1INEH

How the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
213
structure length
213
Chain Sequence
EVTLVESGGDSVKPGGSLKLSCAASGFTLSGETMSWVRQTPEKRLEWVATTLSGGGFTFYSASVKGRFTISRDNAQNNLYLQLNSLRSEDTALYFCASHRFVHWGHGTLVTVSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLESDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG1-LAMBDA CHA255 FAB (LIGHT CHAIN)
publication title How the anti-(metal chelate) antibody CHA255 is specific for the metal ion of its antigen: X-ray structures for two Fab'/hapten complexes with different metals in the chelate.
pubmed doi rcsb
total genus 42
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 1993-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ineH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ineH01
5TDNB 3X11B 5DUBB 5DFVC 3RGVD 5B3JF 1G7QA 3ECBB 1YA5A 2HP4A 2DDQL 4ZSOE 4RWHA 5FF6B 2AK4E 3I75A 1ZXQA 3MUJA 3MLWL 3HZKA 3DUSB 1F4XL 1QSZA 3LS5L 4ODTL 4U0QB 2V5YA 2Y06L 4ELMF 4GKNA 5HYJD 1KIPA 4MB5A 4UIMB 5A16B 4PJHF 1HXMB 2CK2A 2EDOA 2MHAB 5E4IA 3CVIH 3QEUA 4QRPB 4X98A 1GHFL 1OSPH 1X5ZA 4MJ2A 5GISL 1UH4A 1FZMB 1DEDA 2JCCB 5DJ6B 1KACB 3AAZA 4A6YH 4F58L 5ID1B 2AJYH 3MR9B 1ZVYA 3LKOA 3F5WA 1A8JH 5D71H 3MCKB 4OGXH 5KS9A 5IF0A 4D0CB 2ZKHH 3F7QA 2VR5A 1ZHKA 2VQUA 4TTGA 4GSDL 5JUEL 3T3ME 3OG4B 4YDIL 2BHYA 1QYGL 4Y0GA 3U2SB 3CC5B 5EOCH 3K81A 2XYCA 1MHHA 1ZTXH 3O2VH 5I1KH 5ACZB 4NN6B 5GGUB 3DBXA 1T7VA 5I1CH 3BJLA 2JE8A 3T2OA 1N2RB 4R0LA 1VCAA 4HWZB 3MLZL 4KTDH 1ZT4B 4EEEA 5A40E 2FX9H 2BNRA 4MB4A 4OFIA 1FAIL 2DM2A 4I18B 1FVEA 4YWGH 2PO6C 3DSFH 3MV7A 3AGVA 4HUUA 4LOUC 3IF1B 4WCYL 5AEAA 3WD5H 1UXWA 3VE0B 1WZLA 4G8FA 2DM7A 1F3RB 3DUHA 3GK8H 3RIAF 1U8JB 5DJ8A 2B5IC 3BT2L 5JDSA 3AB0B 1X4YA 1I7RA 1ETZB 4HKBB 4Y4FB 3GSUA 2XZZA 3LV3B 4AEHL 3LS4L 3WKMH 5LCVH 5ALCH 4GKZB 2BHZA 4OD2B 2XQYK 3B9DA 1EO8L 5IM7B 5TH2A 1TITA 1JJUA 1OHQA 1A7OL 4FP8L 3RUGB 4MJ5B 5HPMB 1ZS8A 4DUVA 2IG2L 3KHOA 3VRJB 5IKCB 4KK6C 2WANA 4OF6A 4O2CA 5T1KD 3CMOH 2CIIB 1CDIA 5J6GA 3KYNA 1L7TL 1U3HB 2UVEA 4L8DA 4JPIB 5DMJB 4D9RD 4F7TB 4OZGB 3B8SA 1D5MA 3ILQD 4NBZB 2R0KH 2DQHH 3HA0A 4ZFGH 4X4MA 4LCUB 4LRIA 3PWLA 1U92A 5E4EB 4OI7A 4MJ4A 1OB1A 2FHBA 3TWCH 2ICWJ 1P53A 4ZD3L 2GW5A 2OQJB 4XXDB 1K3ZA 2HRLA 2WWKT 4ZO7A 1S7XB 1WITA 2I26N 4PG2C 3ME0A 4IMLA 4RGND 3BKMH 4ZS7L 1AR2A 1XGYL 1FNFA 4JRXA 5HDBF 5EA0H 5I1IL 5DWUL 1W8NA 4X8XA 1TCRA 4QRRD 3PP4L 1J8HE 4ODUB 4U1GB 3A6OA 2BVPB 1WBXB 3ZTNL 4JZOA 5EUOB 1A9EB 1U95B 1G7PB 1N59A 4CADA 4WWKA 4WEMB 4PJFB 2PW1B 2AVGA 4L1HA 3NTCL 1FZJB 4TSCL 4X7CC 5JXAL 1ODAA 1YEEH 1T21B 1UG9A 3FT3B 4N8VA 4H8WL 3QFJE 1VERA 1NFDA 5IHZA 2VDKH 4GMSL 5J11C 4I0PB 3T2NH 4WW1B 4BZ2H 1SBSL 2ED7A 2DMKA 3CSBA 3O0RL 2WBJA 2DQFA 3O81A 3ELAT 5DMGC 3OJDA 5D7JC 1Q0YL 1MHEB 4YHNB 1NCBH 5CD3A 4JN1H 3HC0A 1DBJH 4Q9CA 3OZ9H 1VFBB 3RIAK 4NN5C 4YO0A 2CO7B 1C08B 5LBSH 4CRPA 2FIRT 3NIGE 1R5IA 4WUUE 4XI5C 2AV7A 1KT2A 4CDHA 1XT5A 3PL6D 5C0NC 5CZXC 3O2DL 5DD1L 4Y8DC 4KPHH 1KJ2A 4L8CA 1CE1H 5JZ7C 4OCXL 1TZGH 1OAUL 3O6KL 1KB9K 4XNQA 4JZNA 3EO9H 4OI9A 1L9MA 2EDYA 5IW6A 4MA8H 3OKLB 2NPLX 2Z8WC 3EYOB 4JHWH 3C60B 4BZ1L 2XPGA 1HKLH 5LQBH 3E6HA 4XP5L 4YEFA 3C2AH 3RWIB 3FQXA 3Q5TA 4X6FA 1KENH 3K8MA 5CEZE 3VI4E 1IM9B 4PGEA 3VXOB 1CLZH 2OJZH 3EDKA 3IDUA 4N1EA 1YMMA 3O3BB 5E1HB 1A1OB 3CCHB 4K8RL 3IU4L 5CEYA 1A1MB 2IQ9H 2PR4H 5JDJA 2YD3A 1RURL 3STZA 4U7KA 3BYYA 5IFJB 3L9RB 5J56B 3EYSL 5C09D 2H6PB 3O41A 1N26A 2P8LA 4MNGA 1QFWL 1FN4B 5ESAA 5GJSL 2XTLA 3O6MH 1TVHA 1T20B 3EO0A 3IETB 4JFZL 5KVEH 3TYGL 1YEDA 2R1YB 2RQ8A 3NFNB 4L8SC 1BM3H 5JIHA 1LE9A 1OD9A 4GRLD 2IBBA 1OVZA 3L3GB 2ESVD 4M6OL 1IGYB 1TENA 1VPOL 1MNUL 2FR4B 2DQUH 3CDCA 2BY1A 4OLVL 4YBHA 4FQQB 3WNPA 1EFXD 3FB8B 4QXTA 2OJEA 4G8IA 1N64L 1TTFA 3PGCA 2DQJL 4O00A 3MYZA 4P2QE 1MWAB 4HGMA 2D03L 2Y7QA 5ELIA 5CIPH 4QXUH 1AQKH 5LVEA 1H3PL 2XTJD 3TA3D 4PGZA 5E08H 4M7LT 1GGIH 3A0OA 1QFHA 3AMKA 4PPTA 4QLRA 1EHXA 5HVWA 2V5SA 3N9GL 3BVNA 4WHCA 4HIIA 4NM8L 5JOPE 3JSSA 5BS0B 5ERWB 1U8NA 3QIWB 4MD4B 5D7SH 5BZDA 1FYTB 3EDEA 1JYWA 2PYFB 1ZT1A 5FDYA 4O5LH 3RPIB 4PJ9C 4JKKA 5IEKB 4W4NA 4JY5H 3KXFD 3ZKND 2OP4L 1P4LA 4P3DA 4PY7A 5J12C 5HJ3A 3ULSB 1WWCA 1RQ5A 4GRWB 4I48B 1BF2A 2ZNWA 4KRLB 5ALBH 3SQOL 2QKIA 4PGDB 4D9QE 3OF6D 1E6OL 2AJ3A 2RAMA 2AJXL 4NQSB 2X4TB 3RVTD 4NRXB 1LQSR 4YGVB 2YZ8A 3T04D 5ADPL 5KSBE 3WNMA 3UJIL 5FYJL 3QQ9C 1BVKA 4Z7NE 5I1LB 4WGWB 1MI5D 2I27N 2V2TA 2F74A 5EZIL 1JV5A 3BGMA 4MSWB 4FQ1L 1I7ZA 4LF3A 5F8QC 1AHWB 3OAZK 2I07A 3J8F7 3MLYL 1X5GA 3MRGA 4HH9A 1OP5K 5KVMC 5LJYH 4OLUL 4OIIL 1AGCB 3CNKA 4Q6IA 1FV1A 1EUUA 1K85A 5GGQH 4FZEL 4MWFA 2AJVH 3PABB 1GYAA 3FT2A 35C8H 3IKCB 1S5IL 3QXDA 3BSZL 5D7IF 3ET9F 1J1PL 3RPKA 3DMMC 2YC1B 3FQWA 1QBLH 3WLWC 4WHYH 1G1CA 1PEZA 2B0SL 3GMPB 5FO9A 4XP6L 1X5LA 4KGLA 4OQTL 4YDVA 2F53A 4WTZG 1MJ7L 2IANA 3ARXA 3VD9A 5DQ9B 4HJJL 3BQUC 2VC2H 4E42B 2FL5A 43C9B 4OZFH 1D5IL 1RJZB 2HJLB 5BOZG 1YNTB 3GJFK 4LLYB 3CFEB 3RVWD 4G6JL 1G9MC 4K7PH 5F7EL 4P2RA 3GM0A 1N5AB 4ZOCA 4MA3A 3FB6B 5DUPH 1HDMA 3OHXA 1T2JA 4Y2DA 1S8DA 3IFPA 5C8JB 3HNSL 4KAQL 1A14L 1CBVL 5FUOH 1DN2A 4Z0BH 4BFEA 1ZHBB 2VLKA 2R56H 4JRYB 4WENB 1HSBA 4AY0A 1FNSL 5EO0B 1C5DB 5J13C 3UTTA 5FM5M 3RRQA 1FIGL 2GK0A 1BEYL 5BRZE 3E2HC 5DSCB 1HH6B 1V5JA 1V3JA 4G7VL 4AT6B 1TVDA 4HUXB 3UBXI 5KAQF 5HHNA 4QHLA 4UT9L 5KG9A 4PRPE 2XNAA 1CZ8H 1WAAA 3RTQB 5DK3A 4GRMA 3UC0H 3PWUA 4NUJB 4Q0XH 2R9HC 1JZ7A 1H5BC 3MRMB 4HWBH 4OLWL 2DMBA 4TTDC 5DD3L 1OAKL 1KB5L 2ZUYA 3B9EA 3AXLA 4DW2H 1G7IB 4X7SH 3UTPE 3FO0L 1GJIA 3LEXA 1DQLH 5FHBL 5GS1B 4HPOH 4M7LL 2FEEI 4LK4A 1NAMB 1AR1C 5J3HC 3HRPA 5KVGL 5C3LD 1T89A 3QDMD 2GAZB 3HG1B 1T1YA 4U05A 3ARFC 3QHFH 5T3XD 3LPWA 4L8BB 1P9MC 4XMKL 5CJBA 3ZL4H 1NH6A 3ZSSA 2AEPH 4HX1A 5IR1B 5C0BA 4LP5A 3BEVB 4Z7WE 1OF2A 5KOMC 4YJZL 1ZLSL 2E27L 3BXNB 1WUNT 1GGCH 4XCCH 3QCUL 5KVFL 5E8OB 1IGCH 5I19L 2FJFA 5T5FH 4C4KO 3D3VD 3SDAA 4FFZL 1T5WA 5FO7B 1MH5A 4D9LL 4LARL 2YMXL 2PXYD 1CGUA 4JFDE 1CFTB 3T0XA 1CD8A 2AGJH 5TQ2L 4LDLB 4X6DF 3RBGA 2VAJA 2ZOKB 5FYKE 5KS9F 5HHME 1I1AC 3M07A 5EBMA 4TNWF 1GGBH 1RVFL 3AREC 2SEBA 4PJGB 3LKQB 3NCEB 4IDJH 2W65A 1EEYB 4U1NB 3BZDA 1JGVH 3T3PE 4K3GA 2I60L 1IKNA 1DEEB 4O51B 1MRFH 1FL5A 4CKVX 2VDOL 3NN8A 1ZHLB 4N5ED 3NZ8A 5JR1H 3QQ4A 4HBCH 4Y19E 1KPUB 5TDPA 2P4AB 4UNTA 4ZMAT 2IPTL 3C08H 1HH9B 4YAQA 1W0VA 3VMNA 4LSTH 15C8L 2Q86B 3RZCB 4RQQB 5HYQB 1HOCA 3BOVA 1VGKA 2NY5H 4MJID 4Z7OF 1J1OH 2PYED 2ZJSL 3F12A 2AEQH 4ZAKD 3WEXB 3D39D 1A2YA 2DBLH 1MCWM 2YPVL 4MLSA 5K59E 1MFAL 1FORH 4EDXA 3D9AH 3T0ED 4XCYA 1C16A 2OI9B 2ZOLB 2HT4D 1MJ8L 1KJ3H 5TPWH 4X7TA 1NCTA 3QDGA 3H9YA 5C09B 2Y23A 2CDEB 3T65B 3QNZA 3SDCC 1F58L 4UOW1 1Q1JH 4L4VD 4IEFB 3QFDA 3V7AG 2X4SA 5GSVB 5JHDE 4L3CA 3SPVB 2I25N 3VDCA 5F7HA 4C56B 3G5ZB 2MCPL 4DGYH 2BMKA 2PF6A 3TJHC 1F6AA 4PRHE 1M71B 5IBUB 5CJXC 5I8KL 5F9OH 3S35H 2JKXA 3IDGB 4P46A 3EHBC 3LAFA 3V5HA 1EFXB 1I3VA 5IFAH 3LRGA 4LPXA 1Z2KA 1G7MB 4LSSH 1LEKA 4BUGA 3KPSD 1NMAL 2VDLH 4LSVL 1WZMA 3S96B 2CGRL 5IWLC 1FPTL 2XTJB 4G6AD 1AXTL 2IH3A 1JHLH 1UZ8A 3WE6B 1BIHA 1LO4L 1VEPA 5D7LE 4PJAE 4PB9L 2WMPA 4TNWK 3VFSB 1CVSC 4PRNA 3G5VA 1KLGA 2PTTB 5DRNA 2JB5L 4LEOB 1I9IH 4GXUM 1Z0NA 5KSAC 4QXGH 3QDJD 3HPJB 1NGPL 4G8GA 4QHNA 4NQEE 3HC4H 1BVLB 2HTKD 3UTZB 3KXFB 1JPST 1KBGL 3QULA 2YS4A 4QHUA 1RMFH 1UENA 3X3FL 1R0AL 3CXHK 2BJML 3MLSL 3OAUH 5E2JA 1KJMA 4LPCA 3KR3H 4HPYL 4QXWA 5D9SA 3SE4C 4N90E 2X4RA 1JYXA 4NPYB 4UT6H 4JQIL 3EOBA 4JFEE 3MLVL 3LKRB 2BVTA 5C0GA 2X4PA 4ONFH 3U7WL 1I9EA 1TDQA 4XVJL 4LCCC 1WEJL 3B5TA 5T33L 1X4ZA 1MFBL 1LWRA 4UDTA 3TPUB 1XR8B 1MCSA 3MXWH 4JCMA 4M4PA 3GGWA 1YN7A 4F8QA 1N6VA 1KFAH 1PX4A 1CN4A 3PGFL 5LGKA 4D3CH 1S7TB 3QA3B 4ZNCD 3OTTA 4G8EB 4J1UA 3SE8L 1S7RA 1FO0A 5T3XH 1WCBA 4JKLA 5HHQA 3RFZC 1VKXA 1FVCB 2KL6A 1INEH 2FWOB 5CP3A 4B50A 4EVNA 4NQXA 4LPWA 5EU3A 1KYOK 1QFUH 2YUVA 4JFFA 3KPRD 4JY6B 2VERN 2YD2A 5KZCD 2VH5L 2YD5A 3QIUA 2HRPH 4WU7A 5ITBH 4K94H 5DJDA 1EGJH 1J05B 3C6LB 4G6FB 1EVUA 1ZGLP 3B9KA 3ZT6A 4ZO9A 3A67H 1H9VA 2WAHA 3QO0B 1BJMA 1DUZA 1H15A 2FHCA 3MRRB 2CXGA 1KN2H 1MCJA 3RNQB 3F7VA 3U0TA 1Q9WA 3M45A 1RUQL 4NZRH 1FGVL 2G60H 1NDGA 3MLTA 1E6JH 4QTIL 5FV2A 3FONA 3FZUD 4F9PC 3HN3A 3D6GA 5ADOH 1FLRH 3G5XB 4G80A 5DEZA 5JNYB 1GAFL 1U8KB 2W91A 3VWJA 1NCWH 1Z9OA 1W72B 4NP4H 3ARVA 3QEGH 2RR3A 4FFYL 5GS0C 3S9DB 1ORSB 5DHVB 2ZSVA 3L3OB 3W0WD 4MD5B 5I2IB 1S7VA 4LLWA 4HJ0D 2BVUA 3TNMB 2UUDK 1PG7L 4YNYB 1R5VA 1CL7H 3HC3L 1OSZA 3BUTA 1F4XH 5DD0L 3LS5H 4ODTH 1U8HA 3MXVL 1TTGA 4KKAC 1X9QA 2Y06H 5CJOL 3HI1B 4U3CA 1TNNA 1RAMA 4FG6D 1NGYA 1XF2A 4U1LB 3SO3B 4R2GC 3EKCA 5F71A 2ZG3A 4K8RD 1GHFH 3IAGC 2EDEA 3KYMA 5GISH 2D9CA 4WHTA 1BZ9A 1PX3A 2NQCA 2D4DA 2NTFA 3OKMA 4PREA 1KN4L 5F3BA 3TIDB 5E03A 5GHWL 3V2AR 3ZYJA 5JW5B 2A2QT 2YSSB 3WIIL 3QDMB 4QRTA 3EYFA 5F3HB 2XN9B 1MVUB 3B83A 5T5NF 1WJ3A 2R4SL 4GSDH 5JUEH 4LLVA 1QYGH 3BMVA 5JORA 2BNQE 4UAOB 1R24A 2X1PA 1T6VN 1JZ3A 1LILA 1FRGL 3BISA 4FTVD 3NCFB 4OI8A 1JWMB 2X44D 4XVTL 2AJUL 2P24A 3OKDB 2CRIA 3D3VB 2DJUA 3HCVB 2G5BA 5E2TL 2AJZA 5SX4H 7FABL 3MLZH 3VFNB 2AK4A 4YZFF 3RL2B 1J0HA 3O8XD 4NQCE 1L0QA 1FAIH 2HVJB 1IL1A 1QRNB 4OM1L 1RZFL 5LGJB 3V5DB 3VFWB 4WCYH 1J0IA 1XCQA 5D2NE 4L3EB 5E8NA 3ZDYF 3HPLA 1RJYA 4DCQA 4XPHL 3TO4D 2Z31A 2DRUA 3B3IB 1NGZA 1LD9A 1ZLVH 2BVYA 4AEHH 2VDRL 2XZAL 2E9JA 3LS4H 4PJ8D 2CDGA 3U0WL 1ZSDB 5GGSB 3RZWA 2MMXA 3DYPA 1EO8H 1CG9A 3ARBC 3FB5A 1QR1A 3WDHA 2EICA 5HYJE 3MV11 1P4IH 1L7IH 3PE9A 1GIGH 3QJHA 1A7OH 4KY1L 1EERB 1IM3A 2FATL 4PJ7E 4KRMB 4F15B 4M7KH 2IG2H 4KQ4L 3HZVA 5EO1A 3S5LB 3SQBA 1T1WA 5GGTA 2YOCA 2IALB 5KSVB 3QUMA 4MJIB 3EFDL 2PYEB 4PRDA 5HHVL 2YPLD 5FYJD 3D39B 3O3AB 4MXWL 4U6XA 3L5XH 1DLFH 1KIQB 2MWCA 4P99A 2VDNL 3VXSD 2IFFH 2VLRE 2N56A 2VZVA 1ZA3A 5BCAA 2IADA 3UTOA 4ZD3H 4X8JA 4ESKA 4XCEA 2X7LB 5IMOB 3WHXA 4HIXL 3IXAB 2ZZUT 4FQIH 4OZHB 3T4YB 1XGYH 2LABA 5KANG 3DNKA 3MO1A 1UVQB 3P0VL 5FGBC 5I1IH 2XRAL 1CLCA 2DWEB 1WAAF 4RFNC 1LDPL 4PLKD 3QJFB 3PP4H 5D1ZB 5F7FA 1UACH 3IJYB 3GMOB 4LKXB 4L9DA 1ZA6B 3OAYK 5F7NC 1CTNA 3S37X 2NY6D 1U8IA 2MTPA 3BH8A 5FECA 5HD8C 4Y16D 1T3FB 1M7IB 2VLJE 3R1GH 5J06A 4FNLH 1AGFA 4TSCH 3LN5B 4H8WH 2IBGA 4ZTPL 3ZE0F 4GMSH 2BCKB 4AEEA 1DLHB 3TJEL 1SBSH 1C5CL 5D72L 1QSFE 1MAJA 1AY1L 1E28B 1YUHA 5KSUB 5GGRY 2CIKB 3OR7B 4QF1A 1GGTA 3VGFA 1Q0YH 5ICYA 3FKUS 4QKXB 5SX5K 3I3BA 4PP1C 3LQMA 4RRPA 3BDXA 3QXWA 1YQVL 4GKOA 3WL9B 4IRJA 5HGDB 3P2TA 2NY4C 3QDJB 5MHSD 4P9HC 2F54B 3MBED 3O2DH 3VD7A 1IC5L 2EDHA 5EBGA 3TGXA 2GITB 4WV1B 3WHE1 4OCXH 1OAUH 1RIVL 2YD1A 5E8EB 2NR6C 4G9DB 5DJCA 3TN0D 4DKFL 4RAUB 2D0HA 4PV8A 1OTSC 3L6FB 2MQ3A 4QRUA 2VLLA 4YGAB 1J8HA 4ZUSA 1UYWH 4Y4HA 3H9HB 4BZ1H 5AD0A 5IB2B 3IDNA 4XP5H 3K2MC 5I8CA 3MNZB 5C0IB 5DURD 4BQ9A 1C7SA 3WMSA 4RGNE 3QIBC 2CLVB 1OTTC 2H41A 1Q8MA 2AJSH 4MLIA 2EO1A 1ED3B 3VXMB 5DGQA 1BQHB 2V9QA 4K8RH 1R3HA 2XWBB 1CFSB 1C1EL 3SGJC 1KIUA 4QRRE 1CXIA 3K4ZA 5GGVL 2RB8A 5FHAL 1NFKA 2EH8L 5IB4B 2D7NA 5FK9B 4EQ3A 4QTHB 1G6RL 1SEQL 2ZSWB 3EYSH 3VFGL 1YEHH 4Z7QE 3Q0HA 5DMKB 4LCIH 1KIRB 2EIZA 1QFWH 3QI9C 3RVXD 2ORBL 1EHLL 3W5MA 2M1KA 4PGBA 5GJSH 1JPGA 1IGTB 3RNKB 3P77B 4JFZH 4WUUA 4K55A 4LQ1A 3TYGH 2Y6SC 3I6GA 2G2RA 4OZ4A 4KDTA 1UB5B 3IAPA 4FMKA 3UBXA 5DJYA 4Z78A 3TZVD 5CHNA 1EX0A 1VPOH 3SDXE 1OAQL 3ARDD 4G9FE 1D6EB 4ORGB 4PB0L 3U9UA 3CLEH 1GC1C 1N64H 2DQJH 5F6HJ 1HNGA 4UDUA 1IAKB 1WCQA 2D03H 3C87A 1U91A 4YHLL 1NLDL 4HIJB 1H3PH 1A3LL 3V4PL 1OARL 4NGHL 5SWZD 5DDHA 5DLML 1S9WB 4NO0A 4A2LA 1ZEAH 2VISB 3N9GH 4LLMA 3QG6A 4XPTL 5CJ8A 4U1HB 1I3RA 1QSED 1PZ5A 4UV7L 4P59L 1GGUA 3HNTL 4I9WD 4NNYA 2R8SL 2BZDA 5IMMB 4F7PA 3SGEI 5HYSA 4LLUB 4CN1A 4ZG1A 4UI2A 2OP4H 3A6CL 1F6FB 3IDYB 3U30C 3WIHH 2JJSA 2P8PB 5HHOE 4EI5A 5IK3A 1YY8A 3MLPA 5C0FA 4ODWB 5HTSA 2M2DA 3QUZB 2AJXH 2R69L 5IVXF 4GG8A 3AU1B 1E0OB 5I15H 2KZ1B 5J6HA 3GBNL 3ZHKA 5IB3A 4OLEA 3KLAB 3UJIH 2BSTB 5FYJH 3U4EB 3VRLE 4RMRA 4R0LC 4DOHB 5EZIH 1NDMB 2GY5A 4J4PA 4FQ1H 3KAAA 4P2QA 3BHBB 2BDNH 4G6ML 4BK4A 3JWOL 4JM2F 3MLYH 3NFPA 2E9IA 4OLUH 1QA9B 1BF8A 3GKWL 4AG4L 4YHIA 1INQB 1G7LB 3BUYB 3T77B 2PCPB 1K4CB 4FZEH 3ARGA 5AUMA 3RVVC 2ESVE 2K7PA 4ELKB 4CVUA 5F9WB 4S1DD 1DZBA 1XH3B 4UZGA 3ZTJH 3DURA 5KAQG 5C3TA 5C07B 2JJWA 1S5IH 3BP7B 3T1FA 1BJ1H 3EJZD 1DANU 5DHXB 3VFOA 5I17A 4OIAA 5HI5C 3BZEA 4ZXBB 3TVMB 3ZE1F 2YZ1A 1JZ8A 1NFIA 3RWHA 3TV3L 4DEPC 4YDJA 2B0SH 2I5YL 4LASL 5HGAB 4K7FB 4CVXB 4IIQB 4XP6H 1G9NC 2HT2D 4OQTH 4QCIB 3FHQA 5JHLL 4N8PA 1NUGA 4FTVB 1TZIA 1MJ7H 2G9HA 1XFPA 1FJ1B 1FNEA 2OTUB 5ITFA 4Y5YB 2X41A 1AQDB 3JV4B 2V7NA 4Y5XA 1D5IH 1WBYB 4P4KD 4NRYB 3DROB 3QRFM 2OR9L 3VFVA 3HE7A 1R3LB 5M94B 5EOCJ 4HWEL 5C0CB 2FJGA 4G6JH 5IESL 3TBVA 1HQ4B 5B8CB 5BJTB 4GG6B 3FO2A 1LVEA 4GQPH 5KSBA 1P6FA 3I6KB 4WNQA 4JHAL 1SY6A 3C5JB 4FFVC 2DD8L 3MJ8B 1I7TB 1UM6L 1FFPA 3VCLB 3BDBA 1BZ7A 1T1XA 1G9NH 2QQLH 2VN4A 2C5DC 1A14H 3O4LB 3M17A 4DVRL 3DUUA 3MNVA 4TUJA 3CH8A 1IAII 3U46B 2Q7YB 4PJ8B 4N8CL 4PUBL 4OZIE 3RWEA 5D1QA 3PNWA 3VXUE 4M1CD 1FIGH 5EUKA 3CDGA 4WO4D 1MI5E 5BVJA 4GBXA 5JPNB 2UWEF 2IAMD 2H2SD 1Q9OA 2BC4A 3EYQD 3PWVA 4G7VH 2LAAA 1GZPB 5H2BA 1NC4D 5BXFA 1HHJB 2ADJA 3HE6A 4U1MB 4UT9H 5MEQB 3VFTA 2ITCB 2YRLA 1A4KB 3NCMA 2OZ4L 2EXWC 3JTTA 4FFWC 5F88B 5SWSB 5DUML 5TFSH 2YPLB 1D9KA 2FECL 4OLWH 3HLAB 4KVCH 3S4SA 4L29B 5DD3H 2BVOB 3RWDA 1MQKL 3BO8A 3CH1A 3RWJA 3UYRH 3L3KA 4HK0A 2PO6B 4RFEA 3HMXA 3H42H 5IEHB 2GI7A 2CH8A 1XGRB 3FO0H 5E7FA 2QR0B 5FHBH 2WBJC 4UOW0 1GRWA 3U1SH 4M7LH 2OSLB 4QT5B 2VWEE 4OLYL 1K4DB 2B5IB 2W9LA 4X6EA 3X3GL 5KVGH 1M7DA 5B3JE 3D2UD 4X5XA 2FGZA 1YEGH 2I9LB 1HEZA 4XTRC 3LIZL 1TNMA 4MCZB 2NY1C 1J86A 5C0AD 3VFUB 1UCBH 1PEWA 3DPBA 2BSRA 5JXED 5CILL 4OFYA 2CJUL 2WLYA 3ESUF 1ZLSH 1RUPL 2NY6B 2E27H 2UUDH 3MRQB 4PJHE 1SJHA 4XCFL 3WNOA 1T7WA 3GMQB 3DX6B 3MV9D 3S97C 5DO2C 3BRFA 2Y5TB 5BRZA 2I9TB 2X70B 1V3MA 5C0DB 5KVFH 5I19H 2M8XA 2G75A 1KPVB 2FZ3A 4YFLI 4RIRA 2ADGA 4P5KA 3Q6GH 4P0DA 2DKMA 4PRPA 4D9LH 2VIRB 3C5ZC 2QSCH 2R15A 2CUHA 1BX2B 2HJFB 5TQ2H 1U41A 4MAYA 4U6YA 4HUVB 1DVFD 1KCVH 4Y1AD 3SKOA 2GHWB 4XAKE 3RGHA 3BP4B 1RVFH 1HYRC 3WV0A 5MENB 2HFGL 3QPXL 1MCLA 2Z93B 4W70A 5CUSL 2I60H 2UY7A 3GUTA 1VFAA 4F9LA 1REIA 1G7HA 3ULUL 4F80A 5L2KD 3EW3B 2VDOH 1WC7A 1JNLL 3EZJB 4XCNA 4U2YA 5BV7L 3GSXA 4TUOB 4KZDH 1AD9B 4W6XB 3TN0B 5CAYB 2IPTH 5AG8A 1EFQA 3VXNB 5J1AA 1UEMA 4V2BA 3L7FA 4EI6A 3O9WD 5BQ7A 1JRHL 5LKNA 3FAXA 1MIEL 1GC1L 3SKNB 4Z7WA 5L0QC 1JBJA 5D8JL 5FKAB 1RIUH 1A6WH 5ICXA 4LHUD 1BFOA 4P57A 3QUYA 4U3HA 1MCWW 4HKJA 4LSUL 1KB5B 1F4YL 1TJGL 5T3XE 4NT6B 2P48B 1MFAH 3PHQA 2XWTB 2C1PA 4ODHL 5F7WC 5I18L 2EDRA 4RNRB 3L7EB 3HUJE 5EC2A 3RJDA 4NN5B 3G5YB 3DVIA 1PD6A 4YXLL 2YKLH 2A74A 5C0JB 1VGEL 2IBZX 4CVZB 2W9EL 3SHSA 2NY0D 3T3MF 4X0KA 5ANME 3D3VE 4RSVA 4MMXC 3ROOA 4YBQC 32C2B 2X4UB 3L5WA 43CAA 3DUSA 5I74B 4DVBA 4X5WA 3UPRA 4N0YL 1SM3L 3U7YL 5I8KH 2WWMD 2XT1B 4Y19A 4OD1L 2BXYA 3O4OC 1VACA 2XY2A 1B2WL 4JN2B 5DI8B 3C8KB 3TIEB 2DQEL 5KW9L 3IDIB 3BESR 1NMAH 1A6AA 4QRPA 3JUYA 4DAGH 1CT8B 3IB4A 4LSVH 3OJMB 5LGHL 3QNYB 2CGRH 1FPTH 3ARPA 5ID1A 1HINL 4K07A 1AXTH 5HDBE 3BX7C 3DVNA 2WM0A 5SWZB 1LO4H 4PRIB 3T0WA 1F97A 3GSWA 4PB9H 1J0YA 3QZWA 2A6JA 3AS2A 5F97E 2EEAA 3MGAA 2X42A 4LCYA 2JB5H 4Q6IC 1CGYA 1T1ZB 1U8LB 2C3VA 1NGPH 3VWKC 3BZFA 4O2EB 2O61A 1GGYA 2BOBA 4FHBD 4L8SB 1KBGH 4R7DA 3OAYH 3V6ZB 2V17L 4NKDB 3X3FH 1FFRA 1R0AH 5JHDA 3WJJA 2BJMH 2C7UA 3MLSH 3T0EE 1A7NH 1N6QL 2AS5M 5DXWA 3QCVL 4PRHA 4OQ1A 1XZ0A 3WO4B 1H8SA 4JQIH 5IP4A 3MLVH 5DJ2A 5B3NA 2E7MA 4JDZA 4ZQKB 3PWNA 4L9LC 4LGRB 3U7WH 1NMBL 3HFML 1ZE3C 4S2SA 5F7DB 5T33H 4L4VE 5C9JA 4ZDHB 3H2WA 4YC2C 4PJDE 4HKBA 1ETZA 3MLXL 2NMSA 2LAGB 1H3VA 4LCWB 5C6PB 4KMLB 1ES0A 3PGFH 4Y2DC 5D7LA 4PJAA 4Z5RA 3I02B 1TLKA 4EIZC 3DRQB 3MJ7A 3KWWB 4WI5A 4PJ9B 3KPSE 5HHPA 3E3QC 4WY7H 4CAGA 5J12B 1BLNB 4X99B 3QWRA 3KPPA 5IB1B 4ZFFB 4NQEA 4Y4KA 2VXVL 1HN1A 1M6OA 3WFHA 3MRCB 2E7HA 1CFBA 4ZUTB 2VH5H 1RUAH 1YPZB 4PS4L 2YPKA 2FIKA 1XGTA 2UYLB 3LKSA 1UXSA 4PGCB 1CGVA 2VQTA 4X9BA 4RWYL 2OBGA 4U6HB 4FXKA 3SCMC 5D1XD 1BAFL 4EXKA 5F70A 4IHOA 2HG5A 2DL2A 4A6YA 4GUPB 1H8OA 4JFEA 5GZOC 4W6YB 1RUQH 3T09A 3EDDA 1FGVH 3JTSB 4QTIH 5T5NG 1CGWA 5HXMA 5F1NB 3T08A 5GRYA 1QQDA 4X7FC 1GAFH 3PV6B 2O5XL 4LQFL 1CGXA 5DYOB 1T89C 1A9EA 5DHYB 2NY2D 3DMMB 4FFYH 1KJ2L 3MA7B 3DARA 1LK3L 1IRAY 3MV8E 1I9RH 4QY8A 2IAMB 1AIFB 2CR3A 4HMCA 3MRHA 1IILE 3O11A 1L0YA 1NC4B 4QNPF 1PG7H 1T7YA 2P7TA 2A6KB 3BKYL 5IJVA 3DTXB 5CCKL 3HC3H 3JV6A 4J7RA 3BQUB 3VI4F 1HILA 2QBWA 1KCKA 1W2KT 3GSQB 3MXVH 4JO4H 4Z0XB 5C08E 1CICD 5CJOH 3SDAC 1DCLA 2HLFC 2R1XB 3QUXD 2WINA 1DQDL 1Y6NR 1A5FH 5IFHH 3MLRL 5DVOA 2FBJL 3JWNC 1QSVA 1KN4H 5DJXB 3GO1H 4HQQL 3KPRE 3D2UB 3WIIH 3S3JA 4MXVF 1QBML 5K9QI 5ETUB 4YQXH 1UFUA 1IKNC 5J13B 3P9LB 4LSDA 3E2HB 2R4SH 1ZHNA 1N4XL 2D7TH 4MQXC 3MMEA 1FRGH 2N1KA 3MV9B 4XP1H 4NO5B 4FZ8L 3PWJA 3HAEH 4F8TA 4XVTH 2AJUH 3T4AB 1BOGA 1T2QH 4HBQA 5F89A 1A1OA 1H5BB 2VQ1A 5E2TH 7FABH 3G04A 4R97C 2X2YA 3X12B 2WNGA 1EVTC 4N0CC 4U1KB 2R2BA 1DUYA 1RZFH 4OM1H 3FOMB 4HIEB 5D7IE 1DVFB 1IVLA 3VXPA 3W0WE 5A3IC 1EV2E 2K3TA 3IJHA 4G42B 3RL1B 2A6IB 5IHLB 4XPHH 4K3JL 2HLAA 1NC2A 1CXLA 2DQTH 4HHAB 4WFHD 4MDJA 4HXBL 2XZAH 1AE6L 1SYSA 2IH1A 1CDBA 3U0WH 4BSVB 1U3ZA 4XNXH 1X5AA 4LHJB 4LEXL 1OP3K 1N8ZB 3SKMB 3I9GH 3FOLB 3ULVL 1S9XB 2GFBB 3WUWB 1K5NB 2FR4A 3J7HA 5EPMA 1CL7I 1FQ9C 3FB8A 3GM8A 3TT1H 1VFUA 2EKSA 1UWEL 2BOCA 4KY1H 3M1BB 4JFYA 5I1EL 2RFXB 3O9WB 4BQCA 1QG3A 2WLZA 4KQ4H 4UUJA 2APBA 1SEBA 1JHTB 1MRDL 2BNQA 5EWIL 1RZGB 4QGYA 3D85A 3GI8L 3CZJA 1V8HA 4P46C 3EOYG 2V9TA 2LVEA 5CZKA 3SN6N 4FS0A 5ESQA 1YYMH 4MXWH 2R29L 4LSRL 3FN9A 4HZLB 4HG4K 2VDNH 2DYPD 4C57C 4ONGL 2EZ0D 1P7QA 3O6FD 3KPQA 4KJWD 1CLOL 4MD4A 3MYJA 5E70A 3QEHB 1I1AB 4P5TD 1W0WB 3AREB 2IWGA 4J6RH 4YHML 1XMWA 3ALWA 3VGGA 3MRFB 2R2EB 1TMCB 5D2NA 4HIXH 5FCUL 3MRPA 3LKPB 3V5KB 1GOFA 4Z7VF 1SMOA 3NFSL 3RGVA 3DV4B 1Y18B 1EXUB 1GVIA 5EZOL 1FP5A 1OCWL 4JM2C 5JTWA 5D7JA 4JO3H 5KANI 5I73C 4OIBA 3FN0H 1I7UA 2YA1A 5GPRA 3V6FA 3O45A 3DX9A 4MA7H 5HYJA 2QLVB 5ISZE 1OD7A 2AW2A 4OV5B 1PVHA 2DWDB 1P6AB 4PJ7A 1NBVL 4ZTPH 1MREL 2VTFA 2EIBA 1ZWIA 1CFQB 3OX8B 2MKWA 3TJEH 4EOWL 1C5CH 4NO3B 3UJTH 2VABB 4PJ5D 1U6AH 5CD5C 5JO5A 5D93C 4KJPD 3UZVB 1OT1A 1D5BB 1LDSA 3H9SD 4OCMC 1GOGA 4AEIL 2YRPA 5CP7B 1YECL 1IAMA 4DK6A 4OAWB 1I1FA 4ELMB 5T1DL 5B4MC 3REWA 3RIFF 2NW2B 1YQVH 1CDHA 3ZDXF 4H5SA 2D0GA 3SDCB 1WV7T 1XGPA 3EOAA 5DF0A 1TPXC 3BWAA 1JI1A 1QLEL 3F62A 1RY7B 1T0MB 5HY9A 5FYJE 4MXQC 4KHTL 5DQ9A 3VXSE 4R96B 4DKFH 1A0QL 2BHUA 3FO9A 2XKUA 1WIPA 4PTTA 3OJVC 1QLFB 1SYVA 4I4WA 4X6DE 1I8KA 1A4JB 5CIPA 4HEME 3MRJA 3MUHL 5F9JA 1YNLL 5FKPB 4YHYC 2A6DA 3QIUC 3H3PL 1A7QH 4WTZA 2VLJA 5FA4B 3SE9L 2DI7A 4E0RA 2R1WB 4YR6A 2IJ0C 1IQWL 1NKOA 5JIKA 3NIDE 4RMUA 1QSFA 1TFHA 1JN6B 3F6LA 5FHAH 3MACL 1Y0LB 2FHFA 5FYLL 2EYRA 3PXHA 4XC1H 1NBZA 4IRSD 1U93A 3FQNB 2A9MH 1IQDB 1G6RH 1MELA 1WF5A 1QRKA 2A73B 3VFGH 2EDDA 5ABDE 2ORBH 1EHLH 3MUGA 3LD8C 5D2LE 1KEGL 3MA9L 2AKRB 4Z7WF 4G5ZL 3TP4A 5I0ZA 4H26A 2GKIA 2FX7L 5T1KA 3ZLQC 4PJXE 4AH2B 2J8UE 5DRWB 5DVKA 3DIFA 2V2WA 5EN2B 4UBDD 4POZC 3Q6FA 3MRMA 3RBSA 3SJVB 3MFFB 1KELL 3FAWA 4LBEA 1OAQH 1HHIA 4YHKH 2ICES 4N0FB 1YDPA 1KB9J 5DS8A 2BSSB 1CU4H 4YHLH 1FZOA 1NLDH 3TYFB 5MHSE 4YXKL 3V4PH 1OARH 1RIHL 5J0BA 4NGHH 5DLMH 4P23D 4Z76A 4ENEC 4M61A 1FFNA 2GAZA 2Q1EA 2HH0H 3ALPA 3WIFB 1F6LL 3P4NB 3S88L 3V0VB 4XPTH 4NKOB 3FFCE 4UU9B 1NAKL 5LWYL 5MERA 4BJLA 4UV7H 4AENB 5KOVC 1OGTB 4QRRA 4AL8L 4X6CE 2PW2B 3RIFK 2AXFA 4KK5C 4Y5VC 4X4ME 3HNTH 2XOTA 1P5UA 4BSWA 3ULUD 2FEDC 2R8SH 4OKVB 5KTEL 2ATKB 2NY2B 5JW4M 5IV2B 4EN3D 5ACMA 5E8OA 5I66A 5EU6D 4OZFA 1MAML 1DBAL 4NQDB 1TVBB 3G6JE 3UYOD 4J3OC 4KI5D 1TQCC 2R69H 4F7EB 2XACC 3FN3A 4RGMC 4P49A 5L8LB 1JGEA 3S3PA 2GTZB 1MCFA 1A6VH 1HSAA 1DJSA 4K9EL 4XMLL 5K59F 1G84A 1S9YA 2UZIH 3QUXB 1G1YA 1RZ8A 1F90L 25C8L 4G6MH 4P2OD 3CFDB 3CZFA 4UINL 2JIXB 3JWOH 2CKBH 5I71B 5CSBA 3VXRD 3TNNA 3PL6A 3KYAA 5F7LB 3BRDA 2W60B 3GJEB 3WXWH 3WLBA 1PKQE 5JLZA 2W9DL 5LAXB 3SO5A 2B20A 3GSOB 2Z31C 4MNQD 1NMCC 1A7PL 5EIIA 3GMRA 3RX7A 3GSRA 3QWOA 3F6IA 4JFPB 4NC0B 1LP9B 3C9NA 2NY3C 3RX5A 5I76A 2EYTB 2P5EB 4Z7UE 4ZOEA 2NLJA 4Q7DA 4M8QB 1ND0B 4ZS6D 3TV3H 4PRAA 2I5YH 3JBG7 1K8IB 1R3IL 2VLMD 4ZYKB 2JTDA 1JFQL 3OKOA 3HZYA 3WEXA 3EJYD 1N3NA 4HWBA 4N9GB 2VDPL 2Q8BL 1T0NB 5CGTA 5HHOA 5KN5A 1U8OB 4HEPG 1QSEE 2X9YA 3GNML 5L88H 1ONQA 2OR9H 1T22B 3OKNB 4EKXA 2CPCA 3L95B 4JHZA 2BNRD 4R2GB 4HWEH 3QPQD 3QQ3A 1RFDL 5IESH 4ZOAA 3UTSE 1CCZA 4H88L 4JFXB 4DGIH 2WK2A 3MV7D 5C09A 3V6OE 3RUGF 2DD8H 1UM6H 5HGBA 3PP3K 2X4NA 5FDWA 4KFZC 1J1XL 3LSOA 1EO7A 4DVRH 1RK0B 1BVZA 3FQTA 3IU3B 1MWAL 5DJZA 1L4IA 4OZGF 3H3BC 4GRLA 4LNVA 4Q9QL 1FCGA 1B0WA 2ESVA 2VJXA 4YK4C 3MREA 1F3JB 1MCKA 1S9VA 3ZO0A 3GSVB 2LFGA 3F7YB 2YK1L 3SKJH 1CDUA 1ORQB 2PTVA 2H32B 4DZ8A 3K8LA 1EZVY 2NX5E 4M5YH 1LO0L 4XBGB 2OZ4H 1NSNL 3TA3A 4H1LG 4KVNL 4X9HA 4PD4K 5DUMH 3ARFA 4GFTB 4QWWC 3GMNB 3NBNA 4XWOD 3VMPA 1HYSC 5IG7A 1MQKH 4WW2A 1Z5LB 2DYPB 4UIKL 3B5GA 1HHHB 2ADFH 4GAFB 1TCMA 3HNVL 3L3JB 3CJJA 5EUOF 4P5TB 4F2MB 3MV01 7CGTA 3KJ4C 1T4KB 3CSPA 4MQTB 4OLYH 2YHGA 4E41D 3X3GH 4PJFF 2CLZB 5A2LH 4A2MA 5TE6L 2D2OA 4N0UE 4KK8D 1Y6MR 5GSRA 5B22A 2J4WL 5CBAA 5AZEL 4OLXL 2P49B 2A1WL 4IRJC 1UKQA 3ARBB 2X9XA 3IDJB 4OUUB 1DDHB 5CILH 2CJUH 4NQUA 5GS2D 2LTQC 1JWUB 2MKLC 3LKNB 4OZIA 3PGDB 4MJ6B 1XF5A 4LVNC 1P69B 3VXUA 2PKDA 1MI5A 3P40A 4LDEB 4WWKD 4OGAD 1XF3B 4KH2A 5JPMA 1U9KA 1XCTB 4XBPB 1B4JL 4Y4HC 1R5WB 4K23L 3BGFC 3Q1SL 3PWPB 5E2VH 1A6TB 1KCUL 1S7QB 3U7AA 2QJDA 4N1CA 1S7TA 3MSPA 4AQ1B 2ZCHL 3QP3A 2A83B 1Q9KA 1S7SB 3OBAA 2HFGH 4XZUA 3QPXH 1J10A 5CUSH 4XPBL 4J3TA 4LSPL 2VR4A 3ULUH 2EYSA 3VXTA 2V2XA 4OF0A 3FQRB 3ZKMC 1AGBB 1HIML 1YJDC 4HC1L 5IVOA 3VG9C 1QUNA 4ACPA 3KG5A 4LLQB 2A0LC 4YZFE 2DM3A 4RGOL 2R23A 1MHCB 4O2FB 5E7BA 2OK0H 2H3NB 5A2KH 4KDTC 1MIEH 1WT5A 2FB4L 3ZDYE 4I3RH 4JAMA 3BPNC 1BGXH 5D8JH 4PJHA 1K8DB 3RNQA 4H25A 5EU4A 4FQXC 4GXUN 1F2XK 1SVCP 1NCAL 4MQ7A 1CTOA 3IDMB 5SWQA 4LPTA 3GRWH 4I13B 4LSUH 1F4YH 1TJGH 1MJJB 5C0AE 1YMMD 1HE7A 1HWGB 2HKHL 3MRKB 1OGAD 4ODHH 3OWEA 4FABL 5L2JA 1NJ9A 2NYYD 5FM4A 3UROR 2JF1A 4IRSB 2P8MB 1H3XA 1ORSA 2MFNA 4WDIA 5E9DE 4YXLH 2DTSA 1J18A 4C83B 2NY4B 1WFOA 3U79A 5DRZA 2OS7A 1DFBH 1VGEH 5D96C 2GJZA 4FQLL 4NQVB 5IWLA 2QTEA 2W9EH 3BN9C 1NGQH 3BW9A 3CVHH 3MGOA 1RZIA 4M8VA 4QYOB 1EJOL 4QOKD 4Z95L 5FB8B 3THML 2IPKB 5ENWA 1AD0A 4RRPG 4APQC 1JTOA 4N0YH 5D7KD 3KYKL 1IGML 2D7MA 2GTWA 1F2QA 3U7YH 5H35B 4OTXL 1DN0B 3UAJC 2JJSC 4Y1AE 5KSAA 1DL7L 4EI5C 4D0DB 1RUKH 2R0WL 3W9DA 4R4NC 4Y8AA 2DQEH 3GMMB 2GJ6D 3D69B 5CMAB 3UTTE 5KW9H 1DE4A 1X6NA 5C6TL 3QEQD 1HINH 5L2KE 4KZEL 5IVZB 3LEVH 3DO7B 3OPZL 4KRPD 4J4PC 5JW5A 2YSSA 2FGWL 3QH3B 3DRTB 3MRIB 4ORZC 5E6YA 5DD6B 4ZFOB 1MVUA 5HI3C 5TGBB 2COQA 1GZQB 4KKCC 1NUFA 1AO7B 1YEJH 2DJSA 1CGTA 3KLSA 4RMQA 2JELL 5JMRA 4V1DD 3K2UL 5INCA 4UTBH 4KROC 3HUJA 4BQ8A 3LHPH 3ES6A 4OCLC 4O58L 1AGDA 3MROB 1WGOA 5EU5B 5H8DA 5IT2L 2GT9B 4PJ7F 3ULVD 3ZE0E 2HTLD 5BV7B 4RZCA 5ANMA 1EGJA 3D3VA 2V17H 5EU6B 4RA3A 1G7QB 4EUPH 3V9FA 2C9AA 5EO9A 1N6QH 1KTKE 2PXYA 1CDJA 3QCVH 3QUML 3HZKB 3V5DA 4IM8A 3MFGB 5ID0A 4Y5XC 1ZANL 4GKNB 1NMBH 3HFMH 5L7XH 3HE7C 1SJXA 3VXRB 1BECA 3QEUB 5B38A 1FNAA 3DGGA 4X98B 3MRLA 4XVUC 1MFNA 2O5ZL 4KJQD 3AAZB 3WS3A 1A6ZA 3WFDL 5DR5L 4M1GL 3LKOB 3P4OA 5JOEA 1OTUD 3D18A 4XVSL 3EO1A 1RV6X 3ZMRA 2WQRA 3HI5L 3HTLX 5KS9B 5IF0B 2DICA 4WTWA 4PIRF 1ZHKB 3B5HA 5H37G 5GS2H 3D0LA 5D1QC 1AP2A 1LGVA 4NDMA 1IBGH 4DN3L 2VXVH 3EFFA 3ISWA 4GBXC 1MHHB 4HGWB 2F5BH 4ZAKA 5JW4R 4BFGA 3W11D 1KIQA 4PS4H 3HR5A 4OKDA 3HE6C 2H8PA 1BJ1J 4LFHD 3DBXB 5HYSG 3BDYL 4C4KT 4OCNC 4U7SA 4RWYH 2DQDL 3T0EA 4JDTL 4YUEL 4R0LB 5CJQL 4U1IB 1AGEA 1D9KC 1B9ZA 2BNRB 5DVNA 3LQAL 1S9KC 1DBKL 5FUZL 1FVEB 4NO2A 4P2RD 3MV7B 4HUUB 3X13A 1JCKA 4OJFL 2R4RL 4GAGL 1UXWB 4POYA 1UVQA 2F19L 4LP4A 3V4UH 4L4VA 4PJDA 3HKFA 3C2SA 5DJ8B 4JG0H 2O5XH 5JDSB 4NJ9L 1I7RB 5IQ9B 2F8XC 4LQFH 4GW4A 3GSUB 2BERA 5IBLC 4WFFD 1KCRL 3OR6A 2NXYC 3WSQL 1KJ2H 1UGNA 4GH7B 1M7IA 4UQ2A 4DEPB 4W68A 1XIWC 2H2PD 3PJSB 1PQZA 3KPSA 1ZLUH 1TJHH 4Q9RL 3BKYH 5I9QB 5EH1A 1DLHA 1LO3L 1ZS8B 3QAZC 1A1NA 3JWDC 4Y4FD 4O2CB 2ZUSA 3KPTA 1CR9L 5J6GB 3KYNB 5ICZA 4FQ2L 4L8DB 4OFPA 1T80A 3NGBC 3P9MA 1D5MB 1JGLL 4HUMB 3C5SA 5GGSY 1F3DH 2YA0A 1WFTA 3PWLB 1U92B 3LQZA 4NYLA 4OGZA 3MLRH 3QDJA 5F44A 3FMGL 4MAYC 3W9EA 4X80L 4U1SA 1EHAA 4HQQH 3H7BA 3IJSB 5CGYD 5DJ0A 5FYLD 5E8DH 2J8HA 3MCLH 2EIDA 1KTLA 5EOTA 4XNYH 2XWJA 2QQKL 1U3HD 2Z35A 4L4TE 4IMLB 4ZUUB 1DSFL 1WICA 2O5YL 5IVXE 5K9JL 4F3FA 2EEBA 4Q6YA 1QPPA 2ITDB 2W0FA 3RDTC 4JRXB 3HI6L 4WEBL 5F7MC 4M7ZB 2XQBL 3EGSA 3GHEL 4O02L 1TCRB 4GQ9H 1N4XH 5C0BD 1Z3GL 4KQ3L 1E27A 3WFCL 4JZOB 2NW3A 4JB9L 4FZ8H 2J6EH 3GJFA 2YD9A 1ACZA 1BREA 4P2CG 1N59B 2AV1B 5EU7E 4WWKB 3TFKC 4JREC 1JNNL 4ODVL 1EAJA 1MLCA 3G6AB 3SBWC 3U4BL 3HB3D 3EYVA 1CFSA 1JTTA 1CK0L 3O3EA 4N8VB 4I0KA 1NFDB 2ZG2A 4XNMA 3CSGA 3UP1A 3G6DL 2VZUA 3QUYC 3BIKA 5F72S 2LU3A 5CEZL 2EDTA 2WBJB 2NXZC 3QYCA 2DQFB 1TETL 3NACL 3ZE1E 3OJDB 4CN6A 2EDBA 2FEEL 1WTLA 2JB6A 5I30L 3IS0X 3ARTA 4HIHA 5C0RH 5CD3B 3S4SG 2VXUL 3HC0B 3FQUA 1I85A 2J8OA 2WIIA 4HCRL 4YO0B 4IOFD 1OAXH 1AFVL 1R5IB 2A38A 2AV7B 1KT2B 1KEML 2NZ9D 3KNBB 4K3EH 3WS6A 3KPRA 4LEXH 1IJ9A 1Z9SA 3ULVH 1KJ2B 1FL3A 4L8CB 4ORGA 4WFED 4XNQB 4JZNB 4N0RA 1Q0XL 4UT7L 4NHCL 5IW6B 1IAKA 9CGTA 5I1EH 5HDLA 5FA3A 5LXGL 4BQ6A 1S78C 4M1DL 1MRDH 5EWIH 1NL0L 2XPGB 3VRLF 1I4FB 3E6HB 5FGBA 3FQXB 2OLDA 4X6FB 1KXVC 2R29H 4LSRH 2DB8A 1DQTA 1AI1L 5FOBA 4PGEB 1FE8L 3VFRA 4HV8A 3QO1A 1YMMB 2Q76A 2AQ1A 3BD4A 3STBA 2YEZA 1QOKA 3P30L 1IGJA 2GY7B 2UWEE 1HXYA 4H20L 4MA1C 4ISVA 4YHMH 3CDYA 3O2DA 3C60D 5D7IA 3EDFA 3G9VA 2F9BT 4W6WB 3W0WA 5FCUH 1SJEA 4GAJH 3O41B 3VA6A 3NFSH 1IM9D 2P8LB 4MNGB 3QXAA 5EZOH 5EC1B 1OCWH 2ENSA 4TRPL 5ESAB 1TVHB 2UV3A 4NCC1 3EO0B 1T66C 4HDIA 2HT3C 3WCYA 1PYWB 3VMOA 1YEDB 1DBML 4DN4L 1LE9B 3ALXA 3IYLW 3DV6A 3OB0K 1QO3A 3WJJC 5CEXA 1FVDA 5IOPA 5JW3L 3NZHL 3UX9B 1JF1A 1KNOA 4PV9A 1A6UL 4QXTB 2OJEB 4M6AA 1NBVH 1UZ6F 4G8IB 1MREH 3PGCB 4AK1A 2Y7QB 4EOWH 4IOIA 1FH5H 4RA0C 1S5HA 4KRPB 1MSPA 4OSUL 4DUXA 1SY6L 3KPMA 4PJEE 5J1TC 4NN7C 3BVNB 2D7OA 4HIIB 1YEKH 2AAVA 2W38A 5T1DH 4RFOL 2ZWLT 2H1PL 1U8NB 1I8MA 3QIBA 4MX7A 4RDQF 5BZDB 1ZT1B 3B9VA 1QLEH 5I1JL 4DQOL 3SGJA 4KHTH 2DQCH 3EBAA 3V79C 1A0QH 1P4LB 4P3DB 4PY7B 2FNBA 4XAWH 4Y5YA 4J3XA 3O4OB 1FLTX 3I2CL 4U31A 2QKIB 4MQSB 4Y4KC 3I50L 3VFPA 5GRVL 3O8XA 5BS0D 1VADA 1YNLH 2AJ3B 3QISA 4YXHH 3QIWD 3QI9A 1XR9B 1MLBA 2Z0BA 4NSKA 1FYTD 4PLOB 1ADQH 2P5WD 4U4BA 3ZDZF 3SE9H 3FCTA 3DETD 3FRUB 1BVKB 3MLUL 2V2TB 1CGSH 2F74B 1FZKA 3BGMB 3HMXL 1IQWH 3TO4A 4LF3B 4GT7A 4C59B 2I07B 5TJWK 3FTGA 3LRSA 3MRGB 4HH9B 2D31A 4PJIE 2DAVA 3MACH 4YHOL 5EBWA 5FYLH 3OJ2C 5EIVA 1FV1B 2FLBT 4MWFB 4HKXA 3C6SA 3FT2B 1BQLH 4YPJA 4DKEL 3TBTB 2XXCB 3WIHA 4BH8A 1KEGH 3MA9H 4UV4L 3KLHC 3QXDB 1HHJA 4G5ZH 3QZWG 4ONHA 4JGUA 1H3UA 2FX7H 3HZMA 3X17A 4CUCA 4PLJD 1JZ2A 1CIDA 2WP3O 4OUOA 3FQWB 4OBSA 4PJ5E 5FO9B 2YPLA 3JWDL 4YDVB 5D5ME 5C6WH 3MODL 2C3WA 1KELH 3LDBB 4LMQE 3VXSA 3H9SE 3N1GC 2F53B 1OPGL 2IANB 4Q2ZA 5HHXL 3UYPA 5E6ZA 2FL5B 4X6DA 2CK0L 3B9KD 5J57B 5I1HH 4JDVA 4QT5A 1IFHL 2R2HA 3MTRA 2VOTA 4YC2B 3HMWL 1FNGA 4YXKH 1RIHH 2YUZA 2I9LA 4P2RB 1WVZA 5E2UH 4MA3B 1HDMB 3KS0J 3OHXB 4HK3N 4YDLC 3VFUA 4Y2DB 3IFPB 3IDXL 1NAKH 4ZO6A 3VWJD 4XWGL 2VLKB 5KTEH 4AJ0A 4Y16A 1X44A 1HSBB 5HDQL 3TBYB 2ID5A 2GK0B 3ZKQD 4CNIA 5D2LA 1BD2D 3PQYE 1I1RA 1WFNA 3ZYOA 2VIRA 1RZKL 4PJXA 4R26L 2J8UA 3RY5A 4D94A 5HHNB 4QHLB 1BX2A 5KG9B 4IDLA 5FGCB 4M4RA 1QFPA 3P11L 4GRMB 3OXSA 1DQJB 1QNZL 3HS0A 4K9EH 4V2CB 5HI4D 2VAAA 4JRYD 5IB5A 3LN4A 3AXLB 1ROWA 1W0YT 3BD3A 4UINH 3CFJA 1IZKA 3HUJF 3CDFA 1D5XA 3D0VA 3LEXB 3VGEA 3MBEA 5BVPL 3INUL 2W9DH 5FYKL 3RTQD 3VJ6B 1VHPA 1QBBA 3MGTA 3PG2A 3H0TA 2X1OA 2DL9A 5E56A 3VXNA 4YFEA 3FFCA 3RWCA 1I8LC 1T1YB 4YBLC 4X6CA 4YHZL 2GK2A 2DMCA 3ZHLA 4HX1B 2VXQH 5C0BB 3RJQB 2ICWB 1OF2B 1JFQH 4E9LA 1IKFL 1NKRA 4OLZH 1CXHA 2VDPH 3AS3A 4LVHC 2Z8RA 4EBQH 2FJFB 3GNMH 1B0RA 3G6JA 3HG1D 3SDAB 1RHHA 2B7DT 1T5WB 3PIQA 1MH5B 3CSYA 4NRZA 1RFDH 3UZQA 3RU8H 5A2FA 1MEXH 2BNUA 2I24N 3FO1A 2XY1A 5EBMB 3K4AA 4G43A 1J1XH 4U1JA 4PY8J 2SEBB 1PLGL 3TCLA 2W65B 1MWAH 4LPUA 4I2XE 1WBZA 5D2NC 3CMGA 1PKQA 1FC2D 5HGHB 2HVKB 3WDIA 1EDQA 3EZ8A 3NN8B 3TZVA 3NZ8B 3RGVC 3TM6A 4M43L 3L3DA 3QQ4B 3GSNL 3ARDA 2UY6A 2YK1H 5TDPB 3STLB 3GMLA 4YAQB 4F33A 4Z7UA 1W0VB 1YN6B 4OCRH 1LO0H 5K93A 1XGUA 1VGKB 4OZHF 2FSEB 4R97B 1A3RH 3F12B 4PJDF 2DIJA 5DZNA 4MNQE 4BSJA 1A2YB 3SGKA 2ZUUA 1QSEA 5TF1L 3HNVH 1EEZA 4GRWH 2DLTA 1EIBA 2B4CL 4EDXB 1PDKA 4XCYB 1C16B 3RZCD 5DMIL 3DX8B 3UTSA 2DJ4A 2WUCL 1P4BL 5TE6H 1IGIH 3V6OA 4QNPE 3BMWA 3CFCL 4X7TB 1CVRA 3QDGB 4WI8A 2GSGA 3C5ZA 2X10A 1F00I 3CX2A 3WNKA 2A1WH 4NKDA 3QNZB 2C3XA 3SOBL 3QWQB 3QFDB 3AM8A 2X4SB 3U0PA 4L3CB 3O3UN 4KRNA 2YXFA 3FB7A 5L9DH 3BZ4A 1A02N 1LE5A 3M8OL 5FEBA 2BMKB 4ZQKA 1AJ7H 3TH4T 1HHKA 1VSCA 3PHOA 4P46B 3VI3F 5GRZA 3V5HB 5BMFH 2HMID 4NJAL 1UQSA 5BW7A 1LEKB 3Q1SH 4FOMA 2NX5A 4QHKJ 1JNJA 4FQPA 4TPRL 4LMQI 1EUTA 1KCUH 4DKAA 1MCEA 4MXVE 4A6YL 1TZHB 1H0DA 4C56D 2IH3B 4B53A 5JOFB 1YYLL 2DLFL 4PP2A 2ZCHH 3P4LA 5D71L 3B2UD 1YY9D 3CLFL 4PLNC 4KK9D 3G5VB 1KLGB 1MJUL 5DRNB 3NH7L 5C2BL 1MCRA 4XPBH 1RULL 4LSPH 3X14A 3QNXA 4YFDB 3UEZA 2MQ0A 3IGAA 5EOCL 1INDH 1ZTXL 1HIMH 4HC1H 4G8GB 4N0UA 4QHNB 3U9PL 3BE1H 5I73B 3MJGX 5CSZA 5MEPA 2HFEA 4XRCB 4PJBB 5GXBB 3QULB 4QHUB 4KKBD 4P4KA 1PJ9A 4RAHA 4GS7C 1JGDA 2ADIA 3ARZA 4KTDL 2GUOA 1KJMB 1FL6A 4JY4A 5D9SB 4URTB 2P46B 4E41E 2X4RB 1FBIL 3ILQC 2B1AH 4KKLD 2P5WB 3EOBB 3V4VL 2X4PB 1OWRM 5D93B 5K9OA 4F7CA 2CR6A 3QFJD 2HKHH 4ZNEE 5FOJA 2BRQA 4UDTB 2BK8A 4FABH 4RGNC 4JANA 3WKML 3MA7A 3DO3A 3GGWB 1YN7B 3DI2B 2FRGP 4WO4A 1U58A 3KPOA 1Q94A 1TPXB 4FQLH 4J1UB 1S7RB 1NQBA 1FO0B 1E4JA 1WCBB 5HHQB 1EJOH 4Z95H 1VKXB 1ZMYA 4WUUD 3THMH 5AG9A 4DTGL 3CMOL 2X4QB 4EVNB 1IGMH 2KQNA 3KYKH 4NQXB 1NAMH 4OTXH 3VH8A 5F1IA 4JFFB 4YHYB 1R3KA 1DL7H 4MAUL 2R1XA 5HVFB 4WU7B 5DJDB 2R0WH 2GSIA 5JIPA 4ODXA 4ZFGL 2DQHL 3VWKA 3E6FB 4POUB 4M7JL 4R3SA 1ZLVK 2IEPA 3B9KB 3LB6D 5C6TH 4YIQA 4HXAL 4Z7VE 1QACA 1G7JA 4KZEH 1H15B 3I84A 2AXJA 1J5OL 5DA4A 5CEZD 2FGWH 1Q9WB 3U0TB 1WSST 1RSFA 1NDGB 4NO0D 3MLTB 3UTQA 5C0AA 2Z8SA 3FONB 1MCQA 3PL6C 5JQ6H 1JUFA 3SY0A 3RKDD 5JXEA 3C6LD 4G6FD 2JELH 4G80B 4HUNB 4L9LA 3K2UH 2CKNA 3LD8B 3VWJB 1OW0A 4IRZH 4O58H 5E9DA 4NBXB 3MV9A 2ZSVB 1KLFA 4PFEA 1BD2B 1QEWB 2VZTA 4HD9A 4LLWB 3OB0H 1OGAE 2VDKL 2VXTL 3EAKA 4TSBL 1R5VB 1NBYA 1X5HA 1OSZB 4MZ2A 2FX8H 3FOMA 1I1YA 4S1RL 1DVFA 4Y1AA 4CVWA 1MFCL 3ZDXE 1UKTA 1ZANH 5K33A 5F1KC 5I8EA 1X5FA 1HKFA 2OI9C 1NCBL 1B0GA 3HR6A 4JN1L 1GOHA 1NGYB 3OZ9L 5T3ZD 1XF2B 4QOKE 2EXYD 1HI6A 3KYMB 4WHTB 1BZ9B 2O5ZH 5L2KA 2NTFB 5CGMA 3OKMB 1PSKH 3MJ9H 4PREB 4HFUL 4J12A 5DR5H 4M1GH 4AIZA 5GRJL 3SCMA 5F3BB 1QVOA 1CE1L 3ARGD 5CKAA 4ZUVA 3EO9L 4QHMB 3EYFB 4QRTB 2F58H 1LEIA 1S7UA 4JQXA 3HI5H 1IMHC 2GJ6E 2DKUA 3O9WA 5IW3A 3RY4A 1Q38A 4GRLC 3W39A 2OTWA 3QEQE 4LLVB 5I16A 4JHBA 2GCYA 5JORB 1R24B 2IFGA 2E8ZA 3BH9A 4LGPB 4LHUA 1TQCB 2VKWA 4WHYG 1EPFA 4NCDA 4GLRI 4B5EA 1CLZL 2DTMH 3V0AC 4HS3A 4UMGA 5IQ7L 3K3QA 2DQDH 2XTJC 3WFBH 4Z77A 5ILTH 4JDTH 1OL0A 2XN9D 2G5BB 3TA3C 2AJZB 4ZSOB 5CJQH 1OY3B 2IQ9L 3U6RA 4V1DE 5E00A 2AK4B 3LQAH 4OZFG 1DBKH 5FUZH 2Y4SA 3OG6B 1IL1B 4WW2C 3RVUD 2E9WA 4M93C 5DQDL 2R4RH 2RHEA 4GAGH 2X6MA 1XCQB 2HFTA 4PJCE 5E8NB 2X09A 3HPLB 4WU5A 1FNLA 1H3GA 1AXSA 1RJYB 4DCQB 4CMMA 3R0MA 2Z31B 1PG7W 3DXAE 4NJ9H 3TH2T 3O2WL 5KVEL 3DGCR 1JPFA 1LD9B 1NGZB 1S7WA 5E1AA 4DZBB 2IQAA 4Y7MA 3ZKNC 3OMZA 2ILLA 4YX2L 2CDGB 4X6BA 4KUCD 3WSQH 2J7LA 3QRGL 1QRND 1CG9B 3HAEA 1QR1B 2DQUL 4YHPA 5FO8A 4L3ED 1P2CB 1ACYL 3QJHB 1F8TH 4MCYA 1KG0A 1IM3B 4MVBD 4Q9RH 2NY5C 3RVTC 1C12A 4JO1L 1LO3H 1CFNA 2GIYA 1I1CA 4QXUL 2VABA 5EO1B 1T1WB 3QUMB 5E08L 4FQ2H 3FL7A 4PRDB 3L3HA 1A7RL 3TBSB 4N68A 2HFFA 1RZ7L 4U6XB 2JJTA 3KPLA 4OAWA 3NIDF 5IGXH 2R0ZL 1F4AA 1ZA3B 3B9AA 4MYWB 1CF8L 3FMGH 4QRPE 4X80H 4O5LL 4X8JB 1ZK9A 2JCCE 1KJVA 4XCEB 5D2LF 5CLTA 3WHXB 1IAIL 2O5YH 2XZQL 5K9JH 3B8YA 4YK4B 2VWEC 3MO1B 1MFEH 4PJXF 1QLFA 2J8UF 4JQVA 4WRLA 5ALBL 4WEBH 1U3YA 2VDML 5FKPA 4O02H 4LNRB 4GW5A 4JPWH 4OFYD 4HUWA 3KPNA 2B1HL 4HS6A 3OXRA 1U8IB 3BH8B 5FECB 4JFQA 1JNNH 4ODVH 1HHGA 1WT5C 3I3DA 1AGFB 1IZJA 3RVWC 4JJ5A 1CK0H 4AZ8A 3BP5A 4E5XA 5IIEA 4PRPD 4JZJA 1Y0LA 3G6DH 4WFFE 5TE7L 5D1ZD 5GGQL 1YUHB 2AJVL 3KJ4B 1TETH 3NACH 1B88A 4QF1B 3S37L 5ICYB 4D8PA 3S98A 5T1LA 4X6CF 3OGCA 2VXUH 4O9HH 4QRSA 1MCOL 1M4KA 4HCRH 3BEWA 5MP6L 1AFVH 4IRJB 1CLYH 1MPAL 1QBLL 1KEMH 4KJYA 1OQOA 3H6JA 3EJJX 3MRBA 2LTQB 4HKZA 4L4TA 1DP0A 5IVXA 5FUCE 3CXDL 1O0VA 3G6JF 4KUZH 5DJCB 1Q0XH 4UT7H 4NHCH 3AY4A 1UH3A 4PV8B 5D1XA 2J2ZA 4YPGB 5LXGH 4QRUB 4MDIA 2EE9A 2VLLB 3RUGE 5MEOA 4M1DH 4HFWA 1J8HB 4ZUSB 4Y4HB 3O3DA 5AD0B 3JZ7A 4X4YA 2ERJB 2VN7A 2EH7L 5I8CB 4NZDA 4JM2A 1W72H 2F54D 3QR2A 1AI1H 1OAZL 5DUPL 5DHVH 2L4OA 4ZPVA 4RDQG 4OZGE 5F21B 5T3ZH 3SDDD 4XGZA 3QFJB 2RBLA 2R0LL 1R3HB 1FGNH 3P30H 1BBJA 3N1FC 4BUHA 3K8KA 4NC1E 4Z0BL 5CBEA 1ZGLB 4JFDD 3FFDB 1EEUA 4J23A 3TBWA 1B6DA 2EIEA 3ARRA 5FYKD 3P4MA 3EYUH 5HHMD 4F7MA 3NPSB 4Z7UF 4HMDA 3VG9B 1G9ML 1FG9C 2EIZB 3F8UB 3IRZA 1X7QA 4M9OA 1JYNA 1UWGL 4TRPH 1Q9LA 4PGBB 1UB6A 1JPGB 3VXMD 2EDWA 2QADD 1G0DA 4WUUB 2XQYG 3I6GB 2Q3ZA 2G2RB 1DBMH 4DN4H 4XPFL 4K94C 1U8PA 4LAJH 3QXVA 1CICA 1BWMA 3NA4A 4HWBL 3UBXB 1PZUB 4Y19D 5DJYB 5EUOE 3A6BL 4Z78B 5JW3H 5CHNB 3QUXA 1DQQA 4LIQH 2PXYC 4X7SL 4XPAL 4PJFE 1A6UH 5C9KA 3U9UB 1RZJH 3DVGA 4NKMA 1DQLL 4UDUB 5E6ID 5DK2A 4RAVA 1U91B 4ZFZA 3JV0A 5IHBA 2YBRA 3GIVA 4R4BA 4FRWA 3NCBB 2EC9U 1G6RA 4OSUH 1SY6H 3BWUC 5DDHB 4QGTA 5E94A 5EZJA 1ZVHA 4NO0B 4WFEE 2CD0A 1B4RA 1LP9A 4LLMB 3QG6B 4RFOH 1I3RB 4HJGA 4HG4J 5D96B 1PZ5B 4N5EC 5J7CC 2UWEA 4BFIA 3BIAX 4XHJD 2Y72A 4NNYB 4S10A 2VUOA 1NGXA 5I1JH 3RX8A 4DQOH 4F7PB 1KPRA 5HYSB 3P0YL 4F15C 2VZ1A 12E8L 4YEEA 1JPTH 1U8OA 4GKSA 4YLQT 1FG2A 2WBWB 4EI5B 1JMXA 1YY8B 5IK3B 3I50H 5C0FB 4ODBD 4ZAKC 3UMTA 5HGGS 4GG8B 2CLRA 1I9JH 4P5MA 5E5MA 5AAWA 5IB3B 4M3KB 3T0EC 3MLUH 4KV5E 4ZUWA 3NCJL 1LEGA 2VE6A 4BKLB 5IW1A 2FJHA 5CINL 3DX7A 5JW4N 2EC9T 4P2QB 1F02I 3TESA 2HT4C 1E4XI 2YXMA 2EDJA 3NFPB 1R6VA 1F45A 1QFOA 2FO4A 2DDQH 4YHOH 5EOQL 3QUZD 2OYPA 1YPZF 1LNUA 1OWWA 5F1OB 4YHIB 3MLWH 4HBCL 3ARGB 4KROB 5AUMB 3F7YA 4PJEA 2DQIL 3ETBF 5L8JB 3DURB 3VXQA 3T1FB 4LSTL 1A3QA 3VFOB 5I17B 1U8MA 3DECA 3P3YA 4R9HA 4RBPK 2ARJA 1NFIB 3RWHB 3WUZA 3MNWB 4YDJB 1J1OL 2E6JA 4F58H 4LLDA 5GRUL 5K9QG 4Y5VA 1TZIB 2DBLL 3JXAA 2G9HB 5F6HI 3O6FA 5HHXH 2ZG1A 5GGVY 1FNEB 4RMTA 5ITFB 1MF2L 4G6AC 2V7NB 1IT9L 1OLLA 4Y5XB 5DQJB 5C07D 5AAMA 2CKBA 4P5TA 2XV6B 2XXMB 3IRPX 4NHUA 1IFHH 4MS8D 2LE9A 3R06A 4H1LA 3OSKA 1VFMA 3HE7B 4ZXBD 3TVMD 3VFVB 2BSED 3HMWH 2IBZY 2FJGB 4YDIH 3TBVB 5DFVD 3K74B 3FO2B 4JFED 5TPWL 5KSBB 3AROA 4WNQB 1JPSL 5H94A 3VFMB 3IXTA 3N50A 1FFPB 4HLZH 1IARB 1T1XB 4KDWA 1P7KA 4WUKL 5I1AA 3F65A 3M17B 2Y5EA 4PJIA 4WV1C 5BS0E 1RU9L 2HTKC 4XWGH 3DUUB 1KGCD 3MNVB 5IHUL 2J5LC 1FYTE 5B38G 5DEFA 2APWA 5D1QB 5C0CD 3PNWB 5F9OL 5HDQH 1MUJA 5AWNL 3VDAA 1XF3A 3S35L 4AEFA 5EUKB 3CDGB 2CDFA 5BVJB 1CD0A 4GBXB 4M5ZL 4JLRA 3T8XA 1Q9OB 2BC4B 5IFAL 4ETYA 3PWVB 3CFBB 4LSSL 3R8QA 5H2BB 1RZKH 4TVPL 4GRWE 4WI9A 5GGRA 5BXFB 4R26H 3HE6B 5T1MA 3BT2H 3VFTB 4PJ5A 2ZUQB 3O4LD 1Z9MA 4GW1A 1JHLL 3B6SA 3JTTB 1F11A 5D5MA 2CSPA 1QNZH 4J3UA 1VEMA 3H9SA 1D9KB 2EKJA 3S4SB 3RWDB 3BO8B 2MJWA 3CH1B 1S7SA 1C7TA 2AABL 3L3KB 4HK0B 3RWJB 4RFEB 5K9KA 3D25A 1GCFA 2VUYA 4IBLT 3P0GB 4OCWL 1HCFX 4FP8H 5AYQA 2MQCA 4PG9A 4HLJA 3Q3GA 1MRCL 3INUH 4KC3B 4X6EB 4UNUA 5IMLA 1LO2L 5FYKH 1WIOA 1M7DB 2N7BA 1L7TH 4X5XB 1ZLWH 5SWSD 4GXVL 5CSGA 4AM0A 3VRIA 1I85C 3LEYL 2NXYB 1RMFL 1JNHA 3BKJL 1F3DJ 1O7SA 2PO6D 4RCAA 3JVGC 4K71B 4LOUD 4YHZH 3WS6C 2BSRB 1RJLA 1CQKA 4KMQA 2OZ4A 4PYHA 5B39A 4FXGA 1JYVA 1IKFH 4OT1L 3FJTA 3U4AA 5IVNA 1SJHB 2Q8AL 3RWGA 2DS4A 1IC1A 6FABL 4ONFL 1MFDL 1T04A 1K2DA 4H8WC 2D7QA 5BRZB 1BWWA 3PQYA 4UB0L 3BPCA 4ZS7H 2G75B 2FZ3B 4CBPA 5IJKC 4RIRB 4CDGC 2VITA 2ADGB 3NGBB 4P5KB 4PRPB 5DWUH 3MXWL 1WK0A 1CIUA 4IRSA 1F4WL 1D3CA 1WWAX 3FZUC 1KFAL 4D0BA 3G08A 5I1DA 3ZTNH 4ODSL 4MAYB 4U6YB 3SKOB 1M7XA 4KK6D 1TQBC 1BD2E 2OMBA 4OGYL 2A9NL 5T3XL 2JK5A 1PLGH 3MOQA 3AC0A 3NTCH 4XB7A 1JWSA 1INEL 5JXAH 4S0SD 1P1ZB 3GUTB 4GOSA 4FQHA 1VFAB 3FT4A 1G7HB 4X4XA 3IDYC 3QG7L 1WC7B 2QSVA 4M43H 3O0RH 4HJ0C 3GSNH 4XCNB 5ITBL 4JRYE 1MHPL 4K94L 3GSXB 1Z6JT 3E8UL 1YMHA 3K4DA 3MRDA 5BOPA 5J1AB 4RISL 3L7FB 4JREB 4EI6B 5BQ7B 1TXKA 5MEND 5DFWH 4Z7WB 4K7PX 4NFBA 1JGUL 4P23A 1KN2L 4FG6C 1FFOA 4NZRL 1JK8A 5DD1H 3QXUA 5ICXB 1BFOB 4K8RC 4P57B 1E6JL 3QUYB 1OM3L 4D9RE 3O6KH 4HKJB 2NXZB 4H0IA 5TF1H 3SDDB 5D6CA 2APXA 1L0XA 2B4CH 1QHOA 3PHQB 3UJJL 5C0EB 2C1PB 3PDOA 4XX1G 4NQCD 4AIOA 3QT2A 4JFDB 1NCWL 2WUCH 1P4BH 5EC2B 4JM4L 4NP4L 4CW1A 1CD1A 3CFCH 4IS6A 2QL1A 4EN3A 1SQ2N 5HHMB 3HRZA 2A74B 4QRQA 2BVQA 2ED8A 5DJAA 5EU6A 2X4OA 1NEZA 4TSAL 4X0KB 2H26A 2OL3L 3SOBH 1LK2A 4IIQC 3HG1E 4IMKA 2E7BA 4P4RA 3ROOB 2K9UA 2QADB 4I2XA 5DMGD 3L5WB 43CAB 3IU4H 1CL7L 5D7JD 3RP1A 3MRNA 1O7VA 3M8OH 5DEGA 4CN4A 4DVBB 4X5WB 1RURH 3UPRB 5I6XC 4Y5YC 3GB7A 5CWSA 1FIEA 4Y19B 5EDXA 1KXTB 1VACB 3GRWA 2W1NA 2CO6B 4OCYL 4XI5D 3EOTL 4P2OA 1PY9A 3O8XC 5C0ND 3UDWA 3MJ6A 4NJAH 4WI2A 4NFCA 5CZXD 3VXRA 5B8CC 5GS0L 1A6AB 4X83A 4TPRH 5E6IB 3S7GA 3LN9A 5JZ7D 4FA8A 1YEIL 1UM5L 3QUKA 3DVNB 1YYLH 2DLFH 5E8PA 1LO5A 3TO4C 4MA1B 2IF7A 4MNQA 3GSWB 3QZWB 4M6OH 2A6JB 4J3SA 4PD4J 1QLRA 3CLFH 2VLRD 3CVHA 1MNUH 4PJ8C 4FQXA 1MJUH 4OLVH 4LCYB 2W59A 3NH7H 5C2BH 1X5JA 4PJGE 1RULH 2PNDA 3K46A 3L3IA 2C3VB 4HGWA 3ARUA 1BIIA 4U0RB 3U9PH 2VL5A 3BZFB 3ZZ1A 1YEFL 1CXFA 4OFKA 2O61B 1U42A 2BOBB 2Z9TA 5DRXA 3GSNB 5IROA 1OLZA 4PRID 4R7DB 4I3SL 1X5KA 4IJ3B 4CU7A 5JHDB 4MNHA 5INDA 2C7UB 4NM8H 2FYYA 4U1IA 4TN9A 3REVA 3CAFA 1FBIH 3QSKB 1UT9A 4PRHB 3L5IA 1XZ0B 1ZT7A 2HKFL 5DJ2B 3OKKA 8FABA 4JDZB 2VLJD 3PWNB 3V4VH 1KLUA 4APQA 3W82A 4S2SB 1UJ3A 5C9JB 5IQ9A 3N1QC 3VA2C 3BP6A 4C58B 4MMZC 3SQOH 4OD3L 4NN7B 3DOSA 3UZEA 1E6OH 1QSFD 4S0TD 4B7LA 1MCPL 2C1OA 2H9GA 1ES0B 4Z5RB 5D7LB 3IAQA 4PJAB 1SMAA 2RGSA 4LVEA 4PLKC 2ICEA 4P2YA 5ADPH 1SJVA 3PJSA 1P4IL 1L7IL 3BFOA 4LKCA 3PXJA 3DYOA 3MJ7B 1GIGL 2D4FA 5C09E 1J0JA 1X5IA 4JPVL 5BZWA 4EUPA 5HHPB 2NY6C 4M7KL 4Y16C 2DOCA 4DTGH 3KPPB 2XKNA 5FYJU 4C56E 4NQEB 4Y4KB 2DI9A 1IEBA 1M6OB 4OIIH 2X1XR 3S34L 3WFHB 4LCWD 3CX5K 4MAUH 4XMPL 3Q48A 3L5XL 1DLFL 1IGFL 2YPKB 2FIKB 1XGTB 2IFFL 3GIZL 3LKSB 1UXSB 4NBYB 1MCNA 1N5YL 1I8IA 4M7JH 1MCCA 4FXKB 4PJ9D 1F13A 1T5XA 3BSZH 4ONOA 4HXAH 4E41A 4IHOB 2HG5B 1J1PH 4GAYA 3IJSA 4A6YB 3LH2L 4LVOC 1J5OH 1JVKA 4JFEB 3NVQA 2XTJE 4ZUUA 3IFOA 2ICCA 3CU7A 4FQIL 2EDFA 2Z91A 2ITDA 2ZCLL 5EFIA 2OR8A 1M1SA 5D6DC 4PR5B 3MBEC 5I0DA 4ZNEA 4HJJH 1QQDB 2Y36L 3AUVA 1R3JA 3QQ9D 3TO2A 1UACL 2Q7NA 5D4QA 3TN0C 1CE6A 5TQ0L 1UZ6E 2AV1A 1IAOB 3KJ6L 5F7EH 3S35X 4JG1L 3R1GL 3MOAL 4QY8B 2J3SA 3G6AA 4FNLL 1G9EA 3KXFE 3WN5A 3MRHB 2P43B 5JW4Q 1ZVSA 1AC6A 3O11B 4JFOA 4R7NA 2P7TB 4WJ5B 2VXTH 4TSBH 5IJVB 3HNSH 3JV6B 4KAQH 5JMOC 1CBVH 2A77L 1HILB 4S1RH 3W5NA 2AERT 1KUMA 1MFCH 2HJKA 1DANT 3DLQR 5DT1L 1LP9F 1C5BL 5A2IH 2Z92A 3DMMD 1D7FA 1FNSH 5DMYA 4G9FD 4XNUL 3WLWD 2DLGA 1BEYH 2WINB 2E7LC 4OFVA 2BFVL 5D70L 4YDLB 4Z7VA 3KNBA 1T6WA 4X7EC 4HFUH 4WVRA 1GL4B 3RVXC 5GRJH 3BQUD 1AKJA 2V7HB 2MPAL 1DTUA 5EZLA 1NGWB 5I74C 3SGEH 1K9TA 1OAKH 1KB5H 4JKMA 1XAUA 3ZTJG 3OKEA 3ZDZE 1UYWL 1ZHNB 3TZVC 1I4FA 4RX4A 3ARDC 3MMEB 4J8RA 1GXEA 5IMKA 3PWJB 5GJTL 5J9PA 2AJSL 4P9HL 1BOGB 5IQ7H 2Z4QA 5F89B 4RMSA 5HHOD 3T0DA 1XEDA 2VQ1B 4Q74A 1OGAA 3G04B 3QHZL 1XIWA 1A9BA 4XMKH 3IFLL 1D5ZA 2QEJA 2VL4A 4PJEF 2R2BB 1DUYB 1NANH 3SGKC 3CD4A 5DQDH 2EDKA 2MOVA 4PRBA 1YEHL 3VXPB 2KBGA 4LCIL 4JR9L 3IJHB 5EC1A 4QOKA 3QCUH 4MGXA 1RK1A 2R9HD 4KKNA 2HLAB 5MI0C 1NC2B 3O2WH 2XFXA 1PYWA 4FFZH 4MDJB 3V6OC 4TTDD 4YBLB 1SYSB 2IH1B 4YX2H 4LARH 2YMXH 5DTFA 2NNAA 4RBPH 2J6EA 4JVUA 3QRGH 1XF4A 3BPLC 3DI3B 3FHAA 4MD0A 3AM8C 2DBJA 2Q6WA 5EPMB 2GJ6A 3P73A 4ZFOL 1ACYH 3CLEL 1AR1D 3N06B 2EKSB 2BOCB 5T3ZE 5J3HD 3WO4C 5DVMA 4JFYB 4JO1H 3QEQA 4LVHB 1IEAA 4UUJB 1SEBB 2Q3AA 4ZODA 2BNQB 1ZGLM 3RDTA 3RWFA 3D85B 5DC0A 1XGQA 2X89A 3ARFD 1A7RH 5ESQB 1RZ7H 5BW7C 1ZEAL 5F7UA 1P7QB 2R0ZH 4PJIF 3KPQB 4ETQA 3MYJB 4V1DA 2AXGB 15C8H 1CF8H 4S1DC 4NQCB 4HH8A 3SBWA 3CPLA 3EJZC 3NIFF 4NC2B 3WXVL 4NZUL 5D2NB 1EMTL 4PJCA 1IAIH 2ZJSH 3CUPA 4PTUA 3MRPB 2XZQH 5J11B 2D0FA 1A6PA 5TDOA 3WIHL 4LIQE 3QDME 3RGVB 3OL2A 2XN9E 3DXAA 2HT2C 2YPVH 2VDMH 1Y6KR 4L5FL 4U49A 5D7JB 5D5MF 1XR9A 2C4XA 3U36A 3ROLA 1I1AD 5I15L 4BH7A 5IBTL 2B1HH 1I7UB 3ARED 5FGRA 2B2XL 4UQ3B 3FRUA 3V6FB 3O45B 3VXUD 3DX9B 4P4KC 5HYJB 1MJ8H 2WBKA 4CJ1A 4PJ7B 5TDNA 1U3JA 2BDNL 3X11A 5DUBA 1F58H 2O93L 3ECBA 8CGTA 3W2DL 1NCDL 4X5LA 1J11A 1ZWIB 4OF5A 1RHFA 4NFDA 5TE7H 4NZTL 5FF6A 1ZAGA 2VSCA 4DUWA 4HW6A 2MCPH 5JO5B 3QB7C 4NNXB 1QRNE 3S37H 3TBTA 1PY4A 1ERNA 4L3EE 2VLRB 2DLEA 3ZT7A 4UIMA 5DVLA 1MCOH 1I1FB 1HXMA 5A16A 5EBLB 3REWB 5MP6H 2MHAA 2IMNA 4H5SB 1MPAH 4M1CC 2VZ3A 4WO4C 1XGPB 3EOAB 3S3SA 1FZMA 2H2SC 2IAMC 2JCCA 4UILL 5DJ6A 3N0PB 2VXSL 3BWAB 3EYQC 1A64A 3MR9A 1L6ZA 2PTUA 5HY9B 2KH2B 3CXDH 5EIQA 5FFLA 2DQGL 1II4E 3FO9B 3MCKA 4PTTB 3CK0L 3I3EA 4D0CA 1SYVB 4I4WB 4TVPD 1I8KB 5CIPB 3MRJB 5F9JB 4U33A 3SDCD 2A6DB 2EH7H 3U2SA 3CC5A 2C26A 4MJIE 1OAZH 2VLJB 2PYEE