1J1IA 1KEZA 1VLQA 2O2HA 3KWFA 5AKGA 5A7FA 3EQ8A 4OB7A 5FKJA 2WHPA 1J06A 1SCKA 3H1BA 1CUGA 2W6CX 3EIOA 2DFPA 4BAZA 5DNWA 5T4EA 1CQWA 5AOBA 3WK6A 5D7BA 4QLAA 4EHBA 4DMKA 4AQDA 3O9MA 4U2FA 1R9NA 4X93A 2ECFA 3HSSA 3STVA 5H3HA 2B9VA 5HKBA 3U1TA 4W1RA 1XLUA 4UFNA 4TGLA 4HRXA 1X2EA 4UBMA 1MPXA 3M81A 4MEAA 5AKHA 4I19A 4ETWA 3BF8A 5JD4A 4KJXA 1K8QA 3D5EA 2C58A 3UUFA 5DJ5A 3O4GA 4FKBA 3PF9A 5T4FA 2ORYA 4UFOA 4CIAA 1DQZA 5CBKA 1UK6A 1ZD3A 2AXEA 2VEOA 3RM3A 3H17A 1EVEA 1A88A 2XUFA 3BE8A 2WTMA 3AIMA 5SYNA 3IURA 5JAOA 1QLWA 4AXBA 1L7RA 5IH7A 2G63A 2VJAA 1HLGA 1XZHA 2DR0A 2WFLA 5ALXA 4X95A 1CIJA 4YX9A 1XZLA 1U8EA 5BWCA 1FFAA 2YXPX 2XMDA 4QDXA 4B0PA 1B41A 2PSHA 4MJ3A 1W75A 4GDMA 4GW3A 4LXIA 2HU8A 3D59A 3R3ZA 3OOSA 1K63A 4FLFA 4KRYA 1QTIA 4G5XA 3VKFA 2AJDA 3NOXA 1ZOIA 3DYVA 1ZD2P 4KAJA 2PSEA 3ZLUA 3H19A 2XLBA 1ZI8A 1NU8A 1MNQA 3A2MA 2HHAA 4KEAA 2YH2A 3O0DA 3F97A 1GGVA 3HRHA 3ICWA 4PSDA 2HFKA 3S8YA 3WIBA 3FVTA 4C4XA 1VXOA 1YA4A 4OB6A 2UZ0A 3R0VA 3DCNA 4UFPA 2XQJA 3I1IA 4HAIA 4K6HA 2CUTA 1GPLA 1ACJA 5BWBA 2XMBA 4DNFA 3W9UA 3AIOA 5HF8A 1WOMA 4LYDA 1N1MA 3STTA 3I2JA 2OGTA 4HTAA 1G66A 4JH0A 3WI7A 4HXGA 2X76A 2J4CA 1QGED 3QZUA 1QIHA 1J2EA 5K3FB 4C4YA 4MWSA 2WILA 2V9ZA 5ALLA 1P0QA 4Q3KA 5ESRA 4FWBA 4XWGA 3HABA 2IX9A 3STYA 1QTRA 2XQKA 5LZ7A 1U4NA 3F67A 1OILA 2QTBA 2GBGA 2JF0A 4I3FA 1IZ7A 3C70A 3C8DA 3OM8A 4ZRDA 2WKWA 1QO9A 2ROQA 2XQFA 3E1GA 2WUFA 1VE6A 1CUHA 3WWCA 2CMFA 4X94A 5CH5A 1C4XA 2DSNA 3ZI7A 4F21A 3E3AA 2Y2UA 1CUIA 3O95A 3D3NA 3OTQA 4CG1A 1GT6A 4UBJA 2WG1A 2PUJA 5DTIA 1P0IA 4X3CA 3PF8A 5ALSA 4J0HA 2WTNA 5ALGA 4JYPA 4F60A 5ISMA 2CEKA 4WY8A 3I6MA 5CXUA 1LBSA 4U2DA 4X97A 4BBZA 1MJ5A 3AJAA 3GELA 4I4CA 2XI4A 2QRUA 4FNMA 2Z3ZA 3AZOA 1L7AA 1LNSA 5JAPA 4QDUA 3WK7A 4BP9A 2XDWA 2CB9A 4F0JA 1VOTA 2GBCA 2WUGA 4Q82A 1VXRA 2WLSA 3WK4A 4N5HX 2JGKA 1JJFA 2V97A 2V96A 2B20A 1ZD4A 4FFVA 5JADA 3QH4A 1R88A 2RI6A 4MXDA 1ZI9A 4OPMA 4DM7A 3VDXA 1LPSA 4ZWNA 1JT2A 3QMWA 3WZLA 4H18A 3WKEA 4DMHA 3PICA 2AJ8A 1A8SA 3T52A 1MT3A 4OCZA 1VZ2A 1QIKA 2PKYX 2XB6A 4W1SA 2WHRA 1Q84A 4QLOA 1IUNA 4B80A 4AMZA 1EDBA 2CKMA 1QIJA 2C0PA 1EVQA 1BN7A 1BEEA 5ALTA 2HFJA 3L1JA 4EBBA 2XUQA 1XLVA 4CCYB 3RK4A 1MAAA 3DD5A 2VSQA 4BE4A 4IO0A 4BTLA 5I9IA 1BN6A 1HQDA 4KRXA 2DQYA 4QZVA 4BYMA 1CQZA 1UK8A 3LP5A 3GROA 1XQWA 5JZSA 2EEPA 1TRHA 1XZBA 4FMPA 3VJMA 4CFSA 2H7CA 1B6GA 1CR6A 5ALMA 4WFIA 5JZ9A 1DU4A 1CFJA 1XZAA 4RGYA 5DLPA 4BCDA 2WJ3A 4W1PA 2XMGA 1WHTA 2WHQA 1ETHA 1QZ3A 4Q1VA 2JGLA 5K3FA 1E8DA 1JMYA 5A2GA 3D7RA 1XRNA 2JGIA 4AO6A 4W9RA 4GBGA 1YAHA 1AGYA 3ANTA 4P9NA 1THGA 4X85A 2VT6A 2C0QA 2PM8A 1T2NA 3ANSA 3C6ZA 1CUUA 4C88A 2VATA 5A62A 4G9GA 5I7UA 2BUBA 3WA7A 4B6GA 3AILA 3DL7A 4J0DA 1GQRA 2AJLI 1YB6A 1YASA 3DS8A 2QZPA 4BCCA 2HA4A 2WIGA 4Z49A 5BV7A 2YASA 1YS2X 1E89A 3VISA 3IUMA 1U65A 1XRMA 4BVKA 5I8PA 2XLCA 4Q3LA 3AINA 3SWWA 3BDVA 5C8VA 3ZLTA 1FFCA 2BJHA 3G0BA 3I2IA 1LPOA 2WFMA 2D5LA 5LKAA 1AKNA 1EB8A 5IKXA 2X5XA 2X8BA 2H1IA 1JU3A 2EDCA 4C89A 1NX9A 4J7AA 2VA9A 4EZIA 2DHCA 1E8MA 3N0TA 5C81A 5AKKA 4WFKA 2BFNA 1QFMA 5AK4A 2OPHA 1R50A 1K6EA 1XZIA 1JU4A 4UBKA 1W4LA 5EIAA 3C6XA 2Y6UA 3KDAA 1S8OA 4EUSA 3MVEA 1MX1A 4P92A 1XQVA 1LGYA 3HZOA 1G5FA 1X70A 4DNPA 4NZZA 4UHBA 4Y2SA 5JYCA 1CUWA 3WWPA 5K3DA 3H2HA 2J3QA 2PU7A 1UKCA 4X6UA 3B5EA 1BS9A 1ISPA 2QMQA 2BUCA 3FWHA 5LZ2A 1MN6A 4W1QA 1LPNA 3WLAA 5C8ZA 3H0CA 5ALPA 4RE6A 4BAUA 4QDOA 4IHAA 5CH3A 3MUNA 1UT6A 3IIIA 4CCYA 1USWA 4BP8A 1A7UA 1R4ZA 4DTCA 4QWMA 5AICA 2WG0A 2WIDA 4CG3A 3UUEA 4PF1A 1UWCA 5FUMA 4E14A 1Y37A 3HEAA 1EXWA 3V1KA 5FP0A 3STWA 3X3HA 4KE6A 5LP1A 5ALUA 3WQHA 3C5VA 3CCCA 1H2XA 4QNNA 3TGLA 3QPCA 3CXUA 2GBIA 2QS9A 5T4BA 3QMMA 2QVBA 4LXHA 3DNMA 4PSUA 4PNZA 4GXNA 4HZGA 2XUHA 3PUHA 1LPBB 2HA6A 2I3DA 5AIBA 3WZMA 4XJVA 2J3DA 4ZV9A 4DSZA 1DINA 2JIDA 3TEJA 3OC0A 1XZFA 3K2IA 4OYLA 3O9VA
chains in the Genus database with same CATH superfamily
3OPXA 4N0DA 3A4TA 5ALJA 3GRCA 2B8JA 1SMKA 2FLKA 4A0HA 2OQ2A 2PN1A 1T10A 3ZC3A 1HYBA 4P31A 4I9GA 5J4HA 2JATA 1WB9A 2OZLB 5BV2P 2CLLB 1GO2A 3DPUA 1CE8A 2NZWA 3L7LA 2JK0A 5DRYA 1L5KA 3RTCA 2BI8A 4F46A 1BJRE 2Z4TA 2C1EA 4UARA 1ADCA 1GLNA 4KUGA 4LPKA 4G01B 5EZYB 1QP8A 3TK1A 2Y4NA 1EQ2A 2FR8A 3KQYA 3Q5EA 2G77B 4G84A 4J0KA 2AN3A 3O31A 4ZEMA 3S2GA 4IG4A 1CZKA 1ZU4A 2JIOA 3N75A 3E9DA 5FLKA 5FOQA 1Q44A 4KFUA 4CHGA 5K03A 3RANA 2GJ4A 5YASA 4BE9A 3NUQA 4IYJA 3P32A 4YJHB 4B81A 1QRUA 3L79A 1WU7A 5H68A 3H83A 3C39A 2DFKB 5JYEA 4KTVE 3JQGB 1PZFA 2W83A 3GAMA 3QG5A 1C3OA 1UJ2A 3BH0A 3TLCA 1GKKA 2AIRA 1JXQA 3BD7A 3CG0A 5DWQA 2XUDA 1PNOA 2ZRGA 4FDMA 4NR0A 4YCBA 5M34A 1U0GA 5C8YF 2BISA 4KWHA 3H3XA 2CDNA 2XMSA 3BD9A 4NI5A 4ZA2A 5K3AA 2R6FA 3GGGA 3DV9A 1PK7A 1RFLA 4QPNA 3TLKA 4LQDA 1HG1A 1TTPB 1VJDA 4MQEB 4M1MA 5KREA 5KBYA 4XYLA 1ZD9A 4DCPA 1AS2A 3V8QA 1N9GB 1P72A 1Z5NA 2ADFA 2ILVA 2ZAYA 3M82A 3O4HA 3QE2A 2IIPA 4B3FX 1SURA 4OA5A 1E4EB 4UBLA 4ZPJA 3WMXA 1JHRA 3PU6A 2W71A 4L28A 1SCUB 3WKBA 3Q3GE 1KTIA 3WL6A 2OGZA 4AF6A 4JFAA 1DLIA 3FDZB 1LZKA 2ZRJA 3N0RA 2DHRA 4OKNA 2WTAA 5BN1A 3NAMA 2R9VA 1CUCA 1Z34A 3K8YA 4QHYA 5ALEA 4XVUA 2CF6A 2AGVA 3ZQKA 4TUYA 2JHFA 5KQMA 4IVRA 4H4EA 4I8XA 4C6HA 1GITA 2XNDA 2MR5A 5FYQA 3B1WA 2WMNB 1UBUS 1O03A 4OHCA 4YV1A 2VN8A 5EYPB 4QKQA 3TYXA 4I5DA 2ZIGA 2IPOA 3I12A 2O8DA 2GOYA 1L5RA 2EFCB 4IUCS 4FR5A 1HE5A 3PNSA 4WERA 1SC9A 3UMMA 5DNCA 2NYAA 2DGDA 4TPKA 3FAKA 4X71A 5KC8A 5CJJA 1NATA 1H2HA 3HV2A 4XR4A 3S68A 1UFKA 4MVJI 5M04A 2P11A 5LBIA 2V3WA 3IH5A 1PFUA 2O2XA 5LQJA 4NCJA 4RZUA 3SIXA 4OHYA 2EW1A 1BO6A 3LW8A 4YJ2F 4I55F 9ATCA 2OHFA 2YXBA 1DXOA 1W0CA 5DNYB 2IRWA 4RTPA 1ZUNA 3NVDA 2IS2A 4IIGA 1YA6A 3PYXA 2X0NA 3CCFA 1KMNA 1Z7GA 1E2EA 2IC5A 4X7MA 3DUFB 5KMGB 3H8WA 2JI9A 3U61B 4Z0HO 2G71A 2WSSA 3VDQA 5B64A 1QWOA 5HW0A 4YAGA 1Y4AE 4JGIA 4XUDA 3ZX4A 3NIBA 1Y8CA 5JTTA 1Z6PA 1CUZA 4H35A 2OVFA 1Q22A 1ZN8A 2B37A 4OL9A 4DA8A 2HA5A 4PIPA 2LIPA 3NHLA 1GR1A 4LSGA 1PJTA 2H16A 2ZWVA 4OXQA 1ZH2A 4EG3A 6GPBA 1PDVA 1VKHA 2HADA 3PS9A 2LKDA 4GZLA 1UL1X 2KB0A 4ZQBA 3ILXA 4C01A 3TR5A 1QZUA 2CN1A 4O1MA 3K70B 3ZR4B 3A58B 2PJDA 3HVIA 1Y5MA 1GQQA 4BLUA 3CM0A 1QQAA 1JYEA 1PE0A 1WXHA 1TK2A 1VIDA 1SIUA 4RGQA 1TU0A 1SULA 3C4VA 3ND6A 4Z54A 2AJCA 1M0WA 4A26A 2QX6A 5A4AA 4CEHA 4EY7A 3I62A 4EGJA 1RBMA 4ZMSA 3SFZA 3COVA 5KYXA 2YHIA 2C3YA 5E6RB 4FGSA 1SIOA 4ISCA 2FJPA 4MW4A 4PSVA 3UBMA 4ZMBA 3BB1A 4AG6A 2XHZA 2JEOA 2XT6A 1GV0A 1T24A 1T9CA 3KJFA 5ED0A 2X77A 4EVSA 4O4IB 3T5BA 5EERA 4AI6A 4TXMA 1GQFA 1QZZA 2GDZA 3MJRA 3N6RA 3OIFA 1W96A 3K09A 2X8LA 3GVCA 4BOYA 4CM9A 4YAWA 3NHWA 4GKVA 3V8RA 1SBZA 2BEKA 3DL0A 4LFAB 1H94A 1XI2A 3GFVA 4LHZA 2RHJA 3VBEA 1NKVA 1Z36A 3LDGA 3QU9A 1EVKA 3G8AA 4JL8A 1SUBA 2QN1A 3IQDB 4WJKB 5LA6B 4AUEA 5JISA 2H65A 5JSFA 3DP9A 3GFSA 2I1LA 2FETA 2DPLA 3SKVA 1L5WA 2MOKA 1OIWA 1V2HE 1VTKA 2ORWA 3OZ7A 1OZHA 5JI2E 1X7DA 3LRPA 5AKZA 1KAHA 1U3CA 3D64A 3TX6A 4CQJA 3LQQA 3U1VA 5K3SA 2DSTA 1G8HA 3L1IA 4XJSA 2JJ8A 3WNVA 1J56A 3IUJA 3JYNA 4H7IA 5C52B 3LA8A 5I9NA 1LDBA 3OLQA 2IU0A 3A7EA 2QPOA 4J0IA 1M8GA 1DO0A 4RD4A 3PR1A 5EMKA 4B4WA 5EAIA 3NC0C 2VQ3A 3AEQA 2W7TA 2ZIAA 4NYIQ 4FB5A 1URPA 4RD3A 2GA8A 4EI2A 2AQIA 1RYNA 1X7WB 1AV7A 4AWBA 4W8OA 4MQ6A 2A0FA 2AF4C 1Z4NA 1CG6A 4AZ0B 3DE6X 4E88A 4E13A 1F8XA 4O4JA 1KHHA 1WUJS 2XUIA 4OYYA 3C7AA 4INZA 1C50A 3GWZA 1E9CA 5DI3B 2VF2A 3WL5A 2QUIA 3ZEAA 5FTLA 1BQEA 2JGFA 3FMFA 1UR5A 1DIAA 2Y0EA 2NZXA 4DAEA 2NYUA 1PJBA 2IXGA 2NTJA 3DDZX 3KYJB 3FZGA 4W5OA 1QGZA 2HGZA 5EL0A 4CI9A 1QYVA 1EVLA 4ZFNA 1JB1A 1E5QA 4ZGWA 1UBCA 1C1DB 1GZSA 4WDQA 4MK4A 1TQ2A 2VJPA 3ZDAA 2O2GA 1RRVA 4EKGA 4FHFA 3CLUC 5AM1A 3FSGA 1G6KA 3IODA 4CMIB 5TNXA 2CLSA 8OHMA 5HOQA 4QPJC 2IY8A 1G98A 2KHZA 1Q0ZA 2EVWX 3EXEB 4FMCF 2JLSA 4OXXA 1ARZA 4LJSA 5K8IA 4ZYVA 3MAGA 4H1UA 10MHA 3DCIA 1NPTO 4EO9A 3WL3A 1I1HA 2NUTB 3AEYA 1I2MA 2WNHA 6NULA 5ILOA 4X41A 2CGEA 4J9UE 2R5FA 2RJNA 2ZYGA 1QBKC 3GRKA 3VUEA 1UZLA 2VPQA 3GLIA 1ZNXA 2DB3A 2FUKA 3MAAC 4ZCSA 4HGQA 16PKA 4I50F 1KRWA 2WOOA 3D6AA 1FJXA 5HQ3B 2PD6A 3NR2A 2FOLA 2RBEA 1Y6FA 5IKOA 2CBXA 3SC2A 3H1EA 1X87A 4PZDA 2JFWA 3N76A 4A0RA 5K99A 4EG6A 3LTNC 1MR3F 3ANNA 2V6GA 3SD7A 1F1JA 5G4LA 4XUCA 2AN9A 5JAUA 3CX7A 1KJWA 3GG9A 1H1LB 4BKOA 4C29A 2BD0A 1JQBA 1EFVA 1JBQA 4GICA 4IRMA 4EJFA 2NYRA 4IXDA 2ZUSA 3THWA 1FXSA 3H9GA 4YAKA 2Q8PA 5E3IA 1SEVA 2V7TA 4JGBA 4JVOA 5LQAA 4AKIA 3DBIA 1BS1A 4QWWA 1JBEA 1TCVA 4ZJUA 2X0IA 2X23A 1EX1A 2AT1A 2HMYB 3O7WA 2IF0A 4BS9A 2VZLA 1XPUA 4R1OA 4M98A 4EY3A 4A2QA 1HFEL 1CERA 1TM1E 2FW1A 2Q3BA 4OB8A 3VR1A 5BMVF 2JD0A 2PGIA 4OH7A 5KTTA 5FCDA 4B5KA 5JNRA 4E51A 1VECA 2NZVG 2ZBUA 2Y0DA 2WWHA 5ES4B 1XQ6A 4DR1B 4MV6A 2LVBA 2O3QA 5EEGA 2X15A 2UAGA 1SBHA 1Y1TA 4OGWA 1MU0A 3Q7IA 1CEYA 1PJ4A 1RABA 1QX3A 2HMSA 3GPLA 2VKTA 4KNYA 3TJRA 1ONSA 2H1VA 3B12A 4WHMA 4B40A 3RIEA 1PF7E 4DJ5X 1CIVA 1T13A 3FSEA 3KDPA 4ICIA 4IJKA 4ZALA 3ZD7A 1GCOA 4KZKA 2ZB4A 2CNNA 4G0YA 3L7AA 1NTRA 2D5CA 2EX1A 3HO6A 3OM0A 3OQIB 5JNSA 2UYYA 2QV0A 3QBEA 4K26A 4F04A 1ZG3A 2RB5A 4NBKA 2AC7A 2QYOA 4WDRA 4LX0A 1ECCA 1RQXA 1W85A 2VZEA 3PC4A 1CLEA 5EP2A 4QGGA 1QS0B 2W42A 4IUDS 3V7WA 4IJ6A 4UEWA 1LLUA 3BE5A 4YP5A 5KYKA 4LKOA 3T7JA 4KDFA 3KWJA 3AJRA 1W6UA 4QJ4A 4G81A 2D2VA 2PT6A 2FPWA 2WWRA 3GV0A 1N6IA 4LOAA 3GPIA 2QTRA 2ZR8A 2BFMA 2ZIFA 3BMXA 5TMPA 1FL9A 3X2EA 1JDSA 1RJEA 1ZK2A 4YMWA 3C14C 4I1VA 5DW3A 4YONB 2O07A 5CYPA 4KACA 4G1MB 1A96A 3BHNA 3TLXA 1QM5A 4GWLA 3DCYA 4N0MA 4S1NA 5AR1A 4ZVVA 5TB5A 2C5EA 2HF7A 4E5KA 1SQGA 3BQMB 3X1DA 4II7A 2OYSA 3D0RA 4R3WA 1JYFA 2HO5A 1BWPA 2BFDB 2NU8A 1RRPA 5KTYA 2JLXA 4F5YA 3H6GA 2QYSA 2O05A 3GCXA 1S9HA 4FZVA 2HA2A 3T9FA 1BROA 4Q6WA 2QLFA 1HSOA 3AK4A 1VPEA 5AOCA 5EUBA 4OQ4A 1RLIA 2VPTA 1UWVA 3DO6A 1X1DA 4X91A 5A7HA 2P9YA 5ITVA 5AHRA 3UJ8A 3WLNA 4JHLA 2RC6A 1X77A 1RWWA 1H8ED 2CNOA 4L5BA 4CMEA 1GRQA 1O8BA 4ILKA 2FPLA 2QRHA 1QUEA 1R00A 4JLVA 4JJ4A 5FBKA 1YB5A 3RV4A 4BBAA 3UNXA 4DRZA 5T7BA 2FRXA 3OF5A 4LYEA 2WJWA 2C9MA 3E4DA 4C9BA 3UHAA 2FZEA 1FVFA 5B1YA 2HPHA 2XBMA 1N2CE 4C0KA 1CZLA 3I23A 1VBFA 3IDOA 5T3UA 1E7WA 1OOEA 3PFFA 3A1TA 4II3A 4LYFA 2EIHA 1KP2A 2FMUA 3C4JA 5EE3A 3WAGA 4KSCA 2O0HA 4CR7A 5A3VA 3BWCA 1PJ2A 1D2CA 1LFDB 3UWSA 2O54A 2WWTA 2PSFA 4YDRA 1AKQA 1QH1A 3PE4A 3L8CA 1TMKA 3FNEA 3GVHA 4J03A 5IANA 2Q1XA 3TLAA 4MIEA 3CLRD 3TVTA 2J0QA 1YZGA 4K8OA 1DG1G 1X0XA 1LU9A 1D1SA 2VP6A 3HP4A 1X1SA 4HADA 3H65A 5IU6A 3LKVA 3JASB 1NT2A 5DOVA 4EABA 4W5RA 5AQEA 3C16C 2DPMA 3E9QA 2Q7DA 3G3EA 2NTVA 1AMUA 1P7YA 3AZQA 4RM3A 3W5VA 1Y4ZA 2PH3A 1QKIA 3IO5A 1W2WB 4A03A 4AG3A 3KP1A 4FEAA 3INYA 3QBJA 1DZ3A 2HK9A 4GR4A 2G08A 5JRDS 4HDNA 1Y8ZA 5TV2A 3EF3A 3QXCA 5GJCA 1SBTA 3HNOA 2CZCA 4Y9UA 1N36B 5FAKA 3LUDA 1PZGA 3GP8A 3OQPA 1TVCA 2PH7A 4HDRA 1NURA 4UUQA 1BDBA 2I2FA 2XCSB 3ENNA 3EEQA 4RKEA 1EH5A 3W0LB 1N5RA 1W4RA 2DWPA 2E4XA 1WMFA 3AHIA 4H1VA 1QYCA 1K7CA 1CJKC 1P3Y1 5HF9A 3M34A 4DMGA 1KSJA 4QJIA 5AJWA 1MV5A 2VWQA 4WKOA 1I6WA 4MB6A 4C4TA 4ENUA 1GSIA 1GFSA 1VSVA 1QYDA 2ZJBA 4P2BA 1RI2A 3R3YA 4OK5A 5EJ2A 4JP3A 3V2UA 4B7CA 3GEBA 2AMFA 2XMCA 1W5EA 3GJQA 1EGQA 2YVKA 4CR8A 2V98A 4EFNA 4LQ4A 1IBKB 2B69A 2JD2A 2V7VA 4S1OA 5GONA 2D4AA 2VBGA 3V1NA 2FP3A 3ZWAA 1NBMA 3S0JA 4B3JA 2D8MA 4RF2A 5AM0A 1CV2A 2FMKA 2JVKA 5AHWA 4LZOA 1TA0A 2CCKA 2PPLA 4GECA 4ZT5A 3EEOA 2JGMA 3LVRE 1J8VA 1YR9A 3N70A 4L0DA 3WLLA 4C4OA 4CCAA 2Q3MA 3ED5A 4OHKA 5D6OA 4CYMA 1CJUC 2CHQA 1ZK0A 2R65A 3RADC 1U7TA 2O20A 3ILYA 5CFOA 4Q3NA 4DV7B 2CJYA 2GPYA 4Q4AA 3Q3JB 3P2IA 1VCHA 5UKDA 2AOUB 4G5OA 3PVCA 4L3WA 5CXXA 1I5OA 4EDFA 1WXXA 3AJDA 4ARBA 3DVQX 3ADCA 4EBFA 1MTZA 1Y7LA 3OLZA 2WC1A 1GDDA 4NMMA 4UHHA 1TMGE 4L78A 4KLRA 1QU2A 4HX5A 4RMJA 2A58A 3EVDA 1GUFA 5CBPB 4UASA 2LR0A 3OZDA 3RAJA 5CFNA 5TEWA 5AVSA 1YQUA 3I8OA 4NOLA 5CT6A 2WVGA 3HY3A 3AUKA 1HX7A 3HC7A 4JZKA 3OT1B 4EMBA 1PR9A 4Z1MA 1D4FA 2E4AA 4DKXA 1Z6AA 2H92A 4U9UA 1DUSA 1WXDA 2OZEA 3HJCA 2GCGA 3UF0A 1SCNE 4JT8A 3MBKA 2HB6A 4MHSA 3P5BA 4A8TA 3HXPA 4QAJA 2H5EA 1XLWA 3UV3A 4A7PA 2EFDB 4QG7A 3F9CA 3LQRA 1F5SA 1DEAA 2UZAA 3VR4D 1N1EA 3AKYA 3H2GA 4HWGA 1KIMA 4EL5A 3CF4G 3WGVA 1MDFA 1RWVA 4U7WA 8ABPA 4HLCA 1UBKS 3CX8A 5AVKA 3GOQA 1LK7A 5KTPA 1GILA 5FRDA 4BV9A 3K71B 1YR2A 1Z7BA 3DZJA 4BATA 1AE1A 4KYVA 3C85A 4M1WA 4EJMA 2WSYB 3FDJA 4JB0A 4QTXA 3G2PA 3R1IA 1Z2DA 3UATA 1QDEA 1SUEA 2G25A 2WZDA 3AJ8A 3FMGA 4XSGA 1U0HC 1QB7A 3I2YX 3K6RA 3NBQA 3W8NA 3WGNA 5AKEA 2OGWA 1WD7A 1NHGA 1WP4A 1PX2A 1P5ZB 1QFSA 3BXGA 3LX4A 2CLMB 3P0JA 1UK9A 5GAJA 4C03A 4OHXA 2D54A 4ZZ0A 3NX4A 2C04A 4BPBA 2HEIA 3BL8A 2COEA 1JIJA 3M9WA 3W78A 3VV3A 1WETA 1XDWA 2PGLA 1P2VA 4QTZA 3LLMA 2OCAA 3IP5A 4F11A 1TUGA 4FYKA 2AA3A 4NZ9A 5BPFA 2NNLD 3W7BA 5LZ5A 4HBZA 1G21A 5L3SB 3WQRA 1CWUA 4D9BA 5A03A 5K6RA 1GCGA 2XJ9A 4B3RB 1RZVA 2YN2A 4RHTA 1SZJG 2DTEA 3QLUC 3A10A 2CXTA 3ZI4A 3P2OA 3OPMA 2EFHB 5K51A 2GASA 1UK7A 5DBHX 1ZGZA 4Q16A 3W9SA 1GIAA 4XLZA 3WQBA 1AQ6A 4BQSA 1GTSA 1KI8A 1L5OA 3EIHA 1EPUA 2JRLA 2NO5A 1XT6A 4LZZA 1MFZA 1JW9B 2ZJ7A 2AW3A 1A9SA 4OIFA 3ZNQA 1DCMA 3OX1A 4GMGA 3CB2A 2BMWA 1VZ3A 3BGWA 3FZQA 2IIVA 3ANMA 4KFSA 1X7ZA 3IEUA 4LRQA 3RBAA 1G6Q1 4CIXA 3S8EA 2Q29A 4JU9A 4AJPA 5G0TA 2D0DA 1OJ7A 3NBAA 3QVMA 4EYEA 5G0VA 3TBFA 5F1PA 2IHJA 5AVZA 4QL3A 3TOSA 5B7NA 5AT1A 1O95D 3LDFA 3HJRA 4QQ8A 3AVXA 4ODIA 4PYNA 1XD9A 1IHPA 5FLYA 4OHBA 1NHWA 3M1IA 2FPRA 5EPEA 3TVDA 4PN3A 2HKIA 2XMZA 5JYDA 5JC1A 2Z6QA 3DM9B 3I4CA 2NNWB 2OCKA 2B2CA 4ETMA 4Z0PA 3NHBA 5KSPA 2WJGA 1Y82A 3OE7D 5DF1A 2IYQA 5BSGA 2C54A 3RTDA 2Q3LA 5I51A 4NCAA 4I8DA 5L6MB 3CEMA 1Z3IX 1EI9A 3GUUA 3MWDB 2V7QD 3K9CA 2SKDA 3OIVA 5F21A 1H4SA 1IUOA 2R1ZA 4GI2A 1SA0B 4G4GA 3IDAA 4D9NA 1WEKA 1JL3A 2H2DA 4P4UA 1AY0A 1P33A 3DCJA 5B57C 3E9EA 1XELA 3B2NA 5LZ8A 3DEKA 2CZGA 2XHEA 1U90A 5ER6A 2I3BA 2C92A 4J1SA 2M9MA 4MUJA 1Y3HA 1MABA 1ZONA 4U2CA 1KAQA 4JY7A 4N01A 4QYSA 5JCJD 4N0QA 2L42A 5EXEA 4DM3A 4C30A 3R20A 3M6UA 4GL2A 3PXXA 1UT8A 2VA8A 1ZMXA 3I2FA 5KVAA 1EIWA 3N5KA 1SXPA 1EA7A 5FR2A 3U7IA 5JZBA 1W581 3ZU2A 4HVCA 3FUWA 1XCPA 4M9ZA 1J24A 4L5AA 3HN7A 1R6DA 1KOFA 5ANRB 3OFJA 1SCIA 4MTLA 3FKQA 1UMDA 2CSUA 1AOXA 3RVMA 4CIDA 3E1KA 3CEHA 2BFFB 3BG5A 4KXWA 3CE9A 1ZMRA 3IAFA 3MUEA 9LDTA 1ZVMA 1HG0A 3VJLA 2CZQA 2V8OA 2ZYAA 3NKLA 4X92A 3L5OA 5CIQA 1UEIA 4QXRA 1VA5A 1UBSB 3OOYA 2TRSB 3N8IA 4KXXA 4PYKA 4WBSA 1T1SA 4WZBA 3R9WA 1ABEA 3LWDA 3GLUA 1TD1A 3QSYA 4H7KA 3WWYA 5DU2A 1CUSA 4LRUA 4WK6A 2GQ0A 1O96A 4YEDA 1ZNYA 1XRPA 1Z5UA 5FNVA 2GR9A 4G0VA 3P26A 3W04A 3BTVA 2KYRA 1GGNA 3U4CA 2QX7A 4MCHA 4DXDA 5HIMA 2IA5A 2FAXA 3GU3A 3GLHE 1QF7A 1Q7GA 1KMMA 5E7JA 3VH1A 1MAUA 4XX0A 1R0WA 1PQWA 1XTIA 3CO5A 2FQXA 2FPGA 1C7QA 4E1AA 1MIHA 3HCDA 1EK1A 1M2VA 1XDUA 5EUCA 1L7OA 1E7MA 5IAOA 3AEXA 3PL5A 4MUXA 2J45A 3EZGA 3QPUA 1VB3A 4G9EA 1Y1QA 5ALNA 5JPCA 3COWA 3CW2A 1VMEA 2JGEA 4B3IA 1E2BA 1QK5A 3W8DA 4XPIA 4ENSA 1ISIA 1WB4A 5KWJA 3IC5A 2IITA 4F2WA 1QFXA 1EFPB 3FRIA 5JG7A 3ZCQA 2Z83A 1EESA 3OZFA 2PYZA 3R5HA 3EGOA 3VSBA 3ZGLA 5ICSA 1XRJA 3C5WP 3FCEA 3L1KA 4CG0A 4DC1A 2RGXA 5HK8A 1DDOA 5B3AA 1II0A 4OP2A 5J5CA 1S4QA 1DL5A 2DOKA 2ES4A 1V71A 4KPGA 2Y77A 4X84A 3UWPA 5C5IA 2RHRA 3RHSA 2XZTA 3KWMA 5IAGA 3RSQA 3TIIA 2JLBA 2YNMC 5LD2B 3QF7A 2OB1A 3AI2A 3DZIA 4ZREA 5AOVA 2BGNA 3ZJ4A 4HL6A 3DHWC 3AFHA 4C05A 2BDEA 3E18A 2BFBB 2FPKA 5DM60 1I80A 3E05A 5CURA 3EQ7A 5CNIA 1N0HA 3RW9A 3IV7A 3WX0A 4AJNA 2DF8A 2ZUEA 3LPDA 2WWWA 2Q28A 3AV3A 3WMEA 4HZUB 1SQ5A 2AOVA 3NNDA 2PLFA 3LPCA 1GV1A 4HMOA 4KQJA 3Q3EA 2I7DA 2XR1A 2ZRMA 5H80A 3T9DA 3KSUA 5JSZB 1DUIA 1ZNQO 3V1MA 2AUTA 1YOVA 2IUSA 3WIOA 3LBNA 3ZHXA 4BMNA 4L27A 2A92A 3GL9A 2VJYA 2ZUDA 3KOZA 5BN4A 2VP9A 1BE1A 4TOIA 5J1TB 3T5PA 2I87A 1D7OA 4R3NA 3WMWA 3KXKA 1J33A 2HN9A 1SFRA 1D2EA 2BHSA 4B75A 2UVPB 3UG7A 4X66B 3U7FB 4DCSA 1N0UA 3FCXA 4TLBA 4FR2A 4LISA 3OA2A 2ARKA 1M7GA 3BA1A 1Z0FA 4OM8A 4FEYA 4MLDA 2XUOA 1YQQA 1E61A 2CYCA 3B78A 2QMYA 1GQ2A 5TQJA 3QU4A 4H6PA 4AUMA 1SUIA 1T3ZA 1NV9A 3QEOA 3FFXA 1W1IA 2WJJA 5EIBC 1YHNA 1TFUA 3K94A 5D01A 1UKAA 2DUJA 4BCBA 4CWAA 1UPUA 2IQIA 4Q18A 4UATA 2O7NA 1EG7A 3JR7A 3OZSA 2WSLA 4UUOA 5J43A 1FX0A 2XUPA 4MGHA 3SM3A 2ID4A 3A1VA 4DJFC 1UM9A 2KLHA 2GJSA 1M34A 2X86A 3EXG2 4RMNA 5JH7B 5ENVA 4BWGA 1RT9A 5AVUA 1ODTC 2HA3A 2IYZA 4YYEA 1I14A 2V3VA 3TRDA 4Z2AA 5A4FS 3A9RA 5TQVA 2LE0A 1TAHA 1ZCBA 5IVPA 3DM5A 1JKJA 2FPIA 1EWRA 3WYNA 1AGXA 1CT9A 4FT2A 1R15A 2HAEA 1E2FA 2FDCA 4AYTA 2P67A 4JYCA 2SCUA 2WQZA 4AIRA 5LWHA 1G3QA 1VM6A 1ND5A 2H4YA 3KE8A 4RDIA 2I91A 2JKZA 3SJCA 2QY9A 2YJ6A 2F3QA 3P2KA 4A6DA 3PZRA 3UK6A 2ZWIA 4BMCA 3PC2A 1GPKA 3JQ9C 3A0RB 1NXTA 1RC1A 4UUNA 3NJRA 1XAIA 1Z37A 1IHOA 1E59A 1E9EA 3FDFA 1RLUA 2QP9X 5AI9A 3W8EA 4F4HA 1B3RA 4EEZA 5DX0A 2I1VB 4PYLA 3MJSA 3G8DA 3SBXA 2YJTD 1QQ7A 4WAUA 4QLBA 1FSFA 1P1HA 4AJ1A 3KTFA 1O58A 1EFRA 1BHQ1 1B00A 3FH0A 3ORHA 4BMVA 2I6XA 3TM4A 2GFQA 5A5DA 1BX1A 1GRCA 3QELB 4O4HA 5DSXA 1KOLA 2FCAA 2RGUA 2MMCA 1NM5C 2C2HA 3IOBA 4X65B 2GPBA 5DVZA 4MRRA 2Z0MA 4ESHA 4WCVA 5DBGA 4AURA 1RHUA 3ZD6A 2XKBA 3UMJA 1Z0ZA 2O48X 4G1UC 3JZAA 4V0RA 4E7PA 4AQ7A 2ZWPA 3JQAD 3FPCA 3KJQA 2WHYA 1V5EA 5DEIA 4NENA 5EE0A 4QC2A 1QP0A 4J2OA 2NUAA 4L5CA 3GZJA 1W4CA 2C9YA 3I5UA 4RFVA 3QX7A 1JKMA 4GLLA 1KMHA 5FFFA 4GDFA 3FYHA 3D4NA 3G5UA 3GA0A 4TKUA 4BZZA 2W6ID 3B7PA 3BZWA 3FOWA 3Q0IA 1R12A 1DJNA 4KYTA 2NVUB 3RSFA 2HZ7A 3Q7SA 3RAGA 4Q1FA 1H6AA 3TFOA 2ZAMA 4F6LA 3NVAA 4D0NA 1KDRA 1COWA 2RI1A 4IL5A 1XYVA 2OFPA 3BM5A 5CCEA 3I3OA 2SNIE 1KDTA 2W5UA 4URWR 1YNSA 1PL8A 1SOWA 2NQTA 2BSAA 2Q5QA 3DZ8A 4JVMA 1NIJA 4UAVA 2C4WA 3R75A 3DW1X 4DHWA 1CUFA 2L17A 3F90A 3F98A 2DWQA 3I04A 5H82A 4ANFA 2D62A 2ZIZA 2DPXA 2GKOA 1DP4A 1FE8A 2YC4C 1XXHA 3C8HA 2QAJA 4FLMA 4G1CA 4H27A 4XB1A 4BGUA 1VHJA 1X13A 4I08A 4YWJA 3GLFB 1KDOA 4UHJA 3FUTA 3QNWA 5D5QA 1KNQA 2C77A 3I73A 3A1NA 1EBBA 5AW1A 3NNSA 3PFBA 1OIVA 3O94A 3MT9A 1V3UA 1FFDA 1NUQA 1QVWA 3A4VA 4RPIA 1C1XA 4L75A 5DM0A 1V9SA 1HZZC 2ATXA 1EDDA 3L0IB 5EWLA 3UEOA 3KR1A 3HY6A 5JASA 3G23A 1I94B 1EJBA 3A36A 1N32B 1V47A 1J97A 4NS4A 5IJWA 2WW8A 2A35A 4UREA 1IPFA 4EFKA 5JXJA 3H5OA 5KCMA 6LDHA 5FWYA 2B78A 3EK2A 3ZW8A 4JEIA 1WPXA 4Q1AA 3DL4A 2ZBVA 4QE3A 1THTA 4U2BA 5EMJA 3WYCA 4PLPA 4UNIA 4PLHA 4WZAA 2H7VA 4K0RA 4O5OA 4EEKA 2QXUA 3H2YA 1ZIOA 1IRXA 2VAMA 2I34A 2XAUA 4XDYA 4RTSA 4CKBA 5T57A 3NWOA 3TNYA 3IS3A 1Z0JA 3UT5A 5F98A 2I65A 5F33A 1E77A 1E2KA 2PKQP 1XK6A 1U02A 3FKSA 3MTQA 4JAVC 3N07A 1IQPA 4N7RA 4ND7A 4RK5A 4YXWA 3W34A 1V8BA 2P5UA 1PJRA 4KTTE 3UJHA 2F4NA 3LU1A 4JJ6A 2M98A 2Q0SA 1KYQA 1BAPA 3I39X 1KFJB 4D9KA 3D4PA 4RF3A 3OHPA 4YUAA 1E98A 3H2BA 4LV8B 1VRWA 1ZXLA 2PANA 5A1JA 5EMLA 2J67A 2JIPA 4IM7A 3FYTA 1E1NA 5DO9A 2IIBA 3EMBA 4HDKB 4RPLA 1N3IA 2QQ5A 1GOTA 1UOQA 2HK6A 2WJ6A 4NBNA 4DPKA 5EJEA 4ZYWA 5A06A 5IX8A 2HJSA 1NFQA 3EXAA 1I2DA 4N5MA 2R6HA 1PCXA 2R6R1 2C82A 3EHDA 4URUR 5FUBA 4ZHQA 4LJAA 5A4DA 3V8VA 2LCFA 1BC5A 4O8ZA 4TSRA 4WFJA 4HH0A 2C5FA 3W3AD 4FBLA 5EFZA 2VYVD 3V1LA 2HOQA 3R8XA 3IUBA 4R2MA 4P5DA 5IBPA 3U0BA 4D4LA 3KHKA 1U7ZA 1P7PA 2J4DA 1RC0A 5IM5A 3KSRA 3CIFA 4GEGA 4UCWA 4CHTA 1ZJWA 4B6QA 1KDYA 1XZEA 1XV5A 3MWYW 1BOOA 4PG5A 5J58A 1W2GA 1ZSNA 1N6NA 3OIYA 1AB6A 3MWEA 2POCA 1SG9A 5DYTA 4G5FA 5LU8A 4BKUA 1I4WA 4G6ZA 4HGPA 4BO0A 3SJUA 3CLVA 1P8JA 4DRXA 4KNVA 3PD1A 3K1ZA 2I33A 3R8FA 4KIWA 1DVRA 2ERCA 4D9IA 4X20A 2QEQA 4C5BA 1B93A 3ZUPA 4GLOA 4KMOA 4Q66C 4JSTA 2P3SA 1OLXA 4Y7CA 5BW8A 5JCOC 3T7RA 3C3JA 2WU3A 1JEQB 1IEVA 5F1KA 5IWCA 2XQVA 4Q03A 2ZBGA 3ZQUA 4J0FA 1BRTA 1M1YE 1FNMA 1Q7TA 1H2WA 2NAPA 3ZCVA 4RUKA 1U1IA 3KZVA 2FW8A 3R4VA 4JLOA 4JIMA 1F48A 3M83A 4PFQA 4Z86A 4KP7A 5F9MA 4CI0B 4LZWA 4MLZA 4RAQA 4KR2A 1FRNA 1M2OA 2OWDA 3B13B 2BW0A 5JVDA 5KYUB 4CXMA 2C57A 1NVAA 1V9LA 1QRSA 4DLRA 2GHIA 3JQ8A 4E46A 3N8NA 4G8CA 2B21A 3CZQA 5BNFA 2NO1A 1VG9B 3UKJA 1QP4A 3QKRA 1HXHA 2X8JB 4DLVA 3ZEIA 1KI4A 4ZOCA 3WZ2A 1MOQA 1VPLA 4BB0A 1H8EA 4QGHA 4E4YA 2FX5A 4ZCPA 4YP1A 4W6ZA 4EX6A 5DMXA 3AEZA 5LKRA 1YS9A 2XRMA 5MHTA 2FWNA 2PWAA 3HU2A 3HPQA 2O1SA 4LYGA 1P75A 4PG6A 3H11B 4YT8A 2G1JA 5DK4A 2PNJA 2R6JA 5K01A 4FCCA 2FJUA 3BREA 5DDIP 3T4XA 4Y9TA 1NQOA 4RK7A 1KOJA 1YGPA 4BJ1A 2VTBB 3HKEB 1QVVA 1QR2A 3V4SA 3I09A 2RJOA 5IT0A 5AM3A 2JA2A 3AHDA 3EODA 2WJIA 2CF5A 3IUSA 4LY3A 1Q0RA 4J75A 3NRBA 1BE0A 1A9RA 1B43A 1D1QA 1P9NA 2HPAA 3A8TA 3QVVA 5AVTA 3U44B 3K31A 2A0YA 3VM6A 5AI5A 4MOWA 3DOUA 4IIXA 3R5TA 1E6UA 1QHYA 2PMCA 1E4YA 3KJNA 1UKBA 2FPMA 1QIDA 5EHIA 1RKUA 1X15A 4LQLA 4ZAZA 1E2IA 3OQ6A 3O3CA 2G8LA 5EJAA 1TM7E 1CUEA 3Q6NA 3K70C 3QY0A 2Z5VA 4KB5A 5LOVA 1NN3A 4GLJA 2O5CA 5CA0B 1JR2A 2FEWB 5DYIA 2OC9A 2C61A 1CDZA 2D0PB 1V8FA 5DTEA 3DMTC 2PCJA 1I8TA 1TKBA 2VJOA 4HQ6A 2YOHA 2XXAB 2EFGA 3GMSA 2Y6VA 2Q4RA 1FX1A 4PNEA 2GRJA 3LCJA 4UHKA 3ADOA 3ZDYB 3QWHA 4BP1A 1OA0A 3V32A 3OEHA 1K3TA 1RYBA 3I9OA 3PNOA 5KDDA 4J43A 4B3MB 3GC6A 1PNTA 4FDAA 4G0NA 2Z1NA 1LCIA 3A2NA 3WLPA 5F3RA 4D8VA 1K7XB 2J08A 3NG1A 5FTKA 2F9MA 3E58A 3NYRA 2V7GA 3AR4A 1H9AA 4LXUA 2YR0A 4KXFB 3FD8A 3OZVA 3WYGA 5BXYA 1C3EA 4UW9A 5H7XA 4LPSA 1VC2A 5KC9A 4AZ3A 5IK2D 3B8HA 4CIBA 5IN5A 4O1HA 1O0BA 4JX9A 3B9RA 1ZHHA 4QO8A 4CNBA 3GN1A 1D6MA 1CS4C 4A6PA 3ZG6A 4P98A 1X92A 2DUWA 3K6KA 3B3GA 4YJGB 1SRRA 1THMA 2ZE5A 3D6NB 3SZLA 3AOEA 1D2NA 1RZRD 3FHTA 2BCEA 2Q27A 3RU7A 2IEGA 2AG1A 3R9KA 4H31A 3M4XA 3OT5A 3E9NA 1IIBA 1A9ZA 1MW9X 2GN6A 2O50A 2W0MA 3DKRA 4W9NA 4F8JA 1GZHB 1J25A 3C3KA 1EZ4A 3FNFA 3GLVA 1YMVA 4RWZA 1I5RA 3EOAI 5P8WA 4B47A 4EHDA 5BUSA 2OKGA 3COPA 3KZNA 3HYSA 1OGJA 3WOVA 4N65A 2A7XA 2VQFB 1BVRA 3MFQA 4QJ3A 5J9FA 5I7VA 2QPAA 4H4DA 4MITA 2I99A 5LP6B 2ZI5A 2QAGA 4MQFA 4WQMA 3F3YA 4LV5B 2ZJ6A 1XGKA 3PYLA 4GI3A 4PN7A 4JMPA 4ZO6A 4LHYA 3O03A 1GYQA 1GPAA 1OXMA 2R8OA 3K1AA 3VUFA 3KTAA 1K8YB 4MVJD 3P2JA 1KIAA 3OQVA 4DAOA 3WIUA 4DEYA 4UDNA 1E3IA 1U8TA 1C3LA 2IE0A 4GI5A 5IYZB 5KWVA 2IHBA 4ZGBA 2D74A 4NV0A 1JWBB 3PPIA 3IHKA 2WD9A 3BXEA 4N03A 3RH0A 4P4GA 4V3BA 2DECA 4XIGS 1S8AA 4E4TA 5EKUA 3JQCA 5FPYA 3OX2A 3A25A 4I1OA 3CJQA 4DIOA 4Q93A 3CA8A 2BMJA 2TS1A 3FWZA 1NJ6A 4K6MA 3OLYA 2P2GA 4BO9A 1Q0LA 2EFYA 3PQ4A 4XKJA 1KS2A 1UC4B 3DOHA 4DSUA 4KBGA 3R0IA 1G5RA 2GARA 1HUQA 3U9TA 3T1YB 2R2GA 4DQXA 4LC9A 3R7AA 2HA0A 2IFTA 4DR5B 3NEYA 4PYJA 3SHOA 4CMCA 3ABSB 4D9JA 5C3UA 1UDWA 3FWKA 1RAGA 1P7WA 2I4OA 4AN4A 3EPKA 5AH0A 2AXPA 5K0GA 5FT9A 1VMAA 1LRJA 1MB0A 5ALDA 5FORA 1I6MA 2C3UA 3OCJA 1VHWA 3R0QA 1MRNA 1PEDA 4BKMA 2ZAOA 3G0CA 3GFGA 3P9KA 4EG1A 4ENQA 1DQSA 2GH1A 3V4LA 2Q3DA 5TS3A 3WK8A 3KLMX 5TDHA 4KR9A 3GUYA 5DHUA 3RTAA 1GCUA 4PVDA 1Y9JA 3GWGA 2WM2A 4W9MC 3MLAA 2QJRA 3FLBA 1K9VF 1MAWA 1CUJA 1JAZA 4V2IA 3SXUB 3T5CA 3ZCTA 4UPDA 3JZDA 5FOVA 3N2LA 3SOZA 1EUDA 3FYUC 4QRIA 4IDBA 5D51S 3SS7X 1FU7A 1X1CA 2DYKA 1G2QA 1GQSA 1P74A 3C7TA 3LWNA 4GF5A 4LHWA 5DYYA 4EJSC 3UK1A 2FW6A 2HBZA 3LUBA 5JAIA 2BI7A 2Z57A 1B0UA 1MVLA 4G0PA 2E21A 2GVNA 4Q3DA 4LJ5A 5BVGA 4HFNA 4XD7D 4IEIA 3RYHB 4L6AA 3ADBA 5SZIA 5D3ZA 1JJAA 4OATA 1CXZA 2GTHA 2H48A 1K6IA 5FEUA 1Z63A 3TLBA 1ZM7A 3T3PB 4AO8A 4FONA 1G3MA 3HFJA 3NCHA 5FOUA 2GEFA 2ZYRA 3MCVA 1NPDA 4WINA 1RJ9A 1PSDA 3O4VA 2OFWA 3P9CA 4OD0A 3LHDA 3N6XA 3R41A 4PSAA 4TXJA 4GVPA 1XMSA 3W3ZB 3CUWA 2Q3JA 4GPAA 3OCXA 2ANCA 3HGQA 4J8PA 4E11A 5B1EA 5K0SA 1JEYB 2D1QA 2PZKA 1BD3A 3GK3A 3HO8A 5H9WA 4FVTA 5D8DA 3E3NA 5FWXB 2OD7A 1U28C 1JLHA 1HL3A 1ZN2A 2EJTA 2YMLA 3NBYC 4RFSB 4X3PA 4ZEWA 4DYHA 2H1OA 3FYCA 3W1VA 4GI1A 1A8HA 1DFHA 5T8KC 2E6UX 4KOAA 4EEXA 3FPLA 2HMWA 2YQ4A 3QA3E 4G37A 3W5HA 4IZOA 2MSEB 1V8DA 2J3EA 4XSHA 3WTCA 2O8FB 2J41A 5HWSA 1ZCJA 2PU5A 4M0MA 2XWSA 3GLGA 3J7AC 3RVLA 4JUDX 2IBMA 4NE2A 3SNHA 1XJ0A 3ONDA 4FFBA 1SZPA 2CXPA 2AFRA 2N1BA 3AVVA 3OPVA 1LFAA 2WU8A 4LJ6A 5KTKA 1LEHA 2HRCA 3FIUA 3WDLA 2QSUA 5AKGA 4YRNA 1D9XA 5FKJA 5BVHB 2AOWA 3IQXA 1RPZA 4DOMA 1J06A 4YP6A 2ZR9A 1FUKA 2YW9A 3H1BA 2J9FA 1CUGA 1DAMA 1HURA 1LWNA 4OBWA 4XVRA 2Y05A 4BIIA 3EIOA 5IDWA 4I9NA 3KQNA 2DFPA 4Z4EA 2BELA 1E92A 4BAZA 3WV4A 1N3BA 3ICPA 3M3HA 5FNZA 4BQIA 4EUFA 5ELXA 1O94C 3DEHA 1KQNA 5KS2A 2ESRA 2MHCA 3LVQE 4LCEA 1F8YA 2H8GA 5BQFA 1YR8A 1ZM3A 5AOBA 2X4DA 4C1BA 3SE0A 1N6OA 4PGAA 4F4DA 1T0IA 3GDFA 2XW6A 4YRMA 4W7IA 1PKXA 3EDMA 2A6PA 4IJ5A 3KOUA 3VQTA 4X93A 3K6SA 2ECFA 3GZNB 3W6NA 3HSSA 4IOLA 4ZI7B 3PEWA 1DMRA 5H3HA 4CMKA 1RIIA 2B9VA 3CFYA 4O33A 5C8YA 2FUG6 3U1TA 1QSGA 4RCVA 4XH9B 4FYPA 5P21A 4TGLA 5ENZA 2IHNA 4ZT6A 3ND9A 5GMOA 5DYNA 4D3DA 4DLXA 1OX4A 5TARA 4O6VA 3VMMA 3T4PA 1HNXB 5AKHA 2O0KA 4I19A 3I9MA 2F3TA 1Q1AA 1ZY2A 1QGYA 2XB4A 2OY0A 1EUCA 3BHIA 2X1MA 2QJFA 4A3SA 4AKTA 4TYYA 2A5FA 3OTIA 1ZO8A 4QOGA 4D8UA 1K8QA 3WP0A 4E5MA 2IXBA 1ACMA 5JHHB 5K8UA 3K92A 5CX1A 3FCOA 3CH7A 2B5WA 4RBNA 2C58A 3DTNA 3M89A 4ZD6A 3NHUA 3UUFA 4BKQA 5B12A 3J80A 2HF9A 1SXHA 3HB1A 2VHEA 3LPLA 3UY4A 1FFXA 3D7LA 3PF9A 4GFDA 2LNDA 3BFPA 1P1CA 5CDGA 3CPHA 4NXNB 4A8JC 4CIAA 2HJWA 1PS9A 3QEMB 4JELA 5KOHA 2XGMA 3KKKA 5TPWB 4HAZA 1ZD3A 1IVSA 5CVVA 2A5GA 2VEOA 2ZAGA 4N5NA 1T5OA 1QK4A 4O8CA 3RROA 2C3PA 3L82B 3CVOA 4IDPA 1AZTA 1TC1A 3KL4A 5DT2A 3ROMA 2WJYA 2XUFA 3L7DA 1Q0TA 3VYTB 2R47A 4I55A 3TH5A 1Z8HA 2VH2A 3CX6A 3O75A 1W5SA 1S3IA 2JRCA 1U9YA 4Q15A 4ZTBA 1CFZA 1OI7A 3OFNA 3AVYA 1GNQA 2IYTA 5GVRA 4BFVA 3THYB 1OZFA 1FUUA 3V4OA 1VIYA 4DPMA 4YPFA 5JRZA 4J6EA 1E2UA 2CFIA 4R9VA 4A91A 3A9TA 3FYDA 1NQ5A 3FCSB 3KQSA 1I3KA 3EPPA 1EX7A 1W44A 3HP7A 3KTOA 4CMEC 5IKMA 2PBRA 3MSXA 4OOEA 3PXBA 4BLPA 1J49A 4DIKA 2Z6AA 3CLTD 4ZEXA 4R69A 4UPEA 4YUZA 2VJAA 5MN6A 3LUCA 4C22A 1MHPA 2DR0A 3KU4A 4HNAA 3AGQA 3KNZA 2GBPA 4MP8A 1V1MA 3IVXA 3RO7A 3EWNA 1RLTA 4IF6A 4D98A 3CJTA 3MWKA 4MW7A 1FQWA 3RKUA 1U7UA 4YX9A 3AUUA 4CQMB 1EJ2A 5BRNA 2QN9A 4EGAA 4JI7B 3FOCA 4QUGA 4AYWA 1SVOA 1QO0A 1C1HA 5C80A 1QYIA 2A2ZA 4FFDA 4YMTA 3LCCA 4L5IA 1XDSA 2V6FA 3CHYA 2K7ZA 4R1SA 4DT1B 4ER6A 1E2JA 1F20A 2F90A 2XNJA 1YJ5A 1Q0QA 4I99A 4OJKA 4N3BA 4PINA 3PLRA 3W5JA 4J3FA 2P41A 1OBOA 4YJDA 4GDMA 4BFCA 3MHTA 2HU8A 3DDOA 3KYIB 3A9SA 2A59A 3H9JA 4C3ZA 3OOSA 4D74A 4KRYA 2I6GA 3GB9A 2HJGA 1GZVA 3TOXA 2WNSA 2QZJA 1Z75A 3KBBA 4N3NA 1RYHA 1Z45A 1O7JA 5DHPA 2RHGB 4IIEA 1MG5A 4ZVSA 4IY1A 3ABRB 2G9UA 4DCTA 2ZYUX 2XVZA 1CF9A 1TFRA 3F8TA 3T9EA 4R16A 3L18A 3M5CA 4IWXA 2FPSA 4LDJA 1NU8A 1Z15A 3JZFA 2GPJA 4MS1B 4QODA 1X9HA 1O9GA 2PGDA 3LBYA 3RVRA 1KZ4A 3SIPA 2IOYA 3E03A 2MSCB 2WYIA 2YH2A 3TUJC 2J0EA 1YJBA 3F97A 2CVQA 1BYUA 1YC2A 2HJHA 1TT5B 3GD5A 1V1RA 1GGVA 3T1QA 1QFJA 4G1VA 3LSTA 3TUZC 2Z5FA 1M8FA 3E84A 4P32A 2GPWA 3IJEB 4AJ9A 4UOZA 3B2QA 2DZDA 1AUPA 3IV6A 1X7XB 4WV3A 1VXOA 3PPXA 3SHFA 5KNDA 1YA4A 1X7YB 2XRZA 2P5TB 3P1JA 3IDFA 4KSYA 1WJGA 4MJXA 1KTVA 4DCOA 1L4BA 1QBGA 4Q37A 5FOWA 1SUCA 2QUZA 4FXPA 4D8WA 2CDRA 3TQTA 3MMZA 4CFZA 2XQJA 3IAM6 2J7PD 2EL9A 4E0BA 2IKQA 1RQ2A 3JQAA 4UMVA 3D2LA 4G89A 4DQ0A 3VOAA 1WDWB 2JGRA 2I9KA 3QLJA 1ACJA 5KWSA 2EP5A 1FTQA 5E7IA 1Z16A 1W36C 3AIOA 3LWBA 1KEPA 5FBRB 1N1MA 3GUHA 4JT4A 4ARZA 1O1YA 4HTAA 1Z8NA 2GN1A 2O1WA 4HQKA 4LNUB 2J5KA 4MMXB 4JH0A 4YMLA 2PGNA 1QMPA 3KKNA 4FKZA 4LKRA 3HO1A 2J4CA 2FOIA 3U7HB 2A0UA 4LA4A 1ZESA 1SJ9A 1DX9A 2RFLA 1RMQA 1J2EA 5REQB 3C3MA 4LJ8A 5IJXA 5BSTA 3U40A 1T34A 2CL6X 2DKNA 1OIXA 1FDSA 4JEUA 5DHTA 5JUWA 3BWBA 4IZHA 5EKTA 4L16A 3O8CA 1ZKMA 3VC3A 3PTLA 4TLAA 4Y1RA 1NVVR 1QKKA 1R16A 1JLKA 4BKRA 1DV2A 1MQSA 4IFBA 3IXLA 2G70A 3OQJA 4JJGA 4FWBA 2XNCA 3HABA 4RY9A 3K0HA 1QTRA 2EQ5A 2XQKA 2GF2A 2XMPA 3OJLA 2DLDA 1U4NA 1V3TA 5IG2A 1L1EA 2FE1A 3F67A 2RAFA 5KZMB 2QTBA 4WNIA 1PRYA 2H07A 5AVJA 2GBGA 3H7IA 3EFOB 2DQ4A 3TRJA 2ZIXA 4IDHA 2UU9B 4U6QA 1T9ZA 3FTPA 5A4KA 3OM8A 3GEDA 4FSXA 4JC4A 3LNCA 3D43A 2VG8A 2ROQA 3ETGA 4XQGA 2A9RA 5EKSA 3PEEA 2RI0A 5KYGA 4U2KA 3GFRA 4C76A 5A5GA 3I83A 5CH5A 1ZAYA 2BGGA 4M9SA 1AHNA 1E94E 1B73A 1C4XA 1EGMB 1NXVA 1KMQA 2ZTLA 4P38A 3TX2A 5FH9A 3COJA 1F4LA 4L9RA 1C9KA 1L3IA 2Y2UA 3CXRA 1YS7A 3CX3A 2YJ3A 1KR5A 3OTQA 2WTUA 2BFCB 3K32A 3UH0A 2GLTA 4ZP1A 3FETA 3BULA 3PENA 1ANKA 5E6UA 1BVHA 4L8WB 1E2HA 1WDKA 3AIIA 4JP2A 3B6IA 2QRNA 3NTUA 4KMMA 4M37A 5DTIA 3PF8A 5ALSA 2ZW9A 4A92A 2XWPA 1Q1ZA 1KAEA 3EUEA 1P6XA 4GVLA 4CQLB 1VHLA 5KJ6A 3ND8A 4PY2A 4DLKA 1MUUA 3DPSA 2ZEJA 4JYPA 3VO9A 4EHLA 4YPOA 2FF7A 1SWVA 3ZZ0A 5EJ7A 4QX6A 3E2MA 1PTKA 3IP1A 5DCLA 5ISMA 2C94A 3M4NA 2FSPA 3FG9A 3I53A 1YH3A 3I4LA 1IONA 1XLTC 3GH1A 3DMGA 1LBSA 1A9OA 1WXFA 3DHYA 4L2IA 4NF2A 1Y9ZA 1QH8B 4C7JA 4X97A 5DMHA 3WP1B 1K6JA 1MJ5A 4I4CA 4B3TB 2VRCD 5HVNA 5H8WA 4FNMA 2YHAA 2J59A 4G4SO 3U2QA 3T3HA 4CNQA 5J47A 4EMUA 4TWRA 1LNSA 1S89A 2B9EA 4Q4HB 1GPYA 1KYZA 3MTGA 1N9GA 2VAWA 3B6KA 1E0AA 3E2IA 2ZIEA 2C4MA 2IELA 5I7AA 2IWRA 1LDMA 1KY2A 2GUWA 4MV3A 4R8SA 3WBKA 5C2JB 1KSFX 4DMFA 1RAEA 1QC5B 2V6BA 2ZRIA 3IHLA 1JHDA 4PFKA 4EAQA 3RCBA 3KQVA 4W5HA 2CUNA 3TE7A 3DT9A 1X1TA 3EC1A 1U0LA 4NPCA 3TMYA 3L06A 5CFLA 5KWEA 3G2MA 2B8TA 2J6CA 2OBLA 3MZ0A 4DLYA 5GZ3A 5F5NA 3CVWA 1IUKA 1NBAA 2BEVA 1PD0A 5FL7A 3RYFB 1JJFA 3TIGA 1MA3A 3W5UA 2R6CA 2J3MA 4TVOA 5JSHA 5EYPA 3TG2A 5K45A 1R4NB 2W6ZA 3CO0S 3EBOA 4WN9B 2XSZD 1R88A 1G5HA 2ASVA 2RI6A 3FMVA 3M6MD 1ZI9A 3O1JC 2PZMA 1FS5A 3L46A 1U0OC 2QYTA 3A4YA 3DO5A 4QDKA 4WUTA 2AV6A 2MSWA 2O3JA 4RABA 1GFZA 3S8MA 1P61B 5K8LA 4GQBA 3LKDA 1R6UA 2ID9A 2P68A 2OT3B 1IL0A 3PUWA 5A9SA 1W59A 2BLLA 3QMWA 4FNOA 4XLLA 4QT4A 2X7JA 4KPUA 3PNVA 4DMHA 1LI7A 2OFFA 1I7SB 3HB4X 1RM3A 4GSLA 2VT3A 3IE2A 3TTTA 1VZ2A 4F92B 2DP4E 1QIKA 4K1LA 2XB6A 5DM1A 4RA9B 4DB2A 5BNWA 2WHRA 4GZMA 2OK8A 3CZPA 2LCQA 1X1QA 4D9EA 1N1GA 2CNBA 2VYND 3QVUA 5TLSA 2W37A 4ZVMA 4EH1A 1OYWA 3QVTA 3HBLA 2FQYA 4H1TA 3MYYA 2RKOA 4LECA 2ATVA 3OWHA 1P80A 1T5LA 2AXQA 4S1PA 4HO1X 4TV8F 3UGQA 4DCVA 2C0PA 3AR9A 4XWTA 2Y0CA 2FI1A 3G5LA 5ALTA 1V45E 1Z0DA 2HFJA 4KXYA 5J4YA 3JR3A 1AK9A 3L1JA 5DK6A 2R96A 1E63A 2FFJA 4EBBA 2BKXA 1ZISA 4DARA 4CKZA 5NLLA 1O8CA 3IQFA 4YH1A 5KQLA 2O2ZA 3PCRB 4YIKA 1HEUA 3KKEA 3OECA 5A3RA 1H0KA 2GTIA 2Q3CA 2GI4A 1AKYA 1Q21A 3AXTA 4PYRA 3E9YA 3DVRX 4CTJA 8ADHA 5CEFA 3BIFA 4FJ1A 3TZQA 4CR6A 5JFOA 3Q1KA 3IEMA 1MAAA 721PA 4DV3B 4ID9A 3IT1A 4KQGA 2ADMA 3GRFA 1BN6A 1P5JA 1WE2A 5JW6A 4EFLA 1M5UA 2X5JO 2QT0A 4KRXA 3UHOA 3T3MB 1MRSA 3T99A 4BYMA 2GEKA 1Z8FA 1CQZA 1JA0A 3K0EA 4TS9A 3RYTC 3GROA 1XQWA 2DKOA 2IHVA 4K6CA 2YFQA 3KU1A 1IN1A 2W4MA 2W2LD 3PGKA 2G36A 3D1LA 4QUKA 5B6IA 1PBNA 1SCDA 3CKLA 3LDAA 3AVUA 1ZW1A 2O8CB 3MT8A 2IODA 5ALMA 1RAIA 4BNLA 3OLVA 1IG0A 1RVV1 2BGLA 4WFIA 1HLDA 3CUYA 5HKKA 1CFJA 1G8YA 2H2AA 2HF8A 5DLPA 1RJDA 3TQSA 4BCDA 1IJBA 1WZNA 1OVGA 4N41A 2W00A 5JS2A 2J0SA 4Y18A 1NZJA 1WHTA 2XCTB 4PTZA 2QG9A 1ETHA 5EWJA 2R5WA 2CSXA 3N87A 4BEJA 2QP3A 1JQJC 1DQPA 1OAOC 2JGLA 4OREX 2IDZA 3WBJA 3PXAA 5K3FA 4GX5A 5AVYA 1LJUA 2NADA 1W2HA 3AI1A 3BRWA 3H9CA 4BNDB 1E8DA 3R7BA 5C34B 2VSNA 3GFOA 1JH9A 1HSZA 3KB8A 1NLYA 4JJKA 2HCTA 1M1ZA 4BMZA 1ZNWA 1KPIA 5LBUA 2CCJA 2A86A 1N2XA 2FUCA 5CLFA 1CQJB 1M67A 2JGIA 5K8VA 1R0YA 3BIJA 4AO6A 1QHGA 2QBYB 3GNSA 3QI2A 4US0R 4ME6A 3Q7TA 2Q8QA 4M53A 4B32A 4C3OB 1FBTA 3U49A 4FGWA 2J6IA 2AKAB 3WLOA 1IH8A 1TDJA 1U7HA 1X7WA 5IARA 5IMSA 4TS1A 1PS8A 1SVNA 1TW3A 1DBIA 3EAFA 2JBAB 1CUUA 3T7EA 5BSVA 3P4XA 4F85A 2FFAA 2O8CA 3ZNOA 1CY8A 1SWWA 5JXWA 4JBWA 2OYRA 3MB5A 1KVTA 2QQEA 3KTDA 4N3GA 2QN6A 2QN2A 1CE8B 4B6GA 2JS7A 5AUPB 4MR9A 1PR5A 2BTQA 2A5DA 3DOCA 4HFRA 3DS8A 1VCIA 2R7NA 1YCGA 2HA4A 4B3DA 3EC2A 3TLMA 3VR6H 1E0DA 4BV2A 1YS2X 2R00C 3SJBA 3OF3A 4WESA 3FR8A 4J94A 4GBED 4PEVA 5CA1F 1NW7A 3NGLA 1U65A 3MPOA 1MVOA 2AI3A 4R4JA 4R84A 2DWOA 1XRMA 5GOTA 3B36A 4R5HA 4B33A 1JWAB 2FKNA 1I30A 4DIEA 1CP2A 5CFRA 1SKMA 4FYJA 3SWWA 2OK7A 4MHTA 2JIQA 2B34A 2Y66A 3IDZA 1C3OB 3IEPA 2JJ1A 3F47A 4F9TA 4NYMQ 2WVHA 3CEPB 1RQGA 1G6OA 1Z0IA 2W6MA 3NHMA 3W2HA 1T43A 2J48A 1OY1A 2JH3A 2I2XB 3AO0B 3LQ2A 1KQ3A 1AKNA 4REMA 4BX8A 4O02B 3HJBA 3IJRA 2H1IA 4TTAA 1L5HA 4ZHSA 4NV1A 5SZHB 1TD9A 3KVVA 3G7UA 4KR7A 2O8BA 2DHCA 3N0TA 4Q48A 4MVJF 3W90A 2VUTA 1MV8A 5JNWA 1VFNA 3ZBTA 3AY0A 4A10A 2HJVA 2BFNA 1W48A 2FUG1 4WI1A 2J9GA 3QWFA 5DCUA 1CY1A 4OHMA 2BGMA 1VL6A 3A1DA 3BX1A 1B42A 2WPDA 2Q4BA 2GO1A 3GW8A 4S2UA 4TL9A 4TUYB 4UDOA 3ZHUA 4LYAA 3ROGA 1KQFA 3GCDA 1T5SA 1JLSA 1TVMA 1I10A 3RC3A 4GU5A 4PC6A 1JU4A 3HMKA 4UBKA 1RI4A 3MTEA 3DVSX 2PR7A 5EIAA 1LQUA 5ITWA 2WT9A 4YRRA 5BT8A 2VP4A 2R66A 3DE7X 4LZNA 2Q5JA 2PV0A 2AQ8A 2D1YA 1TF7A 2VNKA 4XIJA 8AT1A 1YQXA 5FBZA 1B4DA 1OREA 4YRJA 1QX4A 1SM4A 2QZSA 3NDRA 2IY9A 4GGOA 1N25A 4LF8B 2Y1DA 1VJGA 1MB3A 1PJZA 2PR2A 3HZRA 4P92A 3KQLA 4BO3A 1KY5A 1WMBA 3F7NA 4AJLA 3BGSA 1ZUNB 5HRUA 1ONPA 4PYMA 1T8TA 4Y2SA 2VCEA 1WMDA 5ERGB 1RAHA 3T15A 4F7DA 1GZ4A 3KKMA 2AI1A 2PRKA 5KX5F 2BSQA 3HKCA 1PR3A 5BY2A 3ONEA 5HQ3A 3KSBC 3LC7O 1LSSA 4HDQB 4FYWA 1UKCA 3LH5A 4MV1A 1BS9A 2C8LA 4D96A 1ISPA 3E9CA 1KK0A 3O8RA 1KWGA 4XGKA 2DETA 4Q4LA 2F17A 2QVXX 1DIGA 1H6DA 1ELOA 3L7CA 5JBNA 3QFSA 2WNIA 4AKHA 2ACVA 2VPWA 2GXQA 1PUIA 1SPBS 1PFKA 1TLFA 4HN9A 1DBSA 4US1R 4WKPA 4HFJA 3DE4X 3ZWWA 4ZYYA 4RTOA 1OSNA 4MLCA 2RCYA 1BSVA 1JPVA 1O5TA 2JAHA 3SBEA 3SC3A 3UMBA 3WSTA 1EP3B 2AZMA 3WBFA 1XU9A 4IILA 5KSZA 1UT6A 1FCJA 2R6GA 3V3TA 2WYOA 4WY2A 1L1FA 2BFDA 5FPTA 4CEHB 2EBHX 4CCYA 4RDXA 2P35A 3WNCA 3VR3D 3VOBA 1H5QA 3AHCA 3FPFA 2ZKLA 4Z53A 1FTGA 1USWA 2YHIB 5B55A 5KYXB 4BP8A 1BD4A 1V7QA 2XXJA 3TTSA 3FM9A 1NOIA 2IXAA 1G20E 3KRTA 4E14A 1G4AE 3EZLA 4BNMA 1KP3A 4BEBA 3KLNA 2CBZA 2DAPA 3PUZA 3AU8A 2BR3A 2NO6A 2H4ZA 2WMOB 4MQBA 4IR7A 5FUMA 3E35A 5T67A 5EA2A 3HY4A 5BWNA 5KNBD 1EK6A 1JIKA 2O1XA 3OBBA 4IVNA 4GP9A 4JWKA 3N3AC 3I0ZA 2ZZMA 3WGYA 2IH5A 1EG2A 1NW5A 3KXLA 3WGJA 3FHOA 3MCTA 4PQGA 5SY4A 3FMIA 3L6RA 3Q1LA 4CL0A 4DWJA 1KK3A 1EGVB 3A9WA 3WQHA 3ICEA 4CF7A 2WTEA 3C5VA 3RC8A 1ECJA 3LVBA 3TGLA 2J6BA 4RZSA 4DNXA 3NETA 4E12A 1DJPA 1HLFA 1W0KD 1ZM2A 1ISGA 1LKZA 4UU0A 5D1HA 4C0WA 5I9SA 2VDVE 3CMMA 4ONEA 4F45A 2V9PA 1AQYA 4QPCA 2JIMA 1ECFA 1OZGA 3UH1A 1NMYA 1LI5A 1LB1B 1NP3A 1DV1A 2Q5FA 1Q6YA 1K3FA 4R54A 3H1GA 4ENWA 4X62B 3R4CA 1N3LA 2QVBA 4ML3A 4MPTA 5EJ6A 2XTJA 3O47A 4LXHA 1SB9A 2YWCA 4BV8A 3DNMA 2E4UA 1Z18A 3JASA 3NBUA 4PSUA 2BHRA 2G76A 4GXNA 1T6ZA 3DXZA 4PNZA 3AEQB 4HZGA 4QGSA 5I6DA 5JFGA <