1INFA

Influenza virus b/lee/40 neuraminidase complexed with bana113 inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
390
structure length
390
Chain Sequence
EPEWTYPRLSCQGSTFQKALLISPHRFGEIKGNSAPLIIREPFVACGPKECRHFALTHYAAQPGGYYNGTRKDRNKLRHLVSVKLGKIPTVENSIFHMAAWSGSACHDGREWTYIGVDGPDNDALVKIKYGEAYTDTYHSYAHNILRTQESACNCIGGDCYLMITDGSASGISKCRFLKIREGRIIKEILPTGRVEHTEECTCGFASNKTIECACRDNSYTAKRPFVKLNVETDTAEIRLMCTKTYLDTPRPDDGSIAGPCESNGDKWLGGIKGGFVHQRMASKIGRWYSRTMSKTNRMGMELYVKYDGDPWTDSDALTLSGVMVSIEEPGWYSFGFEIKDKKCDVPCIGIEMVHDGGKDTWHSAATAIYCLMGSGQLLWDTVTGVDMAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based inhibitors of influenza virus sialidase. A benzoic acid lead with novel interaction.
pubmed doi rcsb
molecule tags Hydrolase (o-glycosyl)
molecule keywords INFLUENZA VIRUS B/LEE/40 NEURAMINIDASE
total genus 97
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.18: Exo-alpha-sialidase.
pdb deposition date 1995-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00064 Neur Neuraminidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 1infA00
4D8SA 2VW1A 4MZEA 3TI6A 1KITA 1MWEA 3TI5A 2F29A 2F0ZA 4GB1A 4X47A 3SLIA 4YZ1A 3W09A 4B7MA 3INBA 4YZ2A 2YA4A 5HUNA 4MZAA 1L7FA 1XOGA 2SLIA 2HTWA 2W20A 4XILA 2YDPA 2YA6A 4XJ9A 1F8DA 4YW1A 1Z4XA 4GZWA 1L7HA 1VCUA 4CPYA 4YZ5A 2XCYA 3K37A 4HZZA 4FPGA 1MS5A 4GZQA 4GEZA 4YW2A 1EUSA 4MJUA 4MX0A 1V3DA 4HZYA 4MJVA 1V0ZA 1W8OA 1V0FA 1NSBA 4H53A 1MS9A 5HUMA 3K39A 5M1ZA 1WCSA 4FPYA 4FPOB 3H72A 1W20A 4CPNA 2QWIA 4I00A 1NMCA 3TIBA 4XJUA 1IVGA 2VSMA 4XIOA 4WA5A 1W0OA 1Z4YA 2QWFA 4CPOA 1NMBN 4FOQA 4FOVA 1A4QA 1W21A 3O9JA 4GZPA 1DIMA 1USXA 1Z4ZA 1INWA 3GVJA 4XJAA 1F8CA 1MS4A 4QNPA 4BBWA 2QWJA 1V3BA 4YW4A 2B8HA 4XIKA 3CL0A 4M3MA 4FPLA 2HU4A 1IVCA 4K3YA 3O9KA 1EURA 1IVFA 1NNAA 2BF6A 2ZB5A 1B9TA 2SIMA 4DGRA 2QWCA 4FOWA 1W1XA 1Z4WA 4XMAA 2F24A 4WA3A 1V3EA 4K1IA 2VWDA 4B7RA 4QN5A 4KS4A 1INVA 4HZXA 4QN3A 1NCAN 1SLIA 4QN4A 2QWGA 1N1SA 4YW5A 5HUGA 4K1JA 4HZVA 1MS1A 2VW0A 1EUTA 4QN7A 2A75A 1USRA 3H73A 4NC5A 5HX0A 2HT8A 2W38A 2SILA 1XOEA 4M4UA 1F8BA 4FPHA 4XJWA 4FPKA 3B7EA 5F9TA 4FPFA 1IVEA 1BJIA 3ALWA 4NCSA 4FOYA 4Q6KA 2YA8A 1MS8A 4GDJA 3NSSA 4XJQA 4MWXA 3H71A 1B9SA 4GDIA 1L7GA 1INHA 1Z50A 3CL2A 4CPZA 1NCCN 4JF7A 4MWLA 2HU0A 1N1VA 2BERA 1INYA 4YW3A 1INXA 1A4GA 1N1YA 2HTQA 3GVKA 1INGA 2VK7A 4WEGA 3T1EA 1MS0A 4XOGA 2XZIA 2HTYA 7NN9A 1MS3A 4XJZA 2X9MA 4XHBA 4UF7A 1Z4VA 1B9VA 2F25A 4XJ8A 2BATA 3PJQA 4KS2A 1DILA 1NNCA 4FQ4A 4MC7A 2AEPA 4X49A 4XYXA 2C4LA 1VCJA 5HUKA 3TI4A 4MWJA 4K1KA 2VSKA 2FHRA 4FZHA 4YZ3A 5B2CA 4GJTA 4WA4A 1MZ6A 1NSCA 1V0EA 4FPEA 1NMAN 1NCBN 5NN9A 4X6KA 3SILA 2XZKA 4B7JA 1IVDA 4MWUA 1SNTA 3TIAA 2F26A 4MWVA 1A14N 2YA5A 4NN9A 4X4AA 4MWRA 4CPLA 4XE9A 2HT5A 2F10A 4XMIA 3CKZA 3JU4A 2ZB6A 1WCQA 3TI8A 3K36A 2VW2A 2F12A 1SLLA 2VK5A 4XJRA 2XZJA 4KS1A 4WEFA 1EUUA 4J9TA 1NN2A 2W5OA 5B2DA 2VVZA 2QWBA 3NN9A 2AH2A 2YA7A 4HIZA 4KS5A 4FP2A 1V2IA 2QWEA 4GZXA 2QWAA 2BZDA 2HTUA 2C4AA 3D11A 4MWQA 4QN6A 1V3CA 1NNBA 2CMLA 2JKBA 4HZWA 4K1HA 1SO7A 4B7QA 2HTVA 2W5NA 4FPJA 2QWHA 2F13A 1NCDN 1W0PA 2RKCA 4FJ6A 6NN9A 4GZTA 4GZSA 1E8VA 4FVKA 1W8NA 2HT7A 3K3AA 4H52A 3TICA 4KS3A 4M4NA 1E8TA 1F8EA 2F28A 3TI3A 2QWKA 2VK6A 3ALXA 4M4VA 3A72A 1MR5A 3H6JA 4MWYA 4CPMA 5JYYA 4SLIA 1E8UA 3SALA 1NSDA 2F11A 4FPCA 4MWWA 2AGSA 4B7NA 3GVLA 2AEQA 4XHXA 3SANA 1N1TA 3A71A 3CYEA 2QWDA 3K38A 1INFA 1IVBA 1MZ5A 1S0JA 2F27A 2YDTA 4GZOA 2HTRA 3OPZA 3D12A 3B69A 3BEQA 4YZ4A 4FP3A 1S0IA
chains in the Genus database with same CATH superfamily
2IAVA 4D8SA 4IFJA 2VW1A 4MZEA 3TI6A 1QBIA 1KITA 1MWEA 3TI5A 2F29A 2F0ZA 2IARA 4GB1A 4X47A 3SLIA 4YZ1A 3W09A 4B7MA 3INBA 4YZ2A 1CRUA 5D9DA 1RWLA 2YA4A 5HUNA 1Q7FA 3AMRA 4R40A 3HRPA 4MZAA 1L7FA 1XOGA 2SLIA 4CHBA 2HTWA 2W20A 4XILA 2IAOA 2YDPA 2GVVA 2ISMA 1U6DX 2YA6A 3TC9A 4XJ9A 3S94A 4AH4A 3E5ZA 2HQSA 3UC1A 1F8DA 5H47A 3WDZA 4HHQA 3G4HA 4YW1A 1Z4XA 4GZWA 4ASCA 1L7HA 1VCUA 4IN4A 4CPYA 4YZ5A 1K32A 2XCYA 3K37A 5CGJA 4HZZA 4FPGA 1MS5A 4AGIA 4GZQA 4Q1UA 2W8BB 3ZGCA 4GEZA 4YW2A 1EUSA 3Q6KA 1RWIA 3A9HA 4MJUA 4MX0A 2W8BA 1V3DA 5GX2A 4IYGA 1OFZA 4AHAA 4HZYA 4MJVA 1V0ZA 1W8OA 1V0FA 1NSBA 3FVZA 5EO8A 4H53A 1MS9A 5HUMA 4D52C 4PWZA 3KGGA 5M1ZA 3K39A 2GVUA 1WCSA 4FPYA 5EO7A 4FPOB 1H6LA 3H72A 1W20A 1CRZA 4CPNA 2QWIA 2VAQA 4I00A 1ZI0A 5D9BA 1NMCA 3TIBA 4XJUA 1IVGA 2VSMA 4XIOA 4WA5A 1W0OA 1Z4YA 2QWFA 4CPOA 1NMBN 4FOQA 4FOVA 1A4QA 1W21A 2FLUX 3O9JA 4GZPA 1DIMA 1USXA 1Z4ZA 1INWA 3GVJA 2WOZA 2ZW9A 5FNSA 4XJAA 1F8CA 1MS4A 3LI4A 4QNPA 4BBWA 2QWJA 1V3BA 4YW4A 2B8HA 2FPBA 4XIKA 3S2KA 3CL0A 4M3MA 2H2NA 4FPLA 2HU4A 1IUBA 1IVCA 1E1AA 5GTQA 4K3YA 3O9KA 1EURA 1IVFA 1NNAA 2BF6A 4L7CA 2ZB5A 1B9TA 4C1YA 4L7BA 2SIMA 4DGRA 5D9CA 2QWCA 5FNRA 4ZY3A 4FOWA 1W1XA 3KYAA 1Z4WA 2IASA 4XMBA 4UOUA 4YY8A 4XMAA 2F24A 4WA3A 4A0PA 1V3EA 4K1IA 2VWDA 4B7RA 4GN7A 2POOA 4QN5A 4KS4A 1INVA 5EX7A 2V91A 4HZXA 4IFNX 1NCAN 1SLIA 2FPCA 4QN4A 2QWGA 1N1SA 3HLHA 4YW5A 5HUGA 4K1JA 4HZVA 1MS1A 1N6FA 2VW0A 1EUTA 4QN7A 2A75A 1USRA 3H73A 4NC5A 5FNUA 5HX0A 2HT8A 1ZGKA 2W38A 2SILA 1C5KA 1XOEA 4M4UA 1F8BA 3ADEA 4FPHA 4XJWA 3WW9A 4FPKA 3B7EA 5F9TA 2IAWA 4FPFA 3S8VA 1IVEA 1BJIA 3ALWA 2ZWAA 4NCSA 4FOYA 2DSOA 4Q6KA 4ZLRA 1X2JA 2YA8A 3SREA 1MS8A 4GDJA 3WN7A 3NSSA 1IJQA 2GVWA 4XJQA 4GN8A 4O5TA 3SRGA 4MWXA 4ZGCA 3H71A 1B9SA 1N6EA 1NPEA 4GDIA 1L7GA 3WWAA 1INHA 4IMBA 1Z50A 2GHSA 3CL2A 4C1YB 4CPZA 1NCCN 4JF7A 4MWLA 2HU0A 2ZZKA 1N1VA 4HHOA 2BERA 4YZ4A 1INYA 4YW3A 1INXA 1A4GA 5F72C 2IAQA 5GX5A 1N1YA 2HTQA 3A9GA 4N1BA 3SOQA 3GVKA 1INGA 4GNCA 2VK7A 4WEGA 3T1EA 3S8ZA 1MS0A 4XOGA 2XZIA 2HTYA 7NN9A 1MS3A 4IFLX 4XJZA 2X9MA 5FWWA 4XHBA 4UF7A 1Z4VA 1CQ1A 1B9VA 2F25A 4XJ8A 2BATA 3PJQA 4L7DA 4KS2A 5FZJA 1DILA 1NNCA 4FQ4A 2OJHA 4MC7A 3DASA 2AEPA 4X49A 4XYXA 2C4LA 3ZGDA 3LI5A 5FNTA 1VCJA 1N7DA 5HUKA 4D52B 3TI4A 4MWJA 4K1KA 3G4EA 4DG6A 3O4PA 2VSKA 3DR2A 5GX3A 5FZNA 2FHRA 4GN9A 2GVXA 3NO0A 4FZHA 4YZ3A 4D52A 3HLIA 1N6DA 1WP5A 1S18A 5B2CA 4GJTA 2DYHA 4G3NA 1MZ6A 4WA4A 1NSCA 1V0EA 4CH9A 4FPEA 1NMAN 1NCBN 1QLGA 3L6VA 5NN9A 4X6KA 3SILA 2XZKA 4B7JA 1IVDA 3VNGA 3Q6PA 4MWUA 2FP9A 1SNTA 3TIAA 2F26A 3BYCA 4D4UA 4MWVA 2IAXA 1A14N 2QE8A 2YA5A 4NN9A 4X4AA 2XN4A 4MWRA 2IAUA 3VNHA 2IAPA 4CPLA 4XE9A 4CSDA 2HT5A 2F10A 2VPJA 1SUUA 4XMIA 3Q6TA 3CKZA 3JU4A 2ZB6A 1WCQA 5GX4A 3TI8A 3K36A 2VW2A 2F12A 1SLLA 2VK5A 4XJRA 2XZJA 4KS1A 4WEFA 1EUUA 4GNBA 4J9TA 1NN2A 2W5OA 5B2DA 2VVZA 5FNQA 2QWBA 3NN9A 3V1SA 2AH2A 2YA7A 4HIZA 4KS5A 2G8SA 4FP2A 1V2IA 3IAXA 2QWEA 2P4OA 4GZXA 2QWAA 2DG0A 2BZDA 2HTUA 2C4AA 3D11A 1V04A 3U0SA 4MWQA 4QN6A 1V3CA 1NNBA 1CVMA 2CMLA 2JKBA 4HZWA 4K1HA 1SO7A 4B7QA 2HTVA 2W5NA 5GX1A 1IUCA 4FPJA 2QWHA 2F13A 4O5SA 2IATA 1NCDN 1W0PA 2RKCA 4FJ6A 1X2RA 6NN9A 4GZTA 4GZSA 1E8VA 4GNAA 4IQKA 1S1DA 4FVKA 1W8NA 2HT7A 3K3AA 4H52A 3TICA 1PJXA 4KS3A 4M4NA 1E8TA 1F8EA 2F28A 3TI3A 2QWKA 2FP8A 2VK6A 3V64C 3SOVA 3ALXA 4M4VA 3A72A 1MR5A 1POOA 3FW0A 3H6JA 2H2UA 4HW6A 4MWYA 3II7A 4CPMA 5JYYA 4SLIA 1E8UA 3SALA 3V65B 1NSDA 2F11A 4FPCA 4MWWA 2AGSA 2DG1A 2IVZA 4B7NA 3P5BL 4JMLA 3GVLA 3I1CA 3SOBB 2Z32A 4AGTA 2AEQA 4XHXA 3SANA 1N1TA 3A71A 3CYEA 2QWDA 3K38A 1INFA 3AMSA 1IVBA 1MZ5A 1S0JA 2F27A 2YDTA 4GZOA 2HTRA 3OPZA 3D12A 3LI3A 3B69A 1C9UA 3BEQA 4QN3A 4FP3A 1S0IA
chains in the Genus database with same CATH topology
4D8SA 2VW1A 4MZEA 3TI6A 1KITA 1MWEA 3TI5A 2F29A 2F0ZA 4GB1A 4X47A 3SLIA 4YZ1A 3W09A 4B7MA 3INBA 4YZ2A 2YA4A 5HUNA 4MZAA 1L7FA 1XOGA 2SLIA 2HTWA 2W20A 4XILA 2YDPA 2YA6A 4XJ9A 1F8DA 4YW1A 1Z4XA 4GZWA 1L7HA 1VCUA 4CPYA 4YZ5A 2XCYA 3K37A 4HZZA 4FPGA 1MS5A 4GZQA 4GEZA 4YW2A 1EUSA 4MJUA 4MX0A 1V3DA 4HZYA 4MJVA 1V0ZA 1W8OA 1V0FA 1NSBA 4H53A 1MS9A 5HUMA 3K39A 5M1ZA 1WCSA 4FPYA 4FPOB 3H72A 1W20A 4CPNA 2QWIA 4I00A 1NMCA 3TIBA 4XJUA 1IVGA 2VSMA 4XIOA 4WA5A 1W0OA 1Z4YA 2QWFA 4CPOA 1NMBN 4FOQA 4FOVA 1A4QA 1W21A 3O9JA 4GZPA 1DIMA 1USXA 1Z4ZA 1INWA 3GVJA 4XJAA 1F8CA 1MS4A 4QNPA 4BBWA 2QWJA 1V3BA 4YW4A 2B8HA 4XIKA 3CL0A 4M3MA 2H2NA 4FPLA 2HU4A 1IVCA 4K3YA 3O9KA 1EURA 1IVFA 1NNAA 2BF6A 2ZB5A 1B9TA 2SIMA 4DGRA 2QWCA 4FOWA 1W1XA 1Z4WA 4XMAA 2F24A 4WA3A 1V3EA 4K1IA 2VWDA 4B7RA 4QN5A 4KS4A 1INVA 4HZXA 4QN3A 1NCAN 1SLIA 4QN4A 2QWGA 1N1SA 4YW5A 5HUGA 4K1JA 4HZVA 1MS1A 2VW0A 1EUTA 4QN7A 2A75A 1USRA 3H73A 4NC5A 5HX0A 2HT8A 2W38A 2SILA 1XOEA 4M4UA 1F8BA 4FPHA 4XJWA 4FPKA 3B7EA 5F9TA 4FPFA 1IVEA 1BJIA 3ALWA 4NCSA 4FOYA 4Q6KA 2YA8A 1MS8A 4GDJA 3NSSA 4XJQA 4MWXA 3H71A 1B9SA 4GDIA 1L7GA 1INHA 1Z50A 3CL2A 4CPZA 1NCCN 4JF7A 4MWLA 2HU0A 1N1VA 2BERA 1INYA 4YW3A 1INXA 1A4GA 1N1YA 2HTQA 3GVKA 1INGA 2VK7A 4WEGA 3T1EA 1MS0A 4XOGA 2XZIA 2HTYA 7NN9A 1MS3A 4XJZA 2X9MA 4XHBA 4UF7A 1Z4VA 1B9VA 2F25A 4XJ8A 2BATA 3PJQA 4KS2A 1DILA 1NNCA 4FQ4A 4MC7A 2AEPA 4X49A 4XYXA 2C4LA 1VCJA 5HUKA 3TI4A 4MWJA 4K1KA 2VSKA 2FHRA 4FZHA 4YZ3A 1S18A 5B2CA 4GJTA 4WA4A 1MZ6A 1NSCA 1V0EA 4FPEA 1NMAN 1NCBN 5NN9A 4X6KA 3SILA 2XZKA 4B7JA 1IVDA 4MWUA 1SNTA 3TIAA 2F26A 4MWVA 1A14N 2YA5A 4NN9A 4X4AA 4MWRA 4CPLA 4XE9A 2HT5A 2F10A 4XMIA 3CKZA 3JU4A 2ZB6A 1WCQA 3TI8A 3K36A 2VW2A 2F12A 1SLLA 2VK5A 4XJRA 2XZJA 4KS1A 4WEFA 1EUUA 4J9TA 1NN2A 2W5OA 5B2DA 2VVZA 2QWBA 3NN9A 2AH2A 2YA7A 4HIZA 4KS5A 4FP2A 1V2IA 2QWEA 4GZXA 2QWAA 2BZDA 2HTUA 2C4AA 3D11A 4MWQA 4QN6A 1V3CA 1NNBA 2CMLA 2JKBA 4HZWA 4K1HA 1SO7A 4B7QA 2HTVA 2W5NA 4FPJA 2QWHA 2F13A 1NCDN 1W0PA 2RKCA 4FJ6A 6NN9A 4GZTA 4GZSA 1E8VA 1S1DA 4FVKA 1W8NA 2HT7A 3K3AA 4H52A 3TICA 4KS3A 4M4NA 1E8TA 1F8EA 2F28A 3TI3A 2QWKA 2VK6A 3ALXA 4M4VA 3A72A 1MR5A 3H6JA 2H2UA 4MWYA 4CPMA 5JYYA 4SLIA 1E8UA 3SALA 1NSDA 2F11A 4FPCA 4MWWA 2AGSA 4B7NA 3GVLA 2AEQA 4XHXA 3SANA 1N1TA 3A71A 3CYEA 2QWDA 3K38A 1INFA 1IVBA 1MZ5A 1S0JA 2F27A 2YDTA 4GZOA 2HTRA 3OPZA 3D12A 3B69A 3BEQA 4YZ4A 4FP3A 1S0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D8S A;  2VW1 A;  4MZE A;  3TI6 A;  1KIT A;  1MWE A;  3TI5 A;  2F29 A;  2F0Z A;  4GB1 A;  4X47 A;  3SLI A;  4YZ1 A;  3W09 A;  4B7M A;  3INB A;  4YZ2 A;  2YA4 A;  5HUN A;  4MZA A;  1L7F A;  1XOG A;  2SLI A;  2HTW A;  2W20 A;  4XIL A;  2YDP A;  2YA6 A;  4XJ9 A;  1F8D A;  4YW1 A;  1Z4X A;  4GZW A;  1L7H A;  1VCU A;  4CPY A;  4YZ5 A;  2XCY A;  3K37 A;  4HZZ A;  4FPG A;  1MS5 A;  4GZQ A;  4GEZ A;  4YW2 A;  1EUS A;  4MJU A;  4MX0 A;  1V3D A;  4HZY A;  4MJV A;  1V0Z A;  1W8O A;  1V0F A;  1NSB A;  4H53 A;  1MS9 A;  5HUM A;  3K39 A;  5M1Z A;  1WCS A;  4FPY A;  4FPO B;  3H72 A;  1W20 A;  4CPN A;  2QWI A;  4I00 A;  1NMC A;  3TIB A;  4XJU A;  1IVG A;  2VSM A;  4XIO A;  4WA5 A;  1W0O A;  1Z4Y A;  2QWF A;  4CPO A;  1NMB N;  4FOQ A;  4FOV A;  1A4Q A;  1W21 A;  3O9J A;  4GZP A;  1DIM A;  1USX A;  1Z4Z A;  1INW A;  3GVJ A;  4XJA A;  1F8C A;  1MS4 A;  4QNP A;  4BBW A;  2QWJ A;  1V3B A;  4YW4 A;  2B8H A;  4XIK A;  3CL0 A;  4M3M A;  4FPL A;  2HU4 A;  1IVC A;  4K3Y A;  3O9K A;  1EUR A;  1IVF A;  1NNA A;  2BF6 A;  2ZB5 A;  1B9T A;  2SIM A;  4DGR A;  2QWC A;  4FOW A;  1W1X A;  1Z4W A;  4XMA A;  2F24 A;  4WA3 A;  1V3E A;  4K1I A;  2VWD A;  4B7R A;  4QN5 A;  4KS4 A;  1INV A;  4HZX A;  4QN3 A;  1NCA N;  1SLI A;  4QN4 A;  2QWG A;  1N1S A;  4YW5 A;  5HUG A;  4K1J A;  4HZV A;  1MS1 A;  2VW0 A;  1EUT A;  4QN7 A;  2A75 A;  1USR A;  3H73 A;  4NC5 A;  5HX0 A;  2HT8 A;  2W38 A;  2SIL A;  1XOE A;  4M4U A;  1F8B A;  4FPH A;  4XJW A;  4FPK A;  3B7E A;  5F9T A;  4FPF A;  1IVE A;  1BJI A;  3ALW A;  4NCS A;  4FOY A;  4Q6K A;  2YA8 A;  1MS8 A;  4GDJ A;  3NSS A;  4XJQ A;  4MWX A;  3H71 A;  1B9S A;  4GDI A;  1L7G A;  1INH A;  1Z50 A;  3CL2 A;  4CPZ A;  1NCC N;  4JF7 A;  4MWL A;  2HU0 A;  1N1V A;  2BER A;  1INY A;  4YW3 A;  1INX A;  1A4G A;  1N1Y A;  2HTQ A;  3GVK A;  1ING A;  2VK7 A;  4WEG A;  3T1E A;  1MS0 A;  4XOG A;  2XZI A;  2HTY A;  7NN9 A;  1MS3 A;  4XJZ A;  2X9M A;  4XHB A;  4UF7 A;  1Z4V A;  1B9V A;  2F25 A;  4XJ8 A;  2BAT A;  3PJQ A;  4KS2 A;  1DIL A;  1NNC A;  4FQ4 A;  4MC7 A;  2AEP A;  4X49 A;  4XYX A;  2C4L A;  1VCJ A;  5HUK A;  3TI4 A;  4MWJ A;  4K1K A;  2VSK A;  2FHR A;  4FZH A;  4YZ3 A;  5B2C A;  4GJT A;  4WA4 A;  1MZ6 A;  1NSC A;  1V0E A;  4FPE A;  1NMA N;  1NCB N;  5NN9 A;  4X6K A;  3SIL A;  2XZK A;  4B7J A;  1IVD A;  4MWU A;  1SNT A;  3TIA A;  2F26 A;  4MWV A;  1A14 N;  2YA5 A;  4NN9 A;  4X4A A;  4MWR A;  4CPL A;  4XE9 A;  2HT5 A;  2F10 A;  4XMI A;  3CKZ A;  3JU4 A;  2ZB6 A;  1WCQ A;  3TI8 A;  3K36 A;  2VW2 A;  2F12 A;  1SLL A;  2VK5 A;  4XJR A;  2XZJ A;  4KS1 A;  4WEF A;  1EUU A;  4J9T A;  1NN2 A;  2W5O A;  5B2D A;  2VVZ A;  2QWB A;  3NN9 A;  2AH2 A;  2YA7 A;  4HIZ A;  4KS5 A;  4FP2 A;  1V2I A;  2QWE A;  4GZX A;  2QWA A;  2BZD A;  2HTU A;  2C4A A;  3D11 A;  4MWQ A;  4QN6 A;  1V3C A;  1NNB A;  2CML A;  2JKB A;  4HZW A;  4K1H A;  1SO7 A;  4B7Q A;  2HTV A;  2W5N A;  4FPJ A;  2QWH A;  2F13 A;  1NCD N;  1W0P A;  2RKC A;  4FJ6 A;  6NN9 A;  4GZT A;  4GZS A;  1E8V A;  4FVK A;  1W8N A;  2HT7 A;  3K3A A;  4H52 A;  3TIC A;  4KS3 A;  4M4N A;  1E8T A;  1F8E A;  2F28 A;  3TI3 A;  2QWK A;  2VK6 A;  3ALX A;  4M4V A;  3A72 A;  1MR5 A;  3H6J A;  4MWY A;  4CPM A;  5JYY A;  4SLI A;  1E8U A;  3SAL A;  1NSD A;  2F11 A;  4FPC A;  4MWW A;  2AGS A;  4B7N A;  3GVL A;  2AEQ A;  4XHX A;  3SAN A;  1N1T A;  3A71 A;  3CYE A;  2QWD A;  3K38 A;  1INF A;  1IVB A;  1MZ5 A;  1S0J A;  2F27 A;  2YDT A;  4GZO A;  2HTR A;  3OPZ A;  3D12 A;  3B69 A;  3BEQ A;  4YZ4 A;  4FP3 A;  1S0I A; 
#chains in the Genus database with same CATH topology
 2IAV A;  4D8S A;  4IFJ A;  2VW1 A;  4MZE A;  3TI6 A;  1QBI A;  1KIT A;  1MWE A;  3TI5 A;  2F29 A;  2F0Z A;  2IAR A;  4GB1 A;  4X47 A;  3SLI A;  4YZ1 A;  3W09 A;  4B7M A;  3INB A;  4YZ2 A;  1CRU A;  5D9D A;  1RWL A;  2YA4 A;  5HUN A;  1Q7F A;  3AMR A;  4R40 A;  3HRP A;  4MZA A;  1L7F A;  1XOG A;  2SLI A;  4CHB A;  2HTW A;  2W20 A;  4XIL A;  2IAO A;  2YDP A;  2GVV A;  2ISM A;  1U6D X;  2YA6 A;  3TC9 A;  4XJ9 A;  3S94 A;  4AH4 A;  3E5Z A;  2HQS A;  3UC1 A;  1F8D A;  5H47 A;  3WDZ A;  4HHQ A;  3G4H A;  4YW1 A;  1Z4X A;  4GZW A;  4ASC A;  1L7H A;  1VCU A;  4IN4 A;  4CPY A;  4YZ5 A;  1K32 A;  2XCY A;  3K37 A;  5CGJ A;  4HZZ A;  4FPG A;  1MS5 A;  4AGI A;  4GZQ A;  4Q1U A;  2W8B B;  3ZGC A;  4GEZ A;  4YW2 A;  1EUS A;  3Q6K A;  1RWI A;  3A9H A;  4MJU A;  4MX0 A;  2W8B A;  1V3D A;  5GX2 A;  4IYG A;  1OFZ A;  4AHA A;  4HZY A;  4MJV A;  1V0Z A;  1W8O A;  1V0F A;  1NSB A;  3FVZ A;  5EO8 A;  4H53 A;  1MS9 A;  5HUM A;  4D52 C;  4PWZ A;  3KGG A;  5M1Z A;  3K39 A;  2GVU A;  1WCS A;  4FPY A;  5EO7 A;  4FPO B;  1H6L A;  3H72 A;  1W20 A;  1CRZ A;  4CPN A;  2QWI A;  2VAQ A;  4I00 A;  1ZI0 A;  5D9B A;  1NMC A;  3TIB A;  4XJU A;  1IVG A;  2VSM A;  4XIO A;  4WA5 A;  1W0O A;  1Z4Y A;  2QWF A;  4CPO A;  1NMB N;  4FOQ A;  4FOV A;  1A4Q A;  1W21 A;  2FLU X;  3O9J A;  4GZP A;  1DIM A;  1USX A;  1Z4Z A;  1INW A;  3GVJ A;  2WOZ A;  2ZW9 A;  5FNS A;  4XJA A;  1F8C A;  1MS4 A;  3LI4 A;  4QNP A;  4BBW A;  2QWJ A;  1V3B A;  4YW4 A;  2B8H A;  2FPB A;  4XIK A;  3S2K A;  3CL0 A;  4M3M A;  2H2N A;  4FPL A;  2HU4 A;  1IUB A;  1IVC A;  1E1A A;  5GTQ A;  4K3Y A;  3O9K A;  1EUR A;  1IVF A;  1NNA A;  2BF6 A;  4L7C A;  2ZB5 A;  1B9T A;  4C1Y A;  4L7B A;  2SIM A;  4DGR A;  5D9C A;  2QWC A;  5FNR A;  4ZY3 A;  4FOW A;  1W1X A;  3KYA A;  1Z4W A;  2IAS A;  4XMB A;  4UOU A;  4YY8 A;  4XMA A;  2F24 A;  4WA3 A;  4A0P A;  1V3E A;  4K1I A;  2VWD A;  4B7R A;  4GN7 A;  2POO A;  4QN5 A;  4KS4 A;  1INV A;  5EX7 A;  2V91 A;  4HZX A;  4IFN X;  1NCA N;  1SLI A;  2FPC A;  4QN4 A;  2QWG A;  1N1S A;  3HLH A;  4YW5 A;  5HUG A;  4K1J A;  4HZV A;  1MS1 A;  1N6F A;  2VW0 A;  1EUT A;  4QN7 A;  2A75 A;  1USR A;  3H73 A;  4NC5 A;  5FNU A;  5HX0 A;  2HT8 A;  1ZGK A;  2W38 A;  2SIL A;  1C5K A;  1XOE A;  4M4U A;  1F8B A;  3ADE A;  4FPH A;  4XJW A;  3WW9 A;  4FPK A;  3B7E A;  5F9T A;  2IAW A;  4FPF A;  3S8V A;  1IVE A;  1BJI A;  3ALW A;  2ZWA A;  4NCS A;  4FOY A;  2DSO A;  4Q6K A;  4ZLR A;  1X2J A;  2YA8 A;  3SRE A;  1MS8 A;  4GDJ A;  3WN7 A;  3NSS A;  1IJQ A;  2GVW A;  4XJQ A;  4GN8 A;  4O5T A;  3SRG A;  4MWX A;  4ZGC A;  3H71 A;  1B9S A;  1N6E A;  1NPE A;  4GDI A;  1L7G A;  3WWA A;  1INH A;  4IMB A;  1Z50 A;  2GHS A;  3CL2 A;  4C1Y B;  4CPZ A;  1NCC N;  4JF7 A;  4MWL A;  2HU0 A;  2ZZK A;  1N1V A;  4HHO A;  2BER A;  4YZ4 A;  1INY A;  4YW3 A;  1INX A;  1A4G A;  5F72 C;  2IAQ A;  5GX5 A;  1N1Y A;  2HTQ A;  3A9G A;  4N1B A;  3SOQ A;  3GVK A;  1ING A;  4GNC A;  2VK7 A;  4WEG A;  3T1E A;  3S8Z A;  1MS0 A;  4XOG A;  2XZI A;  2HTY A;  7NN9 A;  1MS3 A;  4IFL X;  4XJZ A;  2X9M A;  5FWW A;  4XHB A;  4UF7 A;  1Z4V A;  1CQ1 A;  1B9V A;  2F25 A;  4XJ8 A;  2BAT A;  3PJQ A;  4L7D A;  4KS2 A;  5FZJ A;  1DIL A;  1NNC A;  4FQ4 A;  2OJH A;  4MC7 A;  3DAS A;  2AEP A;  4X49 A;  4XYX A;  2C4L A;  3ZGD A;  3LI5 A;  5FNT A;  1VCJ A;  1N7D A;  5HUK A;  4D52 B;  3TI4 A;  4MWJ A;  4K1K A;  3G4E A;  4DG6 A;  3O4P A;  2VSK A;  3DR2 A;  5GX3 A;  5FZN A;  2FHR A;  4GN9 A;  2GVX A;  3NO0 A;  4FZH A;  4YZ3 A;  4D52 A;  3HLI A;  1N6D A;  1WP5 A;  1S18 A;  5B2C A;  4GJT A;  2DYH A;  4G3N A;  1MZ6 A;  4WA4 A;  1NSC A;  1V0E A;  4CH9 A;  4FPE A;  1NMA N;  1NCB N;  1QLG A;  3L6V A;  5NN9 A;  4X6K A;  3SIL A;  2XZK A;  4B7J A;  1IVD A;  3VNG A;  3Q6P A;  4MWU A;  2FP9 A;  1SNT A;  3TIA A;  2F26 A;  3BYC A;  4D4U A;  4MWV A;  2IAX A;  1A14 N;  2QE8 A;  2YA5 A;  4NN9 A;  4X4A A;  2XN4 A;  4MWR A;  2IAU A;  3VNH A;  2IAP A;  4CPL A;  4XE9 A;  4CSD A;  2HT5 A;  2F10 A;  2VPJ A;  1SUU A;  4XMI A;  3Q6T A;  3CKZ A;  3JU4 A;  2ZB6 A;  1WCQ A;  5GX4 A;  3TI8 A;  3K36 A;  2VW2 A;  2F12 A;  1SLL A;  2VK5 A;  4XJR A;  2XZJ A;  4KS1 A;  4WEF A;  1EUU A;  4GNB A;  4J9T A;  1NN2 A;  2W5O A;  5B2D A;  2VVZ A;  5FNQ A;  2QWB A;  3NN9 A;  3V1S A;  2AH2 A;  2YA7 A;  4HIZ A;  4KS5 A;  2G8S A;  4FP2 A;  1V2I A;  3IAX A;  2QWE A;  2P4O A;  4GZX A;  2QWA A;  2DG0 A;  2BZD A;  2HTU A;  2C4A A;  3D11 A;  1V04 A;  3U0S A;  4MWQ A;  4QN6 A;  1V3C A;  1NNB A;  1CVM A;  2CML A;  2JKB A;  4HZW A;  4K1H A;  1SO7 A;  4B7Q A;  2HTV A;  2W5N A;  5GX1 A;  1IUC A;  4FPJ A;  2QWH A;  2F13 A;  4O5S A;  2IAT A;  1NCD N;  1W0P A;  2RKC A;  4FJ6 A;  1X2R A;  6NN9 A;  4GZT A;  4GZS A;  1E8V A;  4GNA A;  4IQK A;  1S1D A;  4FVK A;  1W8N A;  2HT7 A;  3K3A A;  4H52 A;  3TIC A;  1PJX A;  4KS3 A;  4M4N A;  1E8T A;  1F8E A;  2F28 A;  3TI3 A;  2QWK A;  2FP8 A;  2VK6 A;  3V64 C;  3SOV A;  3ALX A;  4M4V A;  3A72 A;  1MR5 A;  1POO A;  3FW0 A;  3H6J A;  2H2U A;  4HW6 A;  4MWY A;  3II7 A;  4CPM A;  5JYY A;  4SLI A;  1E8U A;  3SAL A;  3V65 B;  1NSD A;  2F11 A;  4FPC A;  4MWW A;  2AGS A;  2DG1 A;  2IVZ A;  4B7N A;  3P5B L;  4JML A;  3GVL A;  3I1C A;  3SOB B;  2Z32 A;  4AGT A;  2AEQ A;  4XHX A;  3SAN A;  1N1T A;  3A71 A;  3CYE A;  2QWD A;  3K38 A;  1INF A;  3AMS A;  1IVB A;  1MZ5 A;  1S0J A;  2F27 A;  2YDT A;  4GZO A;  2HTR A;  3OPZ A;  3D12 A;  3LI3 A;  3B69 A;  1C9U A;  3BEQ A;  4QN3 A;  4FP3 A;  1S0I A; 
#chains in the Genus database with same CATH homology
 4D8S A;  2VW1 A;  4MZE A;  3TI6 A;  1KIT A;  1MWE A;  3TI5 A;  2F29 A;  2F0Z A;  4GB1 A;  4X47 A;  3SLI A;  4YZ1 A;  3W09 A;  4B7M A;  3INB A;  4YZ2 A;  2YA4 A;  5HUN A;  4MZA A;  1L7F A;  1XOG A;  2SLI A;  2HTW A;  2W20 A;  4XIL A;  2YDP A;  2YA6 A;  4XJ9 A;  1F8D A;  4YW1 A;  1Z4X A;  4GZW A;  1L7H A;  1VCU A;  4CPY A;  4YZ5 A;  2XCY A;  3K37 A;  4HZZ A;  4FPG A;  1MS5 A;  4GZQ A;  4GEZ A;  4YW2 A;  1EUS A;  4MJU A;  4MX0 A;  1V3D A;  4HZY A;  4MJV A;  1V0Z A;  1W8O A;  1V0F A;  1NSB A;  4H53 A;  1MS9 A;  5HUM A;  3K39 A;  5M1Z A;  1WCS A;  4FPY A;  4FPO B;  3H72 A;  1W20 A;  4CPN A;  2QWI A;  4I00 A;  1NMC A;  3TIB A;  4XJU A;  1IVG A;  2VSM A;  4XIO A;  4WA5 A;  1W0O A;  1Z4Y A;  2QWF A;  4CPO A;  1NMB N;  4FOQ A;  4FOV A;  1A4Q A;  1W21 A;  3O9J A;  4GZP A;  1DIM A;  1USX A;  1Z4Z A;  1INW A;  3GVJ A;  4XJA A;  1F8C A;  1MS4 A;  4QNP A;  4BBW A;  2QWJ A;  1V3B A;  4YW4 A;  2B8H A;  4XIK A;  3CL0 A;  4M3M A;  2H2N A;  4FPL A;  2HU4 A;  1IVC A;  4K3Y A;  3O9K A;  1EUR A;  1IVF A;  1NNA A;  2BF6 A;  2ZB5 A;  1B9T A;  2SIM A;  4DGR A;  2QWC A;  4FOW A;  1W1X A;  1Z4W A;  4XMA A;  2F24 A;  4WA3 A;  1V3E A;  4K1I A;  2VWD A;  4B7R A;  4QN5 A;  4KS4 A;  1INV A;  4HZX A;  4QN3 A;  1NCA N;  1SLI A;  4QN4 A;  2QWG A;  1N1S A;  4YW5 A;  5HUG A;  4K1J A;  4HZV A;  1MS1 A;  2VW0 A;  1EUT A;  4QN7 A;  2A75 A;  1USR A;  3H73 A;  4NC5 A;  5HX0 A;  2HT8 A;  2W38 A;  2SIL A;  1XOE A;  4M4U A;  1F8B A;  4FPH A;  4XJW A;  4FPK A;  3B7E A;  5F9T A;  4FPF A;  1IVE A;  1BJI A;  3ALW A;  4NCS A;  4FOY A;  4Q6K A;  2YA8 A;  1MS8 A;  4GDJ A;  3NSS A;  4XJQ A;  4MWX A;  3H71 A;  1B9S A;  4GDI A;  1L7G A;  1INH A;  1Z50 A;  3CL2 A;  4CPZ A;  1NCC N;  4JF7 A;  4MWL A;  2HU0 A;  1N1V A;  2BER A;  1INY A;  4YW3 A;  1INX A;  1A4G A;  1N1Y A;  2HTQ A;  3GVK A;  1ING A;  2VK7 A;  4WEG A;  3T1E A;  1MS0 A;  4XOG A;  2XZI A;  2HTY A;  7NN9 A;  1MS3 A;  4XJZ A;  2X9M A;  4XHB A;  4UF7 A;  1Z4V A;  1B9V A;  2F25 A;  4XJ8 A;  2BAT A;  3PJQ A;  4KS2 A;  1DIL A;  1NNC A;  4FQ4 A;  4MC7 A;  2AEP A;  4X49 A;  4XYX A;  2C4L A;  1VCJ A;  5HUK A;  3TI4 A;  4MWJ A;  4K1K A;  2VSK A;  2FHR A;  4FZH A;  4YZ3 A;  1S18 A;  5B2C A;  4GJT A;  4WA4 A;  1MZ6 A;  1NSC A;  1V0E A;  4FPE A;  1NMA N;  1NCB N;  5NN9 A;  4X6K A;  3SIL A;  2XZK A;  4B7J A;  1IVD A;  4MWU A;  1SNT A;  3TIA A;  2F26 A;  4MWV A;  1A14 N;  2YA5 A;  4NN9 A;  4X4A A;  4MWR A;  4CPL A;  4XE9 A;  2HT5 A;  2F10 A;  4XMI A;  3CKZ A;  3JU4 A;  2ZB6 A;  1WCQ A;  3TI8 A;  3K36 A;  2VW2 A;  2F12 A;  1SLL A;  2VK5 A;  4XJR A;  2XZJ A;  4KS1 A;  4WEF A;  1EUU A;  4J9T A;  1NN2 A;  2W5O A;  5B2D A;  2VVZ A;  2QWB A;  3NN9 A;  2AH2 A;  2YA7 A;  4HIZ A;  4KS5 A;  4FP2 A;  1V2I A;  2QWE A;  4GZX A;  2QWA A;  2BZD A;  2HTU A;  2C4A A;  3D11 A;  4MWQ A;  4QN6 A;  1V3C A;  1NNB A;  2CML A;  2JKB A;  4HZW A;  4K1H A;  1SO7 A;  4B7Q A;  2HTV A;  2W5N A;  4FPJ A;  2QWH A;  2F13 A;  1NCD N;  1W0P A;  2RKC A;  4FJ6 A;  6NN9 A;  4GZT A;  4GZS A;  1E8V A;  1S1D A;  4FVK A;  1W8N A;  2HT7 A;  3K3A A;  4H52 A;  3TIC A;  4KS3 A;  4M4N A;  1E8T A;  1F8E A;  2F28 A;  3TI3 A;  2QWK A;  2VK6 A;  3ALX A;  4M4V A;  3A72 A;  1MR5 A;  3H6J A;  2H2U A;  4MWY A;  4CPM A;  5JYY A;  4SLI A;  1E8U A;  3SAL A;  1NSD A;  2F11 A;  4FPC A;  4MWW A;  2AGS A;  4B7N A;  3GVL A;  2AEQ A;  4XHX A;  3SAN A;  1N1T A;  3A71 A;  3CYE A;  2QWD A;  3K38 A;  1INF A;  1IVB A;  1MZ5 A;  1S0J A;  2F27 A;  2YDT A;  4GZO A;  2HTR A;  3OPZ A;  3D12 A;  3B69 A;  3BEQ A;  4YZ4 A;  4FP3 A;  1S0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...