1INEH

How the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
213
structure length
213
Chain Sequence
EVTLVESGGDSVKPGGSLKLSCAASGFTLSGETMSWVRQTPEKRLEWVATTLSGGGFTFYSASVKGRFTISRDNAQNNLYLQLNSLRSEDTALYFCASHRFVHWGHGTLVTVSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLESDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How the anti-(metal chelate) antibody CHA255 is specific for the metal ion of its antigen: X-ray structures for two Fab'/hapten complexes with different metals in the chelate.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IGG1-LAMBDA CHA255 FAB (LIGHT CHAIN)
total genus 42
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 1993-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ineH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ineH01
1NEZG 4LCIL 3EFFA 1GGCL 1LP9B 1D9KC 2VQUA 5DJYA 3VG9C 2MCPH 3D6GA 3FO9A 4G3YL 2VJXA 4FTVA 1IGFL 8FABB 3L7FA 5EZOL 4LOUD 1Q0YH 2NXZB 3BQUC 1K4CB 3P4LA 2MQCA 4RX4A 4O2FB 1WC7A 3UPAA 4Y5YB 1CXHA 4ZUWB 4I9WE 3SKOA 3E6HA 1KIPA 1T1WA 1CE1H 3FQTB 4L3ED 5I15L 2J6EA 4NO3B 1P1ZA 3REVB 5DUMH 3X3FH 1AP2A 4L9LC 4Q0XH 1KEGL 3RIAK 3L3GB 4PRBA 2XKNA 1BD2B 4JFQA 3VXUD 5GIRA 4CJ1A 2HTKD 4NWUL 4OIIL 4XC1H 4QTIH 3ARFC 3OV6A 2FO4A 3O3AB 4X5WB 5C3LD 3GRWA 4Y5YC 5J1AA 4PJDE 4DOHB 4WTZA 3V8CA 1FLTX 3OB0H 1YEDB 1ORSB 1J0ZA 4O58H 2PTTA 1JNLH 2NY2C 3LIZL 4XMPL 1II4E 1ETZA 1U8OA 4BYHA 3EFDH 3QIBD 3RPIB 3D0LA 4UTBL 3CVHA 1ZLSL 3U0PB 4MA8L 3NFPB 4HBCL 1D6VH 1N59B 2JB5H 1MCLA 5FYJU 1U8JB 4JJ5A 5GS1B 2DLTA 4P2OA 2A73A 5F1NA 3T09A 3ULSB 3W2DL 1QSFE 4WI9A 1YJDL 5SWZE 4DGVL 4FQIH 2NY3D 5FHAH 5IBUG 3R1GL 2MHAA 1V3LA 2R2BA 3MV9B 3QJHB 2R9HD 4K2UH 1VESA 5IVOA 1GJIA 3N06B 3MA7B 4KRNA 5IV2A 4FNLL 5DJ8B 1W72B 3DTXA 1NUDA 1CIUA 2QLVB 4GRWF 2FB4L 4NYLA 1A3RH 4WV1A 3IRZA 3IDYB 2VRAA 1C16B 5F9AC 1U91B 3GMMA 1EPFA 3HHRB 4POYA 1OY3B 2JK5A 5ICZA 4U1GC 4CGTA 3L3KA 1IC7H 1AGFA 3T4AA 4OAWA 1PJ9A 3ALWA 5E7FA 4GW1B 2CIKA 3OG6B 2X6MA 2B0SL 3EO1B 2GJ6D 4P5KB 3ROOB 1UB6B 4KKLC 5FCSH 2LTQC 3GSNL 4LKCB 4M6OH 4Y19D 4NQDA 2P5WA 5KVFL 1E4WL 5I73B 5C0BA 4YR6A 5I1KH 3P3YA 4LIQL 2DICA 5J6HB 4WNQA 1D7FA 1F58H 2F53B 1ZT4B 4QCIB 3D25B 3W11C 5LGJB 4PJ8C 5D1ZB 5IK3A 4EI6B 4X6CF 2M8XA 4PJBF 4PP1D 5M94B 4MVBD 1JCKA 4NRZA 5GRUH 4R26H 3MGTB 3HE7A 4MCYA 3C5ZB 5E2TL 3OG4B 2DQCL 3GKZA 4P2QA 3LRHA 3F7VA 4XP9H 3B9KD 3QHFL 2PYFA 4DGYH 3EFDL 4LKXA 3VG0H 2XZCL 3W5NA 5FYJH 3RKDC 3PHSA 1IE5A 1H0DA 3LN4A 1A7RH 1KPRB 1KJ2H 4F7EB 1ZHNA 3MRBB 3TIEA 3L7EB 4LLYB 2YUZA 3JV4B 4Z18A 4EI5C 1KG0B 4JFEB 2NY2B 5DD6A 1NL0L 4OUUA 1CFBA 5BVPH 5E4EC 5IOPA 1B6DA 3UTTD 1XCTA 4PJ5A 1I1YB 4P5MB 1ZGLB 4XP9L 5HI5D 3QHFH 5DC0A 1BQHB 1R3LA 3BEVA 5DC4B 3MLWH 2IBGA 4FA8A 3MFFA 2BXYA 4OLUL 5F72S 3VU2A 2Y06L 5TE4H 1E4XL 1WISA 4JR9H 4M7KH 5E2WH 4IHOA 3VXRE 3H9YA 3ILPA 5DDHB 5GGVL 2NXZD 4XWGL 2ORBH 4O4YH 3OAZH 2EYSB 4NN6B 4ZFFB 3CFJB 1L6ZA 1ZT1B 2UYLB 4KROD 1IAMA 2Y5TA 3OTTA 4QEGA 3MRPB 2MOVA 2XYCA 5KVFH 1N3NB 2EIZA 4M6OL 4X4ME 3S96A 3QDJA 2BJML 3M07A 4JN2B 4WEMB 4EN3A 2DQIL 1MIML 1XGYH 3LRSA 2GUOA 3DYPA 4WJ5A 3EO9H 1AHWC 1RFDH 1RMFH 1REIA 3RY6C 1JFQH 1VFAA 2BVUA 4LLMB 3QWRA 4KJYB 3GUTB 4I5BA 1DN0B 2AV7B 2D7PA 4Q6IB 1ITCA 1NAMB 4CNIA 1SMAA 4U4BA 3OGOE 2FB4H 3TF7C 1HK6A 1YMMB 2I5YL 3UTPE 3KYNA 3LMJH 4JZJB 2Y23A 4ISVB 4S10A 1EZVY 3TNNA 4LSVH 4F58L 3PXHA 4RWYL 4JQXA 5C92A 5FKAA 5ENWA 3P77B 5FM4A 3MJGX 1PFCA 4RDQG 1LO5A 4NWTL 2AJXH 3SKNB 5T5NF 5D5ME 2NQCA 4NO0B 3E1F1 2ESVE 1AC0A 1CDGA 4JJHA 4I2XE 4CVUA 2DD8H 3G9AB 4HWBH 3MRMA 1UACL 1CU4H 3ULUL 2WNGA 3O3UN 1TCRA 4L29B 1TZGL 4CKVX 5SX4H 1UB5B 1CGTA 4XBGB 5K9QG 2AJYH 4DAGL 4HCRH 2OX5A 4UILH 3MLXH 2Z8RA 4FTVE 4LIQE 5I1CH 3TO4C 5E24E 5KSBF 3G5VB 4P48A 1X4YA 5IESH 3L9RB 2O5YL 2BZDA 4YDJB 4YBQD 4UIKH 4G8IB 2E9BA 4UT9H 5ISZA 2OZ4L 2F9BT 3SGKC 3DPBA 4LEOA 4CVZA 5GGQL 3VGFA 5D6DC 3IFNL 5DFVD 1DEDA 2DJUA 2J88H 1UM6H 4E42B 1Q0YL 4NKIL 5GS0C 1H5BC 4JGMA 2P5WE 1KJMA 3MRLB 3WE6B 3BPLC 1IKFL 3OKLB 3J7HA 1MF2H 4RMVA 3LQZB 5C08A 1BVLA 4YLQT 3HMXL 1E4WH 5ESAA 3EGSA 1J7VR 1FNEB 1T4KA 2ICEA 3NAAH 3VDAA 2GJZB 3M1BB 1HILB 4IRZH 2EO9A 3FAXA 1F97A 1MAKA 4P23C 1B90A 4YFEA 3AGVA 1A6VH 1NBYA 3KPLB 4UINL 3S37L 3JUZA 4BSWA 2OTUA 2DTMH 3LQAL 4LFHD 2V2WB 1KG0A 2ADIA 5HDQH 1T21A 2F19H 2ENSA 1R3IH 3O2WL 1PEWA 3S3SA 1QLFB 4NJ9H 2G75B 5BOPA 3QDGD 3OAYK 4LCWD 3HC4H 3MV8D 4UQ3A 4ZFZA 5JXAH 43C9B 5HHQB 4RFOH 4LCYA 1QFWL 3DURB 4ZPVA 3BKCH 1ZA3B 4XRCB 3QUZA 4G9FE 4L8BB 5ACZB 3QQ9D 1EFXA 4U6VL 3MRNB 1DR9A 1U3JA 1FZOB 2P5ED 4UT7L 4LCCB 3UTZA 1EHNA 3OPZL 4X8JB 5MI0B 5JUEL 1JN6A 4M7LH 1SYVA 4OD3H 1JWMA 1H15A 3G6JB 4AMKL 5C08B 1R3KA 4PJAF 2VE6A 4UTBH 2Z31D 3WFBH 3ZL4H 4J1UA 1KCSL 1AR1C 1F4YL 1I1AA 2A9MH 4KK5D 1LO0L 1I7UA 3TH4T 1RUMH 4MQXC 1NAKH 1R3HB 5I6XC 3UTSA 5D7JA 3MROA 3NN8A 4W4NA 3IXTB 5DVMA 4ZAKB 4LPVA 1YQ2A 1UB6A 1MRDL 4YHOH 5EO9A 4IOIA 4DVRL 5I1IH 1R3JA 1A6ZA 2PKDA 2APVA 4IOSD 1ZXQA 3WHE0 5HHOB 3MYZA 4PJ9C 4XAKD 4L8SA 1DL7H 3RGVA 2FJGB 4N1HB 3N1QC 4GXVL 2HAZA 4TSCL 4GO6B 1ZLVK 4M4PA 3OKNA 2RHEA 1X7QA 3UJJL 1QLEL 4N0YH 5FM5O 4GQ9L 1A7NH 2NY0C 5GISH 5HJ3B 2FIRT 5EIIA 3G5ZA 2VUOA 1NCWL 5DYOA 4HUVA 2R2BB 4J3TA 5FM5M 2Q1EA 5JPNB 3BVNA 1U3HB 4YHOL 1A22B 1TZIB 1ZANL 3BQUB 4O5LH 1FO0A 4DUXA 2G2RA 3GO1H 4N8VA 2YZ1A 2A74B 4GAJL 1I75A 2X1XR 4QRRD 3UDWA 4CW1B 3I6LD 4TRPL 4J6RH 4OM1L 1KTLB 4KK8C 1F5WA 3EDFA 4GAGH 3STBA 2HH0H 4A6YB 2VB5A 2I60H 1U8IB 2NTSP 1E27A 4Y2OA 4YO0A 1P53A 4NCC2 1OL0A 1JGLL 3MJ6A 1OP3H 2PN5A 4OAWB 1N5AA 1R5IB 3U7AA 5KG9B 4OZFG 1CGYA 1JNLL 4LGPB 1Q0XL 3HMWH 1I9JH 2FO4B 4M00A 4OV6F 3VFUA 4RGNB 1EERB 3QO0B 1KCRH 1EMTH 2WUCH 3X17A 3HRZA 1A8JH 3FB8A 4WI2A 4R97B 4NQSB 5E00B 4X80L 3IDNA 4TSBL 4DGIL 3V4VH 5EU7C 5D2NA 1MELA 3MYJA 1Y18A 4OV5B 4LRIA 2EH7L 4UUJB 1W2KT 3HZVB 4IRSD 4PRIB 3SCMB 3GBLA 2P8MA 4A6YA 3MRQB 3OAYH 3QUZC 1HXMB 3O9WC 1P84J 1X5ZA 2GEEA 4KKAD 3WIHA 5KSBA 1BX2B 2JCCA 3BRGC 4XC3H 5HYSA 1CXFA 4MD4B 3K74B 5IQ9A 5HHPA 1AC6A 3MJ9H 1KTLA 4QY8B 2QADC 2BY2A 3DETD 4J3XA 5IEHA 1NGPL 2J2ZA 5FB8B 4GG6B 4F3FA 2PTTB 3WS3B 4HWUA 2JE8A 1U93B 4OT1H 4JDTL 4WHDA 1TQBC 5I0ZA 4EQ2A 3H3KA 3CFEB 3NBNA 3D9AH 4NKIH 3BGMB 1PLGL 3ECBA 4PGCA 5FYKE 5BRZE 2DIBA 5I8KH 4HXBH 2VLLA 2XV6B 4OCMC 1QFUH 1F4XL 4JPIB 5DURD 3T4YB 3VW3H 2D7NA 3IETA 4OCWL 4JDVA 4QXGH 3VFUB 3J8F7 1TJHH 4HFUH 4Z9KB 4IS6A 2ICES 4PS4L 4EVNB 1NUNB 2IF7A 2PR4L 2XQBL 1DQQA 5CP7B 5IB2A 4NO0A 4WTXA 2EDKA 5FGBA 1S9KC 3PGCB 4TTDC 5B8CC 5F6IC 3FFCA 1Z6JT 4DN3H 5IHZA 1RUKL 4G6KL 4S1RH 3EOAB 3AC0A 1S5HB 2BSTB 3UAJC 4BFEA 1QFOA 2OYPA 1UA6H 4M6ML 2FECL 4N5ED 2EDNA 3AM8C 4R7DA 3OAZK 1BHGA 2VZUA 3F58H 2J8HA 4NNXB 3O2VL 1JWMB 4J1UB 1WZMA 4ZO9A 5DHYB 2W07A 2NW3A 4J12A 2PCPA 1QACA 4DEPC 2YXMA 5JXEA 3FQUA 3IJYA 2Q3ZA 1BJ1J 2DQJL 3HR5B 1FPTH 5T3XL 4LSTL 4LSUH 4P57A 5FK9A 3L3IA 2PCPB 5C07D 4JAMB 3WN5C 2ED9A 1BQLH 3C6LB 3QDGA 3QBTB 5FYKD 1FVDB 1WITA 1V3MA 4BA8A 4OIBA 4LSRL 5DZLA 2H8PB 3S36L 3EHBC 4WDIA 2X4TB 1HINH 3DURA 4LCYB 3MACL 3VE0A 5MENA 3KVQA 1G0XA 1FVDA 1S5HA 1KN2L 4MS8D 2OL3L 1XGTA 2AK4A 5L2KE 1KTDB 1T66C 2Q7NA 5JDSB 5H37H 5FGCB 1L7IH 5TPWL 4WFFD 4J2XA 1UM4H 2CLRB 4KUCF 4S1QH 2FJFB 4ZFFA 5T33L 4OZHA 2AK1L 4TULL 2B5IB 5CLTA 1HKFA 3MLTA 1DDHB 3IJYB 5EU6E 1YY8A 5I1LB 4QGTA 3T3PE 3H2WA 2P4AB 4N0UA 3DUUA 5AYUL 3UJTH 1GVIA 1MAJA 4ZTPH 3VXTA 5HHXL 3OGCA 5EOQL 2E8YA 4JREB 2A1WH 3D18A 1QHPA 2K1MA 1XZ0B 1G1YA 3WMSA 1HN1A 3AREC 4NCDA 3SDDA 3NZHH 2VZOA 1OHQA 4WUKH 5GS0L 2YK1H 1LEKA 1A6AA 5FB8A 4GG6A 1JNNL 1J1PL 4LHJB 2C3HA 1LWRA 2Q7YA 2XTLA 2QJDA 4GJTB 4K9EL 5DJDB 5FYKL 4MJID 5JW5B 2XFXB 3BE1H 5TDOA 5J0BA 2PETA 4BM7A 1S7SB 5GGQH 3I85A 5FAAA 1IC4L 2R4SL 1N5YH 5GRZA 3SDAC 4P2CG 4GMTL 4NQDD 4UT9L 2YA2A 5ICYA 5CFHA 1T2XA 3HE7B 4MCYB 5L0QC 1MHCB 2X4SA 3REWB 3SKJH 1KB5B 2YBRA 1UJ3B 5EZIH 3QH3B 1LNUB 2VXUL 3FOLB 2BCKB 4PJ7E 1Q0XH 1JWSB 1A4JA 4QXUH 3K4ZA 4P4KB 2O61B 1QYGL 1QNZL 4XGZB 3P40A 5J6GB 2XZCH 5E8OA 3QFJB 4ZUVB 3S97C 1F4AA 3KPNB 3HAEG 1D5IH 4NZTL 3KPRA 5MERA 3NAAL 3BGFB 2EXYD 5JHDD 1T20B 2X9YA 3G6AB 3MNWB 2ZUWA 3V4UH 3ETBF 4LSQH 5IBLD 3CDGA 5EBLA 2WWMD 5CZVH 2FATL 1AI1L 3CUPB 1JGUH 1OGTB 3WDJA 3NA4A 3EFFB 3DO3A 4ODUB 1FV1A 4MD0B 5I76A 1T2JA 3TH3T 3TNMA 2BDNL 3QQ3B 1L0YA 2C3WA 3LMJL 4FQ1H 4PJGE 4P4KA 5CILL 5IBUB 4YDJA 4U0QB 3BD5A 4PRPD 3BPCA 4V2BA 2BX5A 2EDRA 2X4SB 3U36A 4NO0D 3QULA 1MHEB 3WUWG 5FDYA 4OZFA 4X9FA 5FIEA 4PBVC 5F9WC 5FYKU 2BVPB 4NGHL 4KZEH 5AWNH 2H2PD 1DL7L 1HWGB 3JXAA 1YC7A 4K8RD 2Q86A 1CLYH 4OZIA 5MP6H 1N3NA 1A3RL 3H6JA 3U9PL 3C8KA 1GHFH 4LAQL 3U4EB 3BO8A 3HZYB 5JR1L 3PG2A 3OF6D 5DFTA 2EIZB 2NZ9D 1MCBA 1T89A 3I2CH 4HV8A 5F97E 5FA4B 2X1PA 3SO3C 4PJCB 5DF0A 5E95B 1XGPA 4OB5L 2MMXA 1ZT7B 3DVGA 4DKDC 1YEDA 2ZSWB 5IP4A 4NQCD 1EK3A 5JIHA 5CGMA 1M4KA 2HRPH 3FMGH 1E6OL 1OAUL 4WWKD 4OFVA 2FZ3B 3QDMA 1Q9OB 1RVFH 3GHEH 5E00A 3KYMA 1C5DB 1J1OL 4JZJA 2OTPA 1YECL 3ZKXB 3O4LA 3G9VA 4XCCL 3WL9A 1NFIA 5JNYB 1ZGLA 5CSZB 1ZLVH 2UUDH 4OD2A 5CKAA 5AAWA 2XT1B 3ARRA 1KTDA 1JHLH 4OUOA 3VFPA 5AD0A 2AK4B 4YPGA 4ZPVB 1F00I 1PDKA 3FB7A 4YWGH 1B88A 1TPXB 3JBG7 2B0SH 5DMJB 3BAEH 1RK1A 2E7HA 1OTTC 1XIWA 1U36A 1P4IH 1VADB 1ZGLP 4HJ0D 4IDLA 4OZHF 1YN6A 4D8PA 1SYVB 2V2WA 3ECBB 4PGCB 4UBDC 3RWCB 4MX7B 5F8QC 4CN1A 2ARWA 1CGSL 3OAUL 3F8UB 5DMKA 3RPKA 4TUKL 1KCLA 5FK9B 3GNML 2AXFA 5FUOL 3MODH 2IPKB 5EWIL 2Z35A 2V9RA 3UPRB 5ALCH 1JZ4A 5DD0H 1S8DB 4K94C 1HIML 3ZO0A 4LSPH 3HCVA 4ZPTB 3VH8B 2J8UA 1I3RB 3TH2T 3T2QA 1MPAH 1IGJA 1J05B 5CGTA 1GGIH 2P45B 2YWZA 3QUKA 3VFGL 4YR6B 2XQYK 5IKCB 2G75A 2CJUL 2CIKB 5TE4L 3RVWC 3H3BC 3QEQB 3RGVB 2H2SD 2ENYA 4YZFF 1ROWA 2MCG1 4LAJH 1M05B 3MTRA 2Y5EA 2D9QB 1T7XA 4OB5H 2XZQH 5FF6A 4LFHG 2AGJL 4K8RH 1IKNC 1U8MB 5HDLA 25C8L 4WW2A 4KV5F 1VGKA 2DQFB 3TZVA 1WZ1H 4HC1A 4LKXB 3MNVB 3SDCB 5ESAB 3QSKB 4R9HA 4NBYB 2OM5A 3LQZA 2GSIA 4Z95L 4XNQB 2FLRT 4QHLA 5C0IA 5CIPH 1B4RA 1N7MH 4O2CA 4OM0H 4AM0B 1T0MB 2VERN 2FEEL 1J8HB 4LARL 4ERSL 3LQAH 4ZOAA 2Q8BH 3RKPA 5I1DB 4XPAH 3BP4B 5EO0B 5TDNA 1N4XL 4R26L 5T1KD 4QTHB 3L3DB 5J6HA 4PGEA 1A2YA 4MYWB 4KQ4L 5HBBA 1FIEA 1FGVH 35C8H 3JUYA 1T7YA 5HYJE 1NBVH 1EO7A 1A3LL 1FO0B 1LEGB 4QRPA 1Q94A 6FABL 4XP5L 3MXVL 3HI6H 4PRIA 1EHXA 4TUJA 3O41A 2VAJA 2QR0B 2ED8A 5J56B 4LSQL 5JW4R 5K9JL 1MCPH 1NLDL 3IFNH 2PW2B 5KVDL 2PTUA 5I1JL 5F9OH 2LTQB 3SJVE 2B4CC 3L3GA 5H35B 4JO4H 1I1AD 4Z8FH 4Y88A 3DTXB 5DGQA 4AENA 3FQTA 4IRJC 3IDMB 1KNOB 1JRHH 5LJYH 4YZFE 1MQKL 1XF3B 5AZEH 1JNHB 2DQIH 3KJ4C 4APQC 3WKMH 4CMHC 1RZIB 3U46B 1VFAB 3RWHB 2Y7QB 3IDJA 5HPMA 1PG7L 4BELD 4X0KB 4URTB 4K2UL 5IVNA 1KFAH 5I1AB 4FFVC 3ULVL 4AEHH 3T0EA 5D93B 3EYOA 2HJKB 2PXYA 4PYGA 3MBXL 3LSOA 3KPMA 1CE6A 3D48R 4ONGL 4Z7VF 1BECA 1P5VA 5DRXA 3ARPA 4X4YB 5BVJA 2C1OA 2A74A 3WNLA 5FFLA 5JTWA 2F5AL 4NFCA 1AQKH 2NLJB 1UC6A 3WUWB 3RAJH 1KUMA 5E6ID 3RUGE 2D4DA 3BVNB 3TN0C 1ES0A 1NDMB 4Y8DC 3MBXH 2EYRB 5D7JC 4HK0B 3HMXA 4LSPL 4J23A 5SX5H 3B3IA 4AL8H 5BJTB 1ZS8A 4QHNA 3MV01 1PAMA 3S96B 2X10A 4KI5F 1TENA 5T1LA 2APBA 2Z31B 5JR1H 4R4ND 2GTWA 3NH7L 4HHAB 3O3BB 3QEQE 4XX1G 4XNXH 5HHNB 1AQKL 1FBIL 2J3SA 3REVA 2IH1A 3U0TB 3UJTL 2C4FT 3P4MB 4KKBC 4QTIL 4HZAA 3CVIH 4OZGE 2CK2A 1JI1A 5ERWB 1V7ML 4JVWA 5EO9B 3UTSE 1H3GA 5J12C 3AXLB 3LKQA 5JOFB 3ZLQC 5LQBL 3FT2A 2WBJD 1MCWM 1IGIH 4NO5B 4L9LB 3HAEB 2DQCH 5F1IB 5E2TH 2VC2H 5TE7L 1JF5A 3Q6GH 1R24B 1DVFC 2C4XA 3DIFA 3KYMB 2MKLC 3ULUC 3QI9D 3SKMA 1DLFH 5B39B 4D9LL 1JRHL 2RJMA 4NZUL 1IGYA 3D25A 2DYPA 3KLAB 1FRGH 3O9WB 3CCHB 4NDMB 4Y1AB 4MD5A 2ZP0T 4GW4B 4KKLD 2VLJB 3V4UL 4IIQB 1P9MA 3HE6C 3V0AC 3QCTL 4APQA 1BZ9B 4LEOB 5C0RL 4R4FH 2WWKO 1BFTA 2GUOB 1XR8B 4I3SL 2E7LA 2EC8A 4Y89A 3SPVB 1B3JA 4XVJL 4PTTA 5FA3A 4RSVA 4DZ8B 1U8LB 3HFMH 3VXQB 4XP5H 2QSCL 2GK0B 3QQ4A 4WCYH 3CC5B 5L7XL 3DSFH 5BV7C 1ZT1A 3B43A 2V9TA 3I3BA 3P2TA 4B53A 4UOW0 5IHUH 2WP3O 1GZQA 4M1DL 4OKVB 3VI3E 3FQUB 1T4KB 2ICEB 5DC9B 4OZ4B 3CXDH 3ESUF 3NABL 4HKBA 5DUBA 1HILA 2XY1A 2L7UA 2XZQL 4RGND 1HWHB 3BIKB 3GM8A 5J57B 5ETUA 2D7MA 3I02A 5J06A 1GOFA 1BFVH 1BZ9A 2ZSVA 5IOPB 2BOCA 2X4RB 5IVZB 2JELL 2A73B 1S7VA 1NCNA 5GS1A 2PUQT 1OF2B 4Y1AA 2BNRA 4LASH 4LU5L 1EXUB 3SJVD 2FX8L 5ILTH 1FC1A 1YA5A 2AJSL 4PJHB 5CINL 4XMLH 3QG6B 3RVTC 1BFOA 4E5XA 3RZCC 3I6GB 1MFBH 3SDXF 2A1WL 3D85B 1W72A 4WV1B 1F11B 2X44D 4XNQA 4ZTPL 5BW7C 2HT4C 3KYOB 1IEAA 1D5IL 2Y6SC 2X42A 3KPSD 2FYYA 3QUYC 2DQTH 4LK4A 1FVCA 4HUUA 5GGTL 3IDXL 5HGAA 5EB9A 4NQVA 1WBYA 1I9IH 2AK1H 4P5TA 4TULH 1U8NB 3GHBH 32C2A 3P11L 4U49A 1QRND 2HFFB 2FBJH 5EOTA 5E08H 1TCRB 1AE6H 4RGOH 1GC1C 1UB5A 3WIFB 4UV4H 1QG3A 3F5WA 3BXNA 3ALPA 4I2XA 4S2SB 3CAFA 4MNGA 4JRWA 2BDNH 1UT9A 4PJFE 1ETZB 5BV7B 3MJ9A 3S36H 5ETUB 1SM3H 3FQNB 1A9BB 2IANA 3AS3A 4C56D 5FV2A 4NKDA 3MLVH 1QR1B 4MQ7B 3HZVA 3EJYC 4PRHE 2J8UF 3PXJA 4KRLB 5FYJE 2GFBB 5BS0E 3MLRH 1S9XB 2C3XA 3NIGE 2DB8A 1MREH 1GGTA 3CZFB 4MX7A 2ZUQC 2D0GA 4LLWA 2DI9A 4L3CA 5EBGA 4Z0XA 2GTZB 1FLRL 1UWXH 5F7FA 4DKEL 4U05A 2AKRA 5J13B 5EFIA 1JYXA 2AV1B 1LE9B 1IKNA 1HQRB 1IC5L 4AEEA 3TFKD 1GRWA 3OF6A 2IWGA 5E1AB 1MCOL 3FO0L 5CJQH 1MLCB 3O2DA 3EOTL 1FE8L 4YXLH 1V5JA 4Q6YA 3F7QA 4MB4A 3SGDI 4YDLB 3LN4B 1BOGB 2Y7QA 4S1RL 1I7ZA 4U1KA 4GKSA 4L4VD 3D39B 3KJ6L 3OBAA 4MDJB 3DX7B 1LDPL 4U1NB 1S9YB 4R3SB 4B5EA 4HG4K 4JFEE 3QNXA 5B3NA 4H88L 1LP9A 4YHIB 2B2XH 3MMEB 3VCLB 1IC4H 2R4SH 1N5YL 4LCUB 3CSYA 3HPJB 3K1KC 3GSQB 1D6EB 3D3VB 3QI9B 5T3XE 1E28A 4LLWB 1EVTC 3AREB 3HG1B 4QCIA 4MSWA 2Z92B 2JB6B 4ODXB 3RZCD 5E94B 2QKIB 2H26A 3CX2A 5DS8A 4YX2H 5DDHA 5E8EA 4F9PA 3UO1L 3VWJD 2CD0A 3MO1B 3JWOC 2FATH 5BZDA 1N64L 3VXSB 1A02N 1KCSH 2A2QT 3O8XC 3Q3GB 5H8DA 4XC3L 3KR3L 2YSSA 4LSTH 4QT5A 5SWQA 4X5XB 4Z7VE 4PRDA 4PJEE 5CILH 5JW4M 1MFAH 4Z7UB 2NY4B 3JV4A 4E41E 5DQ9B 2YD8A 4JFEA 5E99H 3QEUB 2IBZX 4NOFA 4OF7A 3IAPA 1I7ZB 4JQIL 2HP4A 2GHWB 4FXGB 1AI1H 1A7QL 2FYYB 3BPCB 1I7UB 3BN9C 5AG8A 3DUSA 4G6KH 2AP2A 3K8LA 3QNYB 4WTWA 5IMLA 1KIRB 3NACL 1X4ZA 3MQIA 1JHTA 4OQTA 4D0CB 2BVOA 3DSFL 1F3DJ 2A9NH 3SE9L 3V0WH 5D7IA 3MZTA 5BXFA 3KS0H 5D5MF 3QUMH 5HXMA 4JY5L 2VLKA 3FB6B 2BOCB 2XRAH 5DI8A 5BV7H 1IILE 5HHPB 5IQ9B 2FJHB 4KDTA 5I30L 3KDMB 1M7DB 3HZKB 2IANE 3OKMA 4YJZL 1CD0A 2NXYB 3F58L 5TDPB 5IVXA 3EJZD 3FFCE 4MJIE 1GCFA 5B4MD 3FT4A 3QHTC 2XWBA 1J18A 1F90L 2VH5H 4ELME 3WFDH 5GGSB 4GW1A 1JGDA 1WGOA 3V7AE 3VFMA 1RUKH 4NT6A 5FYLD 4MNQE 3QXTA 4N8CH 4XPHH 2QBWA 1TIUA 4XMKL 2AVGA 1KB9J 1U91A 4M93B 4OCSL 3W0WA 4DVBB 2R8SH 1J8KA 2N4IA 3Q6GL 3NCCB 1WQVT 4XXCA 3CGTA 1QFPA 4R3SA 1KIPB 1NCDL 1QVOA 4X80H 1TZHB 4O51B 1J5OH 3CMGA 1J0JA 1K4CA 4JCMA 1YEFL 4GS7C 4O02L 3T2NH 2OK0H 2R1WA 4TTDD 2BNRB 4WHYG 1DQML 2FX9H 1PLGH 3HE7D 1BVKA 5AEAA 1I9JL 2ICWB 4UILL 3MGOB 1KN4H 4FQPA 4L4TA 3X11B 2I9TB 2BERA 4UV7H 1LO3L 4FG6D 1MEXL 4WGWB 2CUHA 2H32H 3OB8A 5IWLC 3ZL4L 4WY7L 3SEPA 2YWYA 3PWLB 3NFSH 4BKLA 4HCRA 4FQLH 1DLHB 1HKLL 4U1LB 3O6LH 4OJFH 5DT1H 2EIBA 1EHLL 2D31B 3OKOB 1U6AH 2HTKC 3F62A 4NT6B 2EZ0D 5KSUA 3SQOL 2A6DB 1QEWA 1KC5H 4S1DD 4TSAL 4D9QD 15C8H 3QJFA 3GIZH 5F70A 1KELL 2ZCHL 5IKCA 5CEZL 1YJDC 4PY8J 1OPGH 5FUZL 2PF6A 2R29H 4UIMB 3TZVC 4KKAC 3V6FA 1T83A 5GISL 4WHCA 4WCYL 1QA9A 4WRLA 2VR5A 3PWUA 3WBDA 2F54E 2NX5E 5DFVC 4ETQB 4GW4A 4HULB 1DLHA 1T80A 2HT2D 4G8GA 1D3CA 2ZUVA 3W82A 4NNPH 4OZIF 2GITB 4X4YA 2Q8AL 5J11C 3E3QC 3GMPB 2Y25A 5T1MB 4XVTH 1C12A 4LHUB 3TIDA 1PG7X 4KJPC 2ZG2A 2M1KA 4CN4A 4IOFD 3UBXI 1FL5B 4PFEA 3WFCH 1Y0LB 4Y2DA 3QA3B 5IR1A 2EIEA 2R1XA 2CRMA 3TEUA 4LL9A 1Q9KA 3G6AA 3MNWA 4ENED 3LAFA 3UO1H 2JKXA 1JJUA 4U1KB 1CF8H 2FBOJ 1G6RL 4L8DB 1QA9B 4U0RC 3WFEL 3DMMD 5BO1L 5IB3B 4BQ8A 1N6QL 3ZZ1A 2DWDB 1OVZA 2A77L 5TF1H 2QHRL 4G42B 4V1DE 5SWSD 4RDQF 2OZ4H 4PB9L 3TJHC 3RVUD 2GT9B 4OZGB 3BISA 4JM2B 4QRRE 1NFDB 3O4LB 3QIUA 1I3GH 3NCBB 5D7KE 5A2FA 3H8NA 1RZ8B 4ZAKC 3ZYJA 3MJ9L 1DCLA 2EYSA 4GAYB 1I8KA 1AGCA 1HHIA 1UWGH 1CK0H 2Q6WA 4Z5RA 3DROA 2DIJA 4IRSB 5F1OB 2VLKD 2H1PH 4MWFA 2E3VA 1KEML 2FEDD 2UZIH 5IMOB 4QLRA 4JPKH 4JRXA 1GPOH 5C09D 4KRMB 3UJIL 4JFPB 3U83A 2P42B 4YHKH 4FRWA 4MAYA 4U3CA 3IJSB 2OQJA 1J87A 1DN2A 3T0AA 4QRTA 1XMWA 4UT6H 4X6BA 5KSAC 4PG2C 4IIQA 3ESVF 3FRUB 1AQDA 1SJHA 3FN0H 3T0EB 1BIIB 3TBWB 5GZND 4AH2A 5F9JB 3MXWL 3OPZH 1RZGB 4U1NA 1HHKB 2EE6A 3RWHA 4JRYA 2AJ3B 1MUJB 4HK3N 4YHNB 3RI5F 4GAJH 1UQSB 1MJ8H 2D9CA 1K3ZA 5ESVA 3D18B 3P0VH 4RGNC 5EU5B 1DLFL 3QUYD 3QCUL 4Y16A 1FJ1A 3QNYA 1UKQA 3VI4F 2YD1A 4UB0L 1NCWH 4EXKA 4NC0B 1NCAL 4LDEB 4PJIF 3W39B 1JGEB 3TVMC 4BZ2L 1P6FA 3BPNB 3MRDB 3LQAC 3U30B 1KPVB 3I9GL 3K80A 2WV3A 3E8UL 5TQ0L 1LE5A 1FNSH 4HSQA 2R4RH 1FSKC 3IJHA 2Z31A 4KMTH 3VG9B 3OKKA 4PD4J 4L4JA 4JHWH 4QRPE 2QSVA 1XGUA 2XQYG 4JE4B 4MJ6B 2DTSA 2B7DT 5F89A 1UH2A 3QDGB 2EDOA 5HI3C 2GAZA 1IEHA 1B6UA 3AFLA 2I9LB 4X99A 4RQQB 2AERT 2HFGL 3VXOA 3L3KB 2HFFA 2JK5B 1G7HA 5CIPB 2XG5A 3BRDA 5C0CE 4D0CA 3TBYA 1BFVL 4R8WL 4YHIA 3UTQA 1F3DH 2N56A 3QO1B 4ZFOB 5T1KB 4OF5A 1TFHA 1VPOH 1NGWB 3DV6A 4M8VA 4KJWC 3K2UL 3I6GA 2WIMA 4QXTB 1BEYL 4P2OB 3QZWA 4EKXA 1TQBB 2XNAA 5INDB 5GS3A 4PG9B 4P3WA 3VFSB 5C0AB 4QHMB 1QO3A 1G9EA 3OHXA 2F53D 1NC2A 3VRLE 2DRUA 4K8RL 1RUQL 5HYQB 3MRHB 3O3BA 4H8WC 3V5DB 2DLEA 3HFML 3MLSL 2HVKA 1NEUA 5DWUH 1RUAH 4HG4J 4Z0BL 1I9RH 4HPOL 4N90E 5FKPB 5DHVA 2OI9B 2FZ3A 3QDMB 5E6IC 1S8DA 3A6OA 2AXGB 3VD5A 2FRGP 5HVHB 4XCEB 4HPYH 5JIIA 3GRWL 4WUUA 3DX8B 4OGXL 5L8KB 4NJ9L 2H9GB 3RTQA 4JB9H 3GSOB 1OP5K 2R56H 3KHQA 2YRPA 1E6JL 2VR4A 5I1KL 3TJHD 4JANB 4HT1L 5KSAB 3EYOB 3ZKSD 2NY5C 5IM7B 3WFHB 3QIWB 4L8SC 5D8JL 3AB0B 3DX7A 4D94A 4XPFL 1PVHA 4APQD 1Z0NA 2GW5A 4Y4KD 4QXTA 1J1XL 3LKSA 1QTYT 2EDJA 2JJSC 4XNUL 3ARDB 2HMIC 1WTGT 2R56L 3CCHA 2AXHA 1IZKA 4LLUB 3LEYL 3TIDB 4N5UA 4XNXL 2NY7L 4LHUA 3BW9A 3TGXA 1UCBH 1KYOJ 5EZLA 3CZFA 4XXDB 3JV5A 5IW6B 5AUMB 2PW2A 3DO7B 2YD2A 3EBAA 3KLDA 3GIVB 3G08A 3BH8A 4DGVH 4RQQA 4ZUSA 3BX7C 3MV8E 2IQAA 5GRJH 4O4YL 4PJEF 3KXFD 3I50H 1WVZA 1UM5L 3WD5H 2P47B 2OJZL 4PPTA 3ZE2E 5DQDH 4M93C 4PJ5E 1ZHBA 4MNGB 3KLHD 4Z7UE 1GGUA 3THML 2J12B 25C8H 5I19L 1IGTA 3UPRA 2XKUA 1MWAB 4OQTL 4KROC 3G5YA 1J86A 5F96H 1N0XL 4L3EB 3BQUD 4M6NL 1EFXD 1VFOA 4YXHH 1CL7L 3SJVB 3V5HA 1UJ3A 1PG7H 4HK0A 3PGFL 2CO6B 1T3FB 4XH2A 1MREL 4R2GC 1MJJA 1TVBB 5C09A 3FTGA 1KJVA 4AT6B 5EZJA 5DQDL 4BKLB 4D0DA 5SX4I 3MNZB 3ZE0F 2X5PA 4PJ7B 4BZYA 1QKZL 3FB7B 1WFUA 5EUKA 2NY6B 1L7IL 5JXED 4YPGB 4LPTA 1PEZA 2UWEE 1ED3B 3UTSD 3L3DA 4Q74A 2F54D 4G6JL 4LEXL 1HYSC 2NY3C 4FQQA 4UB0H 2B20A 4GLRI 4IOIB 4HPYL 3T65B 3BP4A 1QRNB 4G5ZH 3BMVA 3KHOA 2YMXL 5D6DA 2BK8A 1Z9MA 3VXUE 1YEIL 3CVHB 1JTOA 4NQDE 2FNBA 3BEWB 5C1MB 5KANI 1BQLL 2GYSA 2YRLA 4ALAL 5SWSB 5FGSA 3PWNA 3V0VB 5I16B 3W0WB 1N2RB 3HAEA 1FFRA 4EXPX 2JB6A 4FQJL 4I18A 5KTEH 1CN4A 1B0RB 3RP1A 5E70A 2I07B 4OZFH 3MX0A 3I6LE 1UZ8A 5ELIA 5EPMA 4XMLL 3LIZH 1ZHKB 1QNZH 4M1GH 1CDCA 2OS7A 1OAXL 3ARFD 3QPXL 2VLJE 5HHNA 1NBVL 4JPKL 2O5XL 5E9DD 3KXFE 3QDJB 5KVGL 4OTXL 5IGXH 4JZNA 2WMPA 3TO2B 1P7QB 4X6FA 5J13C 5F7DB 1VFBB 3V52L 3PGDB 5EO1B 3F7PC 2XN9A 1NBYB 3FO9B 3O2DL 5HHMB 3QRFM 4OCWH 4U2ZA 1FFPA 4XCEA 2BY0A 5DHYA 5ESQB 1RIVL 1UJTA 3SKMB 4GRLB 1J8HA 5GGRB 1ZSDA 2K3TA 1CE6B 4PRPE 5B39A 4GRMB 1C5DA 3RY5A 1WZ1L 3ARGD 5FOBB 3FT3A 3ZE1F 2VAAB 4PLOB 4ZS6C 3MV8B 4Y8AA 6CGTA 2YUWA 3MRRA 3PNWA 4BZ2H 2VN7A 1CFVH 1EH9A 3GJEA 5ALCL 3STZB 1XT5A 1LO4H 5J12B 1TMCB 3LKNA 2OR7A 2Q8AH 3P4MA 3QXWA 3R8BB 2CKBA 3T0WA 5LKNA 4RAVA 1L4IA 3O8XD 2AJVL 4TVPH 4ZNCD 3BKYH 4JVUA 4MNHA 1F58L 1WUNT 2VE6B 3FZUC 3GMLB 1BM3L 3M45A 4YBQC 4DZBB 2NY2D 1I3RA 4G7YH 1VEPA 3BZFB 5A16A 3CMOL 3ULUF 4RMUA 1TQCC 1UEMA 2ICWI 2ARJQ 4IMLA 1KSRA 3HC3L 5GHWL 4IMKA 2XXMB 3TV3L 5EBMB 1OD9A 1YJDH 4MB5A 4KK6D 1U8PB 2X7LB 3A6BL 5KS9B 5L88L 1QLRA 1P69B 4H25B 1JHKL 3WO4C 2L4OA 2R69L 2DL9A 1S5IL 4I9WD 2YPKA 1EBPA 1OPGL 5FUZH 3Q0HA 5DA4A 1T7WA 5IT2L 4L9DA 2A38A 4JM2F 3KAAA 1IZJA 4NZRL 4TOYH 1FHGA 3EOYG 5CJOH 5E5UB 4NC1C 1Y18B 4OV5A 4KRPD 2QEJA 3A67L 4JRXD 5KSVB 1JK8A 1WAAA 1RJYA 4KJPD 4A2MA 4J3UA 4QOKA 2NNAB 4YGVB 5KSVA 3ZT6A 3LS4L 3IKCB 1ZEAH 4PLJD 2HFGH 1OLLA 4X4ZA 4M02A 4NQCA 1OWRM 2J4WH 1BIHA 4YO0B 3UPCA 3RWDA 4ZG1A 3S3PA 4HUMB 1SEBA 1FAIL 3ZSSA 3HE6B 5LBSL 4X6CA 1QFUL 2BC4A 1K8DB 5I9QC 3VW3L 2EDBA 3QIWA 3LS5L 4MGXA 1JZ7A 3O4LD 3RWEA 5J4MA 5JPMA 2BSSB 4LSRH 4WFHE 1F02I 3BN3B 5I74B 4WWID 5D7IF 3LH2H 2HFTA 1IGFH 1BX2A 3CX5K 3PDGA 1QKZH 4MD5B 5AYQA 1EAPA 2Y07H 1LNUA 1JP5A 1FN4B 5GGVY 4RX4D 3SCMA 4UUJA 1CD1B 4N1EA 1D5ZB 1F45A 3ARFA 4L1HA 2CIIA 5JUEH 2NW2B 1Q72H 1Q9LA 3WFDL 2VDML 2CKBB 2F8VA 1NC4B 1YY8B 5I1LA 1TJGL 1HHJB 3BKCL 3C8DA 4FQXA 1T66D 2HLAA 4Z7VB 3QNZA 5F7EH 2QQNH 3OJDA 1UG9A 1H9VA 3L7EA 1KACB 1FPTL 1R5IA 2W59A 2VDQL 4F8TA 4CBPA 4NUGL 4OCRL 4JFDA 3MCLH 1DANT 1ACYH 1UM5H 4M9OA 1Y6NR 4PGBA 3O45B 1I9EA 3CFCH 2KKQA 4PJGF 5C2BH 3QUKB 3U9UA 1K3IA 1WSST 4TNVF 5A3IC 3O6KH 3QEHA 2YPLB 4P99A 1BZ7B 3S8WA 1FN4A 4G8GB 1EFXB 3SY0B 5CHNA 1JGVL 1BGXL 4NKOB 1JRHI 5CKGA 3TZVD 2YR3A 4K23H 4KHTH 2GAZB 5CJ8A 3U4EA 4Q58C 1XIWB 4PJEB 2VXSL 1K8IB 4EN3B 3TO2A 3GMNA 4E41B 2X4NA 2W38A 3CDCA 3L3JA 3PHOA 1BJ8A 4Q9RH 4U1GB 4LSSH 1SBSH 3PWPB 1P4LA 3IDJB 5HPMB 4WU7B 5EU4B 2ADIB 4NQCB 1IQDA 2A6IA 5GS0H 5JO5A 2GQHA 1AGFB 3W81A 2DQEL 2VDPL 4PJFB 2IPUK 5DEZA 4EVNA 3GFUA 5LWYL 3WL9B 2D7TL 2Z8SA 5CSZA 2R0KH 4EN3C 1FYHB 1U42A 3LV3A 5CD5C 4ODHH 2LABA 2JJVA 3VRIA 3FT3B 4XZUA 3SDXE 4X7DC 3HR6A 1PY4A 1TJIL 2WWKT 4U6XB 1PQZB 5LWYH 3ULSA 1UM4L 5IW3A 3D0VA 2ICWA 3TA3C 3PGCA 2DQEH 2VDPH 4NQED 5C71A 1YEEH 4JM4H 5I1EH 3TBSA 3WCYA 1EAPB 2IANB 2V6HA 1HOCB 5EZIL 2KPNA 2UZXB 1WV7T 2WUCL 4XVUD 1A1OA 5IWLA 4R4NC 1KC5L 5EUKB 5KOMC 4Q2ZB 1VHPA 2CIIB 2QQLH 3LB6D 3ILQC 3TYFA 3TN0D 4OLEA 3BT2H 4Z77A 4R2GD 3ZTJH 5JHDE 2W9DH 2VXQL 3NCEB 2HG5A 2XQBH 4ZS7L 4HUWA 1X7QB 5ECJE 4ONHA 2E7MA 3MRIA 4MA1B 2XRAL 5JW4N 4MQTB 1VACA 3PF2A 4XVSH 1OGTA 3CH1B 1ADQH 4YHZH 3SE9H 1GC1H 3QHZL 4FS0A 4RFNC 1IGMH 2H1PL 1XGYL 5L9DL 3C9NA 1HCFX 1WC7B 1OF2A 3EOBB 4KJQC 3RVXC 2P8MB 5JOPD 2CGRL 4WTZG 2CDGB 5LGKA 4R4BA 5ENWB 4NHCL 1ZLWK 2XOTA 4KZEL 4BK5A 5I17A 5FKAB 4ZDHA 3BZ4B 3I9GH 1TJHL 4NO2B 4OFIA 3BKYL 4QXGL 1FSKB 4P2RB 4OCSH 2R8SL 1NCAH 3O6ML 1T5XA 1UEYA 1SBSL 2G2RB 5ISZE 4OZHE 4OQ1A 5HDBE 1HINL 4Y4FC 2YUVA 1LP9F 3LY6A 2D2OA 3WXWL 3T0ED 1MWAH 1JIBA 5FGRA 3QEUA 4RA0C 1FLRH 3WFBL 1M71B 4PLKD 2ED7A 2UWEB 3SDAB 3QG7L 1IFHH 4MHHI 1QUNA 2O5ZL 1X3DA 3UXFA 1I8IB 2X4QB 2F58H 3KS0J 1S9WB 2IG2L 2E6JA 4DAGH 3NCYS 4ZXBB 2YS4A 4OCXL 1YYML 5EOCH 4KK5C 2YPLA 4MA1C 2VXUH 3NMEA 2VXTH 4R4FL 5EUOE 2VXQH 2VDQH 4WU5A 1X6NA 4OCRH 1EMTL 3B8YA 1CICD 1BD2D 1KCRL 3T1FA 4PJBA 5B39G 1LD9A 1XIWD 2C3GA 5DRWA 4GAFB 3OKLA 4TVPD 1I7RA 1SMOA 3MRLA 4M1CD 4QRUB 3WE6A 2KDGA 4E41D 4PJGB 1VGEH 4DKFH 2YD9A 4XP4L 4NZUH 1AP2B 4F33B 4L4TB 3IT8D 3X11A 3GBMH 1YEHH 3FT2B 1IM3A 1C08A 3UTOA 1IVLA 2XN9B 4PJAB 3OJDB 4G6AC 4F7EA 1IQDB 1KCUH 3PDOB 1V8HA 1S9WA 1YPZF 2ITCB 1KBGL 3DHMA 4WY7H 4G8FB 8FABA 2Z4QB 4G8IA 3LQMA 2L0DA 3SQBA 1N8ZB 1FRGL 1HE7A 4BUGA 2H8PA 1XGQA 4Y4KA 1KENH 1WK0A 3MV7E 4AT6A 3SO3B 3UTQB 3C09C 3EO9L 1ZTXH 3PQYA 4JAMA 2DM2A 5GS2D 2NMSA 1JPGB 1CD1A 3C6LA 4O00A 4BZ1L 3GI9L 3IAGC 5LGJA 2G60H 4C59B 3BQUA 4F7TA 3RWJB 3C5SB 5MEOA 4Y7MA 5HHVH 1QD0A 2B2XL 4QHKI 3T0EE 1MCEA 2FHBA 4YIQA 3GGWB 3V52H 4OI8A 3LS4H 3QPQD 1X5IA 1OTSD 2Z4QA 1TETL 4RBPH 4PJFF 4P9HL 3T2PA 4KAQH 2QQNL 1G7IA 4HX1A 4WFGE 2X4PB 1C5BL 4J8RB 1OAYH 1RZIA 3VWJC 2OTUB 2WBJA 4U6VH 4EBQL 2OR9H 1SVCP 4WHTA 1KNOA 2ESVD 5CINH 3BPLB 5MHSD 4IRJA 3IFPB 1CZ8L 3ULUH 3VXRD 4NQXA 5DD1L 1MI5A 1ZVSA 4Y19E 1DBKH 3R06B 5K9OA 3RVTD 2HH0L 5L6YH 3NPSB 1CVRA 1MCJA 1HH9B 1K85A 3I50L 1CIDA 2GSGA 4PJHA 4FQ2H 4OLZL 1D5XB 3ISWA 4CN6A 2ZPKL 4L3EA 4QRPB 2DQDL 3OKDA 4N8VG 2WM0A 4ZXBA 3O8XB 3ZE1E 2BRQA 1QFWH 2DIAA 3MRPA 2OTWB 1M7IA 4FFYH 3H9SB 4F15C 4L3AA 1BWMA 4ODBD 3K81A 4ODVH 5IGXL 2W9EL 4X6DB 3MV9D 1SJXA 4I77L 1LEKB 5T1DH 4YNYA 3OJVC 5E08L 5E7BA 5F7MC 5F7LB 2V7HA 4BH7B 4POUB 4XB8A 3LOWA 3UTTA 4RGMC 4X7EC 3WNNA 1ZEAL 3NA9L 3BH8B 4ZUSB 5ID0A 3EYUH 2VDLH 5KN5B 1R3LB 4YGVA 2XZAH 3VRIB 4EIGB 1RJZB 4MXQC 1D5MA 2FSEB 3HUJB 4JM2A 3TNMB 2PO6C 4YDKL 4NQXB 1N0XH 1YEJL 3LKPA 4OQTH 5C9KA 4PJAE 4Q6IA 1LO2L 2HKHH 2P1YA 3WUZA 5T1DL 4L5FH 4M7ZB 1KXTB 2A83B 4NBXB 4OGXH 5IT2H 3EZ8A 1E4XH 4NHUB 2VZSA 3RVVD 4NUJB 1G7PB 1MIEL 1KLFA 3QDJD 1S7UA 1ORQB 5EFIB 1K8IA 1P7QD 4F8QA 4H1LB 2AKRB 1MCRA 2F15A 3VG0L 5EZLB 1NANH 4CW1A 1HDMB 4IOFC 2R0ZL 1HCVA 3MREA 5MEQB 2FD6H 4HAGA 2X70B 5EBMA 2Z35B 1HHGB 1AGBA 4JFPA 5A16B 2KZ1B 1MI5E 2CXGA 3MLXL 1NUGA 2AABH 5LVEA 1YN7A 3QPXH 1OTUC 3C60B 1JYWA 3MR9A 3LRSB 3MFFB 4M5YL 3LEVH 5DD0L 4LKCA 1T1XA 4JFYB 2C7UB 4PJ5B 1AGDB 1A1MB 3JV0A 2YA1A 4U7SA 3VXSD 4Z76A 1CGSH 4N68A 4XCNA 2UYLA 1T2QL 4OBSA 4QRSA 4QRPD 4X7TA 1WWBX 2RBLA 4S1DC 4AEIL 4HLJA 3TYGL 1JMXA 5INDA 5DJ0B 4CRPA 4FQXC 1GGBL 1CFSB 3LHPH 4AEHL 3X3FL 3B9KC 2R1XB 3PWJB 1NGWA 1WFOA 2NTFA 3BUYB 5B3JE 4JPWL 3CU7A 4I1NB 1R3KB 1F11A 3AUVA 3PABA 2V7NA 3ARFB 3T1WA 4JCLA 1TVHA 2NY0B 4YHNA 3O0RL 1KT2B 1RURH 1KJMB 3DRTB 4HGWA 3O2DH 2NY1C 5C9JB 3ZKND 4LCWE 1NBQA 1U93A 3IDIA 4LPXA 5DJXB 4OZGF 2ZUTA 5F7DA 2EECA 1J1XH 4Y4HA 2Z93B 1NEZA 3GSNA 4P3DA 3LEXA 1RZFL 4I5BB 1CLOH 4KKCD 5F88B 1A6UH 1BWWA 2VDNH 2EIDA 3B83A 2J7LA 1MCPL 1NLDH 2EC9U 5H2BA 5K9KA 4YBLC 2LU3A 3QB7C 1FORL 1Z2KA 43C9A 1YQVH 3EO0B 5SWZB 5D1XD 5IVXF 5I8CA 3JWOH 1HSBA 1KJVB 1DSFH 3C5JB 3KJ4B 1A3LH 1KGCD 1T3FA 4Z5RB 1UZ8B 4Y5VB 3W0WE 1IAOB 3JTSA 1CG9A 5IJKA 4KAQL 4PP1C 4M7LL 1RULL 3C6LC 5I2IA 3UC0L 2AJXL 3GM0A 1X5LA 3RIFK 1IT9H 3TBVB 5C0ND 4PTTB 3I6KA 5EC1A 1O7SA 1MVUA 3BGAA 4P9MH 4XAWL 4FABL 5SV4A 4JVPA 3B2VL 4K7PY 4ZTOH 3S34L 7FABL 3GNMH 4HH9B 4RRPA 5D7LA 2KL6A 5D7JD 1BEYH 4LVOC 4Y4HB 4NCC1 4JDZB 1U3ZA 5DJYB 3MRBA 1GGBH 2BVOB 4MAUH 3NFPA 1P4IL 4TQEH 1A21A 1OD7A 1PG7W 1YMMA 3DXAE 3N1PC 1QVOB 2P5WD 2V5MA 4GW5B 3QXAB 1BMGA 1EEYB 3DI2B 4CNIB 4X6EB 3F7VB 2VQ1B 2DDQH 4XP1H 1T03H 2X40A 5F1KC 5ITBH 5KVEL 5JMOC 1K4DA 4MWFB 1EDQA 3O4OB 3VXME 3MRFA 1NUFA 2DMKA 3QDJE 4PRHD 5IMMB 1EJOH 1RJLB 1KLGA 2IH1B 4WO4D 3D2UD 3C2SA 4X5XA 4KQ4H 2FHFA 4YXKL 3CLFH 1CXEA 3L5XL 1JPFA 3IU3B 5DRZA 3Q6FB 4G6JH 1RD6A 2V17L 3ORJA 5CZXD 1MJUH 4ZPTA 3VH8A 4F7CB 4PJCE 4PJBE 1TTFA 4Y5XC 5D9SA 3MOQA 4HJJL 1OTUD 1P4BL 2APXA 4YHKL 3P0GB 1Q9KB 3BZEB 1QHOA 3KPSB 4UBDD 3SDXA 4N1CA 1YPZA 4KQ3L 2YD7A 4UNUA 3L5IA 4P4RB 5D1XB 2CKNA 1OLZA 1DUZA 3QG7H 1I1YA 1RV6X 1AY1H 2QV2A 4KVCH 1FIGH 3B9VA 3KPMB 2BY3A 5E6ZA 4X8JA 2ADGA 2FEDC 1FZOA 1U58B 2WIIA 3WHE1 2WWMC 4AQOA 1IAKA 4G6ML 4G8GD 2YD4A 5EC2A 5B8CA 4DQOL 2Y36H 3DECA 3BE1L 2QL1A 5JLZA 1MJ7L 5HDOA 4L4TD 3STLB 2OJZH 4LRNH 4OD2B 2VLRB 4HT1H 2YPKB 2PYFB 4H8WH 1UXSA 5D7LE 2GTZA 1DBML 2DLFH 5JQ6H 4ZUUB 2IH3B 4I77H 2DMCA 4RIRB 2FL5B 1S7RA 3RFZC 2B4CL 4AZ8A 2WSKA 1DQMH 2FX9L 4MMXC 5GGSA 4NM8H 1RJCA 4Y4FA 4KK9C 4G9DB 1C5CL 5D1QA 4ODTL 3VGHA 1G7JA 4GG8B 2DQDH 2VSCA 4ZQKA 2IMMA 5AWNL 5HJ3A 4M7LT 4X5WA 4PY8I 4DCQB 3BEVB 3PV6A 1A9BA 5J3HD 3P30L 4PB9H 3AM8A 5DUML 4LCUA 3CDYA 3MMEA 5MEPB 3L6FB 4RISH 3U0WL 2EO1A 1T1YA 5C8JB 4YXHL 4QHMA 2Y72A 4IDJL 2VXSH 3IXTA 1K4DB 2LQRA 3ZKMC 1NGYA 4UQ2B 4M6MH 1AR1D 2SEBB 3P9MA 1FGVL 1Q9LB 4QHLB 5IV2B 4NC2B 3U48A 4ODVL 4JKKA 5GRXG 3MXWH 3DOSA 2JJTC 4NN5C 1HKLH 5I66A 2XY2A 3D1MC 1NGYB 1F42A 2X2YA 4JKMA 4MA8H 3SHSA 3NCMA 4ZNEE 1PZ5A 3SDYH 3VXOB 2KQNA 4OCXH 1OAZL 3MA9H 4JFED 1MWAA 5I8EB 4YHMH 2ZCLL 3FQRA 2BNRE 3FT4B 4AEFA 4H5SB 3WIHH 3FRUA 1ACYL 4NKMB 4W6XB 5IFAL 1KLUA 1IFHL 2O5ZH 3EHBD 1U95B 3I02B 2UY7A 5ISZD 2VYRE 1BLNA 5T5NG 3NIFE 5F7EL 15C8L 3LPWA 2R0ZH 1EUTA 2HKHL 1J5OL 2FJHA 1KENL 1JYVA 1AXSB 1GOHA 4RMWA 4K3EL 1M6OA 1N26A 3Q1SH 5E94A 3RWGB 3NOIA 3KPOB 5C0GA 1BD2E 3JTSB 2FX7H 2EKSA 3PWVA 1N6QH 5LCVL 3IKCA 5CUSL 1C16A 3FOMA 4KZDL 3VRJA 4LGSB 3GMMB 4ESKA 1X5KA 2E9WA 2GK0A 5HYEA 3KYOA 3W9EA 1R0AL 2XTJB 1RK1B 4K3EH 2FIKB 4JRYB 4DKFL 1DN0A 4K9EC 3MV9A 2EE9A 1UQSA 4NN7B 5JORB 3BH9B 2AJ3A 1KCKA 4E5XB 3DX9B 2IALA 4RWHA 4QF1A 1CTOA 5D2LF 1A1NB 1L7TH 1N59A 5BXFB 2KQMA 3INUH 1YUHA 3WV0A 1QRNE 4KTEH 1HNFA 2EDXA 2CK0L 4M62L 4O2EA 3WYRA 5DJCB 1UGNA 3VGAC 3JWDL 3HKFA 1MFCH 4CADA 4GG8A 4ZYKB 5IMLB 4BFIA 3D5OF 5EN2A 4MNQD 4G8GE 4CVXA 4HJGB 5E8PB 2EDQA 3MLYH 2X4OB 2WINA 2VDOH 4X5LA 1U92B 5IMOA 3SKJL 4RAUA 4NM4L 5IBLC 4EJ1C 5GPRA 4Q9QH 5EIQA 1UFUA 4YDIL 1I1RA 1F4WH 2WQRA 3MUGB 4LHUD 4UOW1 4P59L 3VGBA 3GMOA 5D4QA 4YPJA 1NANI 2VDRL 1CDBA 4NO3A 2LV4A 5IB1A 2DM7A 2V5YA 3DMMC 1D6VL 3NFSL 5FUCC 3BKJH 5C0AA 2CR3A 3QIBB 4M43H 5C0EB 5FECA 5D6CB 4I0PA 4KI5C 1S7XA 5KJRL 3MLVL 5FYLL 1N64H 3K4AA 2IQAB 5IR1B 1MOEA 4TUOA 4W4OC 3VXMA 4YFLF 3CSPA 3KLAA 1AGBB 5T1KA 1HQRA 5EWIH 2F53E 3T77B 4HQQL 3TLRA 4B7LA 4U1IB 4K7PL 1J8HE 3C6LD 3D3VA 1FV1B 5IEKB 3CSYB 5TH2B 3IDUA 1HQ4B 3VGDA 3AAZB 3T77A 1JPTH 1VKXB 1I3GL 4DKAA 1S9XA 3WHXA 3P11H 3AU1B 5CGYC 3MCKB 5TPWH 3PWUB 4ETQA 3L95A 3BPOB 2Z8WC 4IJ3C 4I0PB 4U7KA 1XF4B 4EQ3A 1LDPH 2GY7B 5D93C 4AIXA 4NFDA 1NC4D 1T04B 3O6FC 1Q1JL 1LE9A 1WBXB 5DO2D 3P4NB 5JIPA 2AV1A 3TBVA 3IJHB 1CCZA 5CEXA 2ZNWA 1YEHL 4FN0A 5ALBH 4OZ4A 4G3YH 1LK3H 4HS3A 3UBXB 3VI4E 1JWSA 1KPUB 1PX3A 5T1LB 3ZKNC 1JGVH 2VQTA 4OJFL 2C4FU 1AD0B 5M7QA 2HG5B 4LASL 4LU5H 3KPLA 4GKNA 2VDOL 3BP5B 3ZDXF 1JGDB 1INDL 4EUPH 1N6VA 4HIEB 1QSZA 2AS5M 1OB1B 3QQ4B 4XI5C 1XFPA 3VXRB 4KH2A 3WO4B 5DJCA 1T22B 3TBTA 5HI5C 5IQ7L 5ESQA 4ZYKA 1SEQH 4KPHH 1H8NA 4UV7L 1U95A 4PLNC 1YUHB 2YN3A 3I2CL 4M8QB 1OCWL 3V4VL 1A6VL 3EDJA 1EEZA 2V17H 4G43B 3MV7A 4XVUC 5CWSA 4DN3L 3KJ6H 5E2UL 2I9TA 1TNNA 2YD3A 3MRQA 4Z78A 3QZWB 1AQDB 3E0GA 3AY4A 5BZWB 2R1WB 1BBJB 1HH9A 1FVCB 4HUUB 4F57H 1OAXH 3JWDH 1M1SA 4O2CB 3NZ8A 4AM0A 4PRNA 1U6AL 5C0CB 3UYPA 2Y9RT 4ZUTB 5CBEA 2A0LC 2N7BA 1X9QA 3VRJB 3S4SG 1S7TA 2F58L 1IAII 3MGTA 2HMID 1I8MB 3DUUB 2C3VB 1TCMA 3H7BB 1JNNH 1JPSH 4ZSOE 3TO4A 5J1AB 4N5EC 3D9AL 1EGJA 1WCQA 5I71B 1YEEL 4JM4L 4KI5D 5I1EL 5HDBF 3W11D 5ERWA 4C56E 3S5LG 1B9ZA 5CZVL 2D7QA 4YGAB 1W8OA 4AIOA 1IKFH 3VWKC 1CBVL 1T0PB 4Z7UF 5I73C 1HEZB 4XBPA 3QP3A 4PTUA 3N50A 2ESVB 2MQ3A 3TT1H 1UZ6F 3QUXD 5C6TL 3V5KA 2HRLA 5JW3L 1ES0B 1NDMA 4EDWL 5DI8B 5F21B 3MV7B 2R1YA 2B5IC 1ZLUK 5F6HJ 3LPFA 4PY7B 2J4WL 1ZA6A 3AAZA 3EYQC 4PREB 4I0PC 1TVHB 1TZIA 3MRDA 4JQXC 1VKXA 4K7FB 3DVNA 2NXYD 4KJWD 2NYYD 4Z7WA 2XICA 2X4UB 3QXDA 3WJJA 5D2LB 2WAHA 2G5RA 4NYLB 4I3GA 4Y0GA 5DJ8A 3U4AA 5EUOF 4N0CD 5FA3B 1MLBA 3ZDYE 3PL6B 2ADJA 5D7SH 5D96C 5A2KH 1RY7B 3DUSB 5C7XH 4F9LA 1X5GA 4WW2B 3BP7B 5C0EA 3KXFA 3MRCB 1QSEB 3U46A 1BOGA 4HS3B 2DM4A 4Y16D 1IGTB 1CGVA 3CFKA 3BYYA 2IFGA 4MQXD 1FDLH 1SJEA 1A6UL 2X09A 3MROB 1INEH 4TRPH 4UT7H 4OM1H 4HIHA 4DCQA 5AZ2H 5GJTL 1QQDA 4MNQA 2EDDA 5BZDB 4CUCA 4RWYH 3H3PL 4WU5B 3TJEL 4HW6A 1DJSA 4XCYB 3B5TA 1T7VA 2Z92A 3T2NL 3P73A 3MO1A 4NOBA 1U92A 4OCYH 1UJ3C 4D3CH 5F6IB 2QKIA 1UKTA 4M1CC 2BRRL 2R2HA 4G6FD 4P2RD 2UY6A 4RGOL 3PQYE 1GL4B 3CSGA 4MQSB 1A0QH 4GFTB 1XH3A 5C6PB 1R0AH 4TVPL 1G7PA 3CVHH 1K6QL 4MD4A 2MQ0A 3O6FA 4HHAA 4H1LA 1AIFB 4R7NA 5E2WL 1G6RB 1NGXB 1ITBB 3TA3B 3V9FA 1CLZH 1NMAL 4KFZC 4M4RA 1MY7A 1QBLL 5LGHL 1G9NC 5D6CA 3A6CL 4LLYA 3O81A 3P4OA 1JV5A 4NQVB 5HGAB 3QDMD 4XNMB 1TZHA 4JQVA 1E6JH 1S7QA 4G9FB 1LO0H 2WIIB 4RA3A 2A6JA 3QUXB 4Y2DB 5K9OB 4U2YA 2YHGA 3BHBB 5J3HC 2EDHA 3QO1A 4ELKB 1T6WA 1U8QB 1I4FA 3GDBA 5I76B 1S5IH 1OM3L 1BAFH 5EUOA 3WXVH 2DQGH 4X8XA 4YFDB 3EDEA 2EE2A 3EJYD 3MFGB 2DBLH 3ZKQD 2NZIA 3KPOA 5C0GB 1QR1A 5FKPA 4LMQE 4P2OC 3QEQD 4JFFA 1VFMA 3CXDL 1W0VA 3MUZ1 3UC0H 2R0LL 5GRUL 2XKSA 5DTFB 2DKMA 2DJSA 4B0MM 5DFWH 4Z95H 5E9DA 1FBIH 2NY6D 3I6KB 2Q3AA 2BOBA 3PL6C 5TE6L 4G7YL 5KVGH 1OCWH 2PW1B 5M95B 5D72H 1YNKL 1ZLUH 4NN7C 4OZIB 1LO2H 3N0PB 3S35L 3MA9L 1WF5A 1V3JA 4ZMAT 32C2B 3IFOB 1WBYB 4S1SL 1I8MA 3BWAB 1U8NA 1JTPA 2DKUA 1L7TL 1KIQB 2P44B 3MCLL 1WIOA 3U36B 4GG6F 4E9LA 1EVUA 1EO5A 4AIZB 2YEZA 2OL3B 3SBWC 5GZOD 2APTA 4ALAH 2EYTB 1JHKH 3R06A 1FJ1B 3V7AG 4JPVL 4W4OA 5D96B 4X4MA 5DUPH 3EYFB 3B5GA 1HHHB 4GOSA 3AROA 4Q7DA 3GI8L 5DR5H 5F1NB 3ZTJG 2W9EH 3ELAT 3QG6A 2FDBP 1OP9A 2EH8L 4MJ2A 4MCZA 3DVFA 3RBSA 1M05A 1S7VB 1FYTA 2C26A 1BLNB 2BSRA 2RQ8A 3QXVA 2E27L 5EU3B 4AG4H 1XZ0A 3ARED 3NIDF 3MRRB 1T0NA 4X6BB 2HKFH 3KPNA 2K9UA 3EYSL 3QFJA 4ZUVA 4UIKL 2R39A 5DJ2B 5MEOB 1Q9OA 3ARGC 4JRXE 1MFEL 3DNKA 1QPPA 1MSPA 2EDFA 4LLQA 1AD0A 3TZVB 4R90L 3NIFF 5J89A 3NPSC 5D1QD 5IF0B 1GZQB 2VXVH 3GSWB 1XGPB 4PJ8D 5JHDA 2V5SA 4PJCA 1B2WH 1X4XA 4YE4H 5JO5B 5GSRB 3P0YH 4XTRC 1JZ2A 1DFBH 1FAIH 3VMPA 5JIKA 5K9QI 2W0LA 2GJJA 3HPJA 5B38G 4JRYE 1FH5H 5BCAA 5HY9A 4H20H 3ARGB 3CXHJ 3EO0A 3WIIL 2V5RA 5T3ZH 3MBEC 5CJBA 3L95B 4UQ3B 1VENA 3F6IA 2Y06H 4ZXBC 1TVDA 1A7PH 3MUJA 3ABZA 3T0VA 3VFPB 3EZJB 4I8DA 5C09E 2EKJA 2VLKB 2I07A 3C60C 1UH3A 2QSTA 3MOAL 4LLVA 4L4VE 5DVOA 1KTKE 2VLMD 4J4PA 4L8CA 1MHHA 2NW3B 3ARSA 3T1FB 1CE1L 3OKEA 3SE8L 3OMZA 3EIFA 1GHFL 2H41A 5J9PA 3U6RB 4QRUA 3EGSB 4HEPG 2JIXD 5SWSE 4U6TA 1UXWB 2GITA 3CDGB 4WFGD 4R7DB 4RNRB 5C0JB 3TP4A 1KXQE 4PGBB 5K59F 5HVGB 4NUJA 3WN5A 4QOKE 2WBJC 3HUJE 5AAMA 3RY4A 2VKWA 1OT1A 1TPXC 1DP0A 4HUKB 2V5TA 1T2QH 4JKWA 3UCRA 5B4MC 4XCNB 2DWDA 1DANU 2BHYA 5DSCA 3S9DB 4KTYA 5F9DC 3WKNA 4N0FB 3ES6B 3O3DB 2ORBL 2CLVB 3MCKA 2AABL 3WUWA 1H3VA 3EW3B 3FTGB 3HC0B 1KYOK 1UM6L 3MV7D 2QR0A 3D3VE 1KTRL 1I8LA 4U1LA 1LO4L 2UV3A 1OAQL 3QXAA 5B21A 4EN3D 2FWOB 1NQBA 4NO2A 2RB8A 3BZ4A 3MLSH 1KB9K 5DWUL 2H3NA 1UH4A 3RL1A 3ZMRA 1TXKA 4NNXA 1W0WA 4MA3A 1IAIM 1M7IB 1VEMA 1WBZB 4JDZA 1FIGL 4M3JA 2VXVL 4R96A 2BHZA 4GXUN 1TQCB 4MDJA 3VMNA 5I1DA 4QF1B 3H42L 5JDJA 3QIBA 2QQKH 1Q38A 1F2QA 3VD4A 1L9NA 3DXAB 4UDUB 4YHLL 5DK3A 4XNUH 2LE9A 4PRAB 1UKSA 3EYSH 1NKOA 1MWAL 5MI0C 5D2NE 4OGYL 4P46C 4ZO8A 4C56A 3DARA 4N0UB 5E4IA 5H35A 2FSEA 3HUJA 2ADFL 1TETH 3L5HA 3V4PH 43CAA 2XA8L 1RZFH 4XNZC 3O41B 4TVSa 1U8HB 3ME0A 4WUKL 4PJXA 2I26N 3GK8H 4Q2ZA 4XP6L 1AXSA 3PWPA 1YEIH 4U31A 4Y4KC 2BNUA 3DGGA 2BRRH 2HA1A 1Z9OA 5FDWB 3SPVA 3TT3L 1S9VB 2EEDA 3T04D 5TDOB 5A2IH 2DBJA 5DJDA 3M17A 4XI5D 5DJAA 3TA3D 4L4VB 1RMFL 1QSFB 3TYGH 4JY6A 5E8DH 2V7NB 3PABB 1MCDA 3LN5A 2EE3A 3QRGL 1DBJL 2J5LC 1MHCA 4JO1H 4ELMB 4AIZA 2MFNA 4FFYL 3S4SA 1WCBA 1KCVL 4ZTOL 4XAWH 4JN1H 2KH2B 3D85A 4DFHA 3C2AL 2F5BL 3MRHA 1G9NL 4EBQH 1URLA 1IM9B 1LILA 1QO3B 1W0YT 4KU1A 1X44A 1ZVHA 2VLME 3O6LL 2X05A 5C0AE 4X7TB 3GJEB 3TFKC 1HHJA 5L2JA 1NJ9B 3KPQA 4UZGA 2CO7B 3UTSB 1HI6A 2GTWB 3UZVB 4MAYD 8CGTA 4QYOA 4PGZA 4WI8A 4XAKE 3DMMB 3W9DA 12E8H 1NGZA 4WW1A 2A9NL 1KFAL 4PLJC 1AY1L 4WI6A 4KDVA 4R97C 3TN0A 3C08H 2EDWA 4PB0L 1HHGA 1G7JB 2ID5A 3WNMA 1TTGA 2W65A 4P9HH 4ORGA 5D70L 3BP6A 5AYUH 1YN6B 1CLOL 2BMKA 2I9LA 3HG1A 4LHQB 3IDGB 2QQQA 1NCUA 2H32B 2WK2A 1FL3B 1V3KA 2YPVL 1MI5D 3RWEB 2NPLX 3OJ2C 5HHQA 4Q97A 3GB7A 3VXMB 1ERNA 1NMCB 2ZJSH 2M2DA 1J0YA 3MRGA 3WXVL 5AD0B 4LGRB 3RUGF 2EEBA 2X1QA 4M3KB 4LVHB 3BKMH 4HXBL 1BREA 1XEDA 5JQHC 1QLFA 4QRSB 1ZHKA 3GI8H 5DR5L 1MHEA 1NC4A 3CU1A 4UU9A 2VLJA 2EDLA 5FO8B 2WUBH 3HI1B 2AQ1A 2YPLD 4QT5B 3RZCB 3QNZB 1YEKL 3A0OA 3V6OE 5CMAB 4YDVB 2W9LA 1P2CA 1U58A 35C8L 4KDWA 4GSDH 5DRNA 5HYIA 4G7VL 3V6OC 3E3QE 4JFFE 2AQ3A 3NCJH 1QBLH 1T5WB 4JKLA 5LGHH 5KZCD 2GK2A 2AI0H 4NZTH 3UTPD 1H15B 1WWAX 3E6FB 1QSED 1WAAE 2C5DC 4FQCH 4L4VA 4D9QE 4HIIA 4P3CL 2FGWH 5DMYA 1ZT7A 3DVGB 3PIQB 2V7HB 1YNKH 4BH7A 4M5YH 1QQDB 1JPFB 4QXUL 4OFYA 3KPRB 5MERB 1MCCA 1KEMH 2UZIL 1FZMA 4O2EB 3UROR 1ZA3A 2V2XB 5I1GL 1INDH 4FNLH 5GRVL 1CLYL 3ZYZA 1K8DA 3VRLF 4WO4C 5D7IE 1RI8A 3K2MC 4Y16C 3BXNB 5KSAD 2UWEA 2V9QA 3K2UH 3CJJA 5C0FB 3FO0H 5CJQL 2GSGB 1KLGB 3PWPE 4HFUL 3RRQA 1YYMH 1DBBH 5EC2B 5B8CB 2P43B 3MJ7B 4JFZL 4EUPG 4PJXE 2W0FA 5HYJD 1LVEA 4OZFB 4KKNA 4ZS6D 1A7PL 2IG2H 4KY1L 3HC0A 1WFTA 4IRSA 4M61A 3CLEL 1G1CA 5C0IB 2L7JA 3SOBH 3ZTNL 4X83A 2DI8A 4DK3A 3IS1X 3GEWB 1J1PH 2ILLA 1P2CB 4LVNC 4MNHB 4YEEA 3VGEA 4D9RD 1BD2A 1NBZB 5E5RB 5F7WC 1BFSA 3ULUE 1MEXH 2V2TA 3SDXB 5C0AD 5JOEA 3MRMB 4WHTB 4LNVA 3GKWH 1PW3A 1UVQA 4OLYH 2DMBA 1A6AB 3ULVE 4L8DA 4X0KA 3VDBA 4K3JH 1R3HA 3U4BH 1EGJL 5FCUH 3VXMD 1D5BB 4Q6IC 4OSUL 2D7TH 4PJXF 1J0HA 3SE4C 1JNHA 1NCDH 1KLUB 4ZOCA 2FBJL 3RL2B 1AH1A 5IB5A 1CFQA 1KF9B 1A0QL 1INQB 3QDME 3BAEL 4PLKC 5CCKH 3L3HA 4X9IA 3RWJA 4GH7B 4AK1A 3QUZD 1JN6B 3KYNB 2A6KA 2VL5B 1D5XA 4ORZC 4NPYB 3OR7A 3MACH 3HNSH 3RIFF 4KRPB 4NQUA 5E2UH 3REWA 3B4NA 4D3CL 3BT2L 1JHLL 1JPGA 4U33A 4Y1AD 2D03L 3U1SL 5DEFB 1NDGA 5IROA 4U7MA 2A0LD 1DUYA 2YBRB 1Z9SA 3K46A 3BJ91 4XPGL 5H94B 4JG1H 4LBEB 2XN9E 4HUVB 3AMKA 4MJ5B 3FJTA 4TUJB 1IQWH 5CEYB 1BGXH 1U8IA 4Z7WE 1J0KA 3JTTA 5GGUA 5CP3H 3K3QA 1QRKA 3O11A 3RBGA 3H9HA 5ADPL 1OGAA 4WEUD 4FQLL 4XHQA 5TFSH 3OJMB 4WGVB 3RX8A 2FJGA 3S98A 3LD8B 1EUUA 2FR4B 1NGQH 1L9MA 4NJAH 2BY1A 3NFNB 2Q7YB 3ARBC 4JY5H 1HSAA 2BFVH 5D7SL 3MV8A 5C7XL 4PJGA 3OKOA 1DFBL 4F33A 1AHWA 3GGWA 3FONB 3E6FA 4DK6A 3PJSB 5DYOB 1FC2D 1JNJA 4C4KT 2NY3B 3TNNB 1PGRB 2AJZB 2N1KA 2PR4H 4HKZA 1LMKA 4IM8A 4JREC 3ULVC 1T1ZB 4GMTH 4Y5XB 1XF2B 3ARWA 5DHXB 2DF3A 1RUPL 4HMCA 5IHZB 3ARBD 2FJFA 2BFVL 1DQDL 5E6IB 2NY0D 3MLTB 1YNLH 3G6DL 4JHAL 3PDDA 4XMKH 1WJ3A 4U3XA 4Z76B 3KLSA 4IRZL 5CEYA 5T5FH 3KR3H 4JN2A 4DJMA 1H3PL 1NAKL 1CICB 5C2UB 4Y19B 5CHNB 3V6ZA 3L5WA 3RU8H 5TGBA 5D7LD 5GGTA 3OX8B 4KMLB 5CBAB 3QUYA 4MJ4A 4LLQB 3DWTA 2IPKA 1CYGA 1YEGH 2AEPH 2X89D 2NLJA 2XWJA 1X6LA 5LXGL 1H3UA 1CLCA 1RIUL 1YPZE 5BW7A 4OBRA 1CF8L 4HLZG 4GKOA 5C86A 4MD0A 4PJHF 4X6DF 3MCG1 5I1HH 3UDWC 1WT5C 2NY4C 3L3HB 4XXCC 2OJEA 4IBLT 2YC1B 4K94L 1JPTL 4TSBH 2RCSL 5DD3H 5MEND 2CDGA 4XX1E 3DBXB 1CWVA 3M8OH 4GQPH 1KJ2B 2ITDB 5HI3D 1GSMA 3EOBA 4HQQH 4F9LC 5ADOL 4QWWD 2UVEA 3SQOH 1DQQB 2YD5A 2VWEC 2CRYA 1UADC 4XVSL 3I3DA 1NFDF 3H9SD 1A7BA 1CGXA 1FCGA 1PKQA 2CSPA 4XHJC 4NZRH 4MJ5A 1MFAL 4FQJH 4PJ9A 5TFSL 3LD8C 3RGVC 5E1HB 4FP8L 3LN5B 3TVMD 2F5AH 4XTRD 3AVEA 2EDTA 2GJ6B 3NIGF 5KG9A 4KY1H 3BGMA 4OT1L 4ZO6A 5EDXA 2OBGA 4X6DA 2GY5A 4N0FA 4HDIA 1QOKA 2VABA 1QSEE 2W0KA 3VXNA 3MBED 3DETC 4Q9QL 2V2XA 1S7SA 3BSZL 5F7KC 4TN9A 3KLHC 4JZOA 3U0PA 1DZBA 2WBKA 1CQKA 3D0LB 5KW9H 1IGCL 5DVNA 2B4CH 2VABB 2EC9T 5KS9A 3QYCA 4PS4H 3WKML 1CR9L 3D0VB 4U1SA 2R0WL 1BM3H 4YHPB 4OF0A 5F6HI 2F19L 2CDFB 3HNTL 5IB4A 1P6AB 2DTML 4J4PD 3BPNC 1V7MH 2X9XA 4W68A 5FV1L 5HHVL 4PRPB 5E8EB 2DQTL 3U30C 5K33A 5D2NB 4PJ9B 4KTEL 1F4HA 4OSUH 3BMWA 4WUUE 4HWEL 1CDHA 2AEPL 4PJDA 5EA0H 4W81A 3U4BL 1MAMH 3OKEB 4KGJA 4L8CB 2BNQD 1JK8B 3GKWL 4GSDL 4NQEE 2PXYC 1GZPB 5CS7A 4PJDB 4TPRH 3WJLA 4DOHE 5I6XB 5FHBH 1YDPA 1RUML 1R5WB 4UDUA 4HX1B 4JLRA 2H6PB 3FCTA 5IIEA 3P4OB 2JIXA 4V1DA 5E5MA 3ZSTA 4RMSA 1MCHA 4GKSB 1CGWA 2DD8L 1P5UA 1BBDH 2DAVA 3ARUA 3G5XA 1YC8A 2ZUUA 3MJ8B 5H2BB 5K9KB 3UYRH 3TCXA 4ZFOL 4NQTA 3NGBC 4RCAA 1YYLH 4MA7L 4JZOB 4BH8B 5JZ7C 2Q8BL 4POZD 3RTQB 3S7GA 3SDCC 4K8RC 1VGEL 2Z93A 4P3DB 2H2PC 2D03H 3QXDB 3RUGA 3CD4A 1KCVH 4I4WB 3HC3H 1YMME 1T1ZA 3C5SA 1NKRA 4GS7B 1U3HA 3CK0H 5CJ5A 1BZ7A 4EDXA 2CH8A 3T08A 4MXVF 4L1DA 1CXIA 2GSIB 2XXCB 2FO1A 2HTLD 1EJOL 4N0YL 1OSPL 2JLLA 3K8MA 1WZKA 5KBNC 3EYVB 5IW1B 4QRRA 1MRCL 1MH5A 1OAKH 1PKQB 2DL2A 4CDGC 5JW3H 5HSFA 1EO8H 4MHHG 4PGDA 4HC1L 2HVKB 5L2JB 2AI0L 1A6ZB 1JPST 2K7PA 5GSVA 3F5WB 1VA9A 3U7WH 2XFXA 2WBJB 1NJ9A 3KPQB 5IIEB 3FFDA 3H7LA 3MLRL 3KXFB 4NQCE 4O9HL 4WU7A 5BS0D 4UMGA 3BDYH 1A1MA 4PJAA 1MF2L 5GSVB 1G9ML 2DLHA 5J8OA 3F12B 5GGSY 4GMSH 4XPBL 2PO6B 2YEZB 4HKJB 2AJVH 2J8UB 3DV4B 1HXYA 4JDVB 3BJLA 5IUSA 5JW4Q 1D5ZA 3BKML 3NPZB 3JWNC 2YRZA 1T03L 4P2YA 5CIPA 4LCCA 1X5JA 1NDGB 1EIBA 3BP6B 4KTDL 2DKSA 1IM9D 3HG1E 1DTUA 4QXWA 2CDFA 3WEXA 4PY7A 5ACZA 1FGNH 3MREB 4OFDA 4POZC 5MEQA 1S9VA 1FO0H 2CKBL 2F53A 4BQ9A 3JZ7A 4Y4KB 3M17B 5IESL 1RULH 2BVQB 2GCYB 1IEBB 5HYSB 2MSPA 5FDWA 3N1GC 4G8EB 4X9GA 5IFAH 4OTXH 3WJJC 1QFWI 2VO5A 2ZCKH 1P7QA 1EA9C 3SDDD 2QSQA 3KPRD 4C55A 4FXLA 5FO7B 3TPKA 2HN7A 1G0YR 5GGRY 4N8PA 2MWCA 12E8L 4BSWB 4WUUD 1XCQA 3UP1A 2IAMC 1IRAY 4FQXB 5EH1A 3CXHK 1X5AA 4Z7QF 3RNKA 3BYTA 1J10A 1MJUL 4FFZL 4XWGH 3H7BA 5D2NC 4TOYL 4GKNB 3UZQA 1J8HD 4ZODA 2IEPA 1L0QA 5KAQF 2XWBB 4NP4L 1DEEB 5I74C 3WD5L 1CFQB 3WDHA 3NVQA 3ZE2F 3UTTE 4ODUA 4ELMA 1FH5L 2JJUA 1QR4A 4J4PC 4PRAA 4I13B 4RMRA 2NYYC 3E6HB 4XWOD 5HHOD 5ICXB 4LLDB 4H26A 1FYTB 1MNUL 5EU6D 4P4KD 5KS9E 4OIAA 4KJQD 3LVEA 3RVXD 5IHUL 1MQ8A 2EXWC 3KGRA 1KULA 3HRPA 2VMFA 4PRID 4U1SB 3CH1A 1ED3A 2J5LB 2LAAA 1FP5A 3G08B 5D7IB 3CPLA 2OTWA 3IJSA 1QLEH 2Q86B 4BK4A 2AEQH 2I24N 2MTPA 3D2UA 1IBGL 5JHLH 3O11B 3PP3K 2H3NB 3U82B 2O61A 5DQJB 3MV9E 4KTDH 1AXIB 2ICCA 3BP5A 4NM8L 4OLYL 2GJ6A 5F1IA 2QTEA 3G5VA 1EEYA 4XHJD 4NNYA 1MFDH 4EUPA 3QCUH 2BHUA 2CDEA 4MNQB 2DQUH 1CDYA 3IYLW 2GT9A 3IU4L 2PYED 3GMLA 2C1PB 4GBXB 5EORL 1ZHBB 3ES6A 4OLVL 3HLAA 4HH8A 1G84A 3UX9B 1J1OH 3HE7C 3QFJE 2JELH 2FECI 3QIWC 4L8SB 2ITDA 1EJ6A 2ADFH 2CMRL 3FN3A 2HLFD 4OLUH 1QZ1A 5KSBB 1KJ2A 3T0XA 1XF2A 3MLWL 1AO7B 3IB4A 5GRJL 5LQBH 3QUMB 3RGHA 3VFTB 2NY4D 5I75C 1X5XA 5EUOB 3C6SA 2WLZA 3PWLA 4HJGA 1B2WL 5E4EB 2JJTA 3RWIB 5HGBA 5JXAL 1JVKA 3U9PH 3OGCB 5FO9A 4YDVA 5CD5D 4KGLA 5C0CD 1WLHA 3RDTB 1MQKH 3VI3F 1PX4A 2AXJA 3WLBA 5I18H 5EU4A 1P1ZB 3UZEA 5F9WB 3OX8A 4WJ5B 4KJYA 3GUTA 5E2JA 3INUL 2AV7A 4HLZH 2J6EH 1CXLA 4R6UA 2JJWA 2AW2A 4FQ1L 4HWNA 1B0GA 1GGIL 4JANA 3SGKA 5DO2C 4YHYB 3HI6L 1AKJA 3NZHL 1DUYB 5HVHC 4PGJA 1A6WH 2F5BH 2AK4D 4FQHA 5DMGD 3U2SB 2F8OA 2NY1D 1Y6MR 2VTFA 3PNWB 3CFJA 1B0RA 2GFBA 5CUSH 2Q20A 3PWNB 4EOWL 2J6EL 1N2RA 5EA0L 5TQ0H 3IXAB 4HPOH 5E8DL 2YPLE 4PRNB 1MCNA 5JHLL 4J3VA 2AEIT 5ACMA 4D0BB 1FFPB 3B6SA 3RJDA 4MAUL 4DFIA 4ONOA 2VZTA 5CMAA 5DURB 1AHWB 1JWUB 4PJFA 2IAMD 1IMHC 4EOWH 2NR6D 4OF3A 1CXKA 4OUUB 2XIDA 2BVEA 1XR9B 5CGYD 4W70A 4E0RB 3S34H 1VDGA 2OLDA 7FABH 3DX6B 3BP7A 2R0LH 4UAOB 4YHML 5MENB 4HXAL 2FIKA 2C7UA 1OAZH 1HHHA