1INLA

Crystal structure of spermidine synthase from thermotoga maritima
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
295
structure length
285
Chain Sequence
RTLKELERELQPRQHLWYFEYYTGNNVGLFMKMNRVIYSGQSDIQRIDIFENPDLGVVFALDGITMTTEKDEFMYHEMLAHVPMFLHPNPKKVLIIGGGDGGTLREVLKHDSVEKAILCEVDGLVIEAARKYLKQTSCGFDDPRAEIVIANGAEYVRKFKNEFDVIIIDSLFTEEFYQACYDALKEDGVFSAETEDPFYDIGWFKLAYRRISKVFPITRVYLGFMTTYPSGMWSYTFASKGIDPIKDFDPEKVRKFNKELKYYNEEVHVASFALPNFVKKELGLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase
publication title The crystal structure of spermidine synthase with a multisubstrate adduct inhibitor.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 91
structure length 285
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 1inlA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1inlA01
1X19A 3BKXA 2B2CA 4P7JA 1FP1D 1ZGAA 3EMDA 5F2OA 3BXOA 3DUWA 3P71T 3T0IA 2EFJA 3OPNA 4FZVA 5H02A 3ANXA 1M6YA 5CM2Z 3EEYA 4AZVA 3KPVA 4UOEA 4PWYA 2PSSA 1JQEA 4ZTBA 2G1PA 1QAOA 1U2ZA 1WZNA 2DPMA 2PT9A 4YV0A 4QTTB 5FA8A 5FHQA 5U4XA 2CWWA 4RTNA 4QVGA 3UA3A 1NBHA 4QDJA 2AOXA 5EZSA 3G5LA 2OZVA 4IV0A 4HH4A 2ZZMA 2P1DA 4CKBA 4QQKA 2AZTA 3UBTA 3UJ8A 1YFLA 2AOUA 3NTVA 4P7KA 3F4KA 2Z6AA 2NP6A 4QPNA 2OXTA 3LECA 3LKDA 4E70A 2GS9A 1UIRA 3NWBA 4PYKA 2AOTB 2YXEA 3NVKI 2QE6A 3HCFA 2IBTA 2P3LA 5BW5A 1KYWA 3CVOA 1T43A 1PJZA 3HEMA 4GEKA 4O29A 5LQCA 4Z2YA 1QANA 3I9FA 5EKXA 1TPYA 5HIIA 2VDWA 2VDUE 4BP1A 3P2KA 2ZTHA 1UFKA 3CGGA 4B17A 1V39A 3DXYA 3G88A 4M36A 3QOXA 3UJCA 3C3PA 3I53A 4P7FA 3X0DA 5CUQA 1WS6A 4E2WA 2YR0A 5CVJA 3LDFA 5E2AA 1INLA 3GXOA 3KQQA 5DX1A 5EHGA 3A25A 1G6Q1 3B3JA 5D1HA 3NJRA 3B3FA 4ER3A 4OBXA 2P3QA 4OQEA 2YQZA 3M70A 4YUZA 4Y2HA 3GNLA 5DWQA 1AV6A 1SUIA 1WG8A 2CL5A 5LR6A 3C6MA 4PGGA 3EGIA 3U81A 2HV9A 3GU3A 4EKIA 4OX9Y 3OZTA 3GRRA 4FSXA 2YTZA 3HA3A 3UJDA 5P8WA 4YUYA 4HGYA 2B78A 2HWKA 3KKZA 5E2BA 4V0RA 3LCCA 3S68A 3THRA 2N47A 3HVHA 1Y8CA 1JG1A 1L3BA 5ICCA 1ORHA 5GM2A 2NXEA 4E2YA 1JSZA 5M5BA 4PYOA 3PX2A 1N7JA 4YV2A 1WXWA 3UJ7A 1EQAA 4QDKA 3TPZA 4RTKA 5K0LA 3CJQA 2YXLA 3SX0A 2QRVA 3EGEA 8MHTA 4XUEA 2PVCA 1NBIA 1X1BA 2R3SA 4HSGA 1VPTA 3VC1A 4CXMA 2GH1A 3G89A 1I9GA 3FUXA 5EZQA 4L7VA 4DA4A 1KR5A 5LQRA 5DX0A 1VL5A 3GWZA 3DULA 3E05A 5JR3A 4R6WA 1FBNA 4P58A 5EG5A 5DXAA 2Z6QA 3JWJA 5E9WA 2VP3A 3M6WA 2IIPA 5DPMA 1AQIA 2O05A 1N2XA 2PLWA 2AOUB 5DTRA 3VYWA 4A6EA 1MHTA 5EIWA 3LBYA 1NW8A 2IGTA 5IKMA 5E1OA 5FWDA 4CTJA 3ELWA 1R18A 3AXSA 1SG9A 5K05A 3AWIA 5BXYA 4H0NA 5E8RA 2XBMA 2IP2A 3LHDA 3SMQA 4PGHA 3BGIA 3EVAA 2ZULA 2PY6A 4FT2A 3UJAA 5LQJA 3FTFA 3E7PA 1RI2A 2C7RA 3BWCA 3MTIA 5LQKA 4MWZA 2P8JA 2Y1XA 3DOUA 5E1DA 1PRYA 1SUSA 2OPBA 3GRUA 1R74A 1NE2A 4KW7A 3P9CA 4RVGA 1EAMA 3LGAA 4RYLA 5EVJA 1YZ3A 3SVZA 1RI5A 3KQTA 2IDKA 1G38A 1NW7A 5DTMA 4HRAA 4KIGA 1DCTA 3EMBA 3UJBA 5EMLA 5K03A 2AOVA 2OY0A 2XVMA 4YUXA 4LG1A 2EX4A 3T7SA 4RTOA 5BW4A 3JWIA 1XCLA 5DM1A 5E9JA 2IDJA 3PFHA 1RJGA 2JHCA 4XCXA 1RI3A 4PYLA 5DSTA 5EC8A 1BOOA 3Q87B 4YUVA 4NECA 3T7TA 4R8SA 2AN3A 3TFWA 2PX5A 2ERCA 1NKVA 3B3GA 4RTMA 2P35A 3CBGA 4FP9A 4OA8A 3REOA 2FPOA 2UYCA 2AVNA 3L8DA 1XTPA 2GPYA 3TRKA 3MGGA 3PS9A 4DKJA 4K6MA 4WVLA 5HIJA 5EEGA 3MCTA 4DQ0A 4RV9A 3B89A 2JJQA 2ZWAA 1KPIA 3M6VA 3FUUA 5CVEA 4YMGA 1I4WA 3SR4A 5HIKA 2HR1A 4YV1A 1VQ1A 1XDZA 3EVGA 2ZW9A 4PONA 2FRXA 3B7PA 3UJ6A 3I5UA 5CCXA 3DXXA 4PYMA 4JXJA 2C7PA 1B42A 3NDIA 3EVDA 2FK8A 5CIYA 2LD4A 1ORIA 3P9KA 4LECA 4RVFA 3OU2A 1VP9A 3EVZA 5FWAA 4KVZA 2YVLA 5HILA 7MHTA 2V74B 2G8NA 2P40A 3NVMB 1FP2A 1UWVA 4GUAA 4BLWA 1TW3A 3PFGA 4KIFA 2OO3A 4FGZA 2Z6UA 3QOWA 3KR1A 1KP9A 1NW3A 5ERGB 1RJEA 4KRGA 4A6DA 3GCZA 4RTPA 4LWOA 2PXXA 2VS1A 3HVJA 4F85A 5DM0A 3RODA 5IH3A 3CC8A 4RVHA 1YUBA 1VE3A 2OB1A 3OFKA 5K01A 3G5TA 3ME5A 1JG3A 1WXXA 3P9NA 3E23A 1O54A 2FCAA 2I62A 2VZ9A 2KW5A 3NWEA 1L1EA 3TM5A 5KYGA 4ER7A 2CMHA 1G55A 2PXAA 2A14A 1ZHFA 1R6AA 1N7IA 4G56A 3B5IA 4LWPA 4DCMA 3K6RA 3LCUA 1AF7A 2F8LA 1BKYA 3LDUA 3FRIA 3AXTA 4WXHA 3O7WA 2WA2A 3FYDA 5K0FA 4AX8A 4MIKA 5CVVA 5DT2A 4GF5A 4KDCA 3KQYA 2P41A 3P2IA 2AVDA 3FTDA 5EMJA 4PYJA 2GAFA 2G70A 1M0EA 3SSMA 5KQSA 3A26A 4HTFB 4BP3A 4PCAA 3TM4A 3EEOA 3Q7EA 5FADA 1D2CA 1XXLA 2CKDA 1JG2A 4EMSA 3IHTA 4QTUB 3TR6A 5LQUA 3IEIA 4C4AA 5HIMA 1X1AA 3SXJA 2BH2A 1ZG3A 1KXZA 2OB2A 4C04A 1KIAA 5GWXA 1D2GA 1Q0SA 3LBFA 4FS8A 4QPPA 4RTRA 4M37A 3SSNA 2PXCA 4CKEA 4EK9A 3I58A 5DLYA 2WA1A 4DCGA 4RTLA 4PIMA 2ZWVA 3ER9A 4CWAA 1JR4A 5EIFA 4E32A 4EVIA 3MHTA 2PKWA 5ICGA 4RVDA 5FUBA 2NNWB 3KQVA 4ER5A 4X1OA 5HOQA 3EVCA 1G8AA 4RWZA 4E2ZA 3MCZA 3NMUF 2DULA 5DX8A 2ZZKA 5B1SA 3DP7A 5K8VA 3FPJA 4X60A 3T7RA 5GIPE 2V7EA 3ERCA 4BY9E 2AN5A 1YFJA 4U7PB 3TKYA 2ZBRA 3EVFA 4AZSA 5GIOE 2UYQA 4PYNA 2H00A 3UJ9A 4DZRA 3TOSA 2ONYA 4PYQA 2HNKA 5K0JA 2P3OA 1ZQ9A 2C7QA 2GA9A 4E2XA 3LPMA 1P1BA 4GQBA 2ONZA 2O07A 3HNRA 3CKKA 1TW2A 3EVEA 4X63A 4IV8A 3FUTA 3A4TA 5DM2A 4IKPA 1DL5A 2AOTA 3FPHA 4M38A 3KQPA 2B3TA 4EQZA 3BGVA 3QV2A 4C08A 1JSXA 3OU6A 1Z3CA 3HCDA 5EMMA 1RI1A 3H2BA 1XCJA 2E5WA 2PWPA 2PBFA 3FTEA 2R6ZA 3G2PA 5BP7A 4E33A 5KS2A 1JQ3A 3GJYA 3R0QA 3EVBA 4ATNA 4MHTA 3C0KA 3JWHA 2AR0A 4HC4A 4QVKA 3EGVA 5EKUA 1F3LA 3BGDA 3I64A 3SM3A 3TLJA 1VP3A 3PLAE 4R8RA 4FT4A 3TMAA 2FHPA 4ER0A 4PYIA 1ZKDA 3CCFA 3LKZA 4BLVA 5KQRA 3PTAA 1NW5A 1VIDA 4RTQA 5F2NA 1XVAA 3M6UA 5HZMA 3HCAA 2IFTA 2O57A 3KU1A 3DH0A 3GIWA 5MHTA 2NYUA 2ZFUA 1G60A 1MJFA 4RTJA 1H1DA 3HCEA 3TQSA 2PT6A 2IPXA 3G2OA 3KPWA 1YZHA 5C1IA 1QAMA 2I6GA 3G8BA 2CMGA 3GO4A 1YF3A 3KPUA 5GM1A 2JH8A 1L3CA 1DUSA 2BR4A 3VSEA 1X1CA 5DRYA 3MTEA 2JG3A 1BC5A 1KHHA 4DF3A 5T67A 1RI4A 3KR9A 3GDHA 1XDUA 3A27A 4XUDA 3NW9A 4OA5A 4EKGA 4DMGA 2QRVB 3C3YA 4ISCA 3M33A 3OCJA 3FYCA 3MQ2A 3PVCA 1YB2A 1KPHA 1BHJA 3OZSA 4U7TB 1RJDA 3HCCA 5T6BA 2OBFA 2Q41A 3FRHA 2QY6A 3KPJA 5EEHA 5C9ZA 3ELUA 2I7CA 4PNEA 2UYHA 1NT2A 2UZ4A 5T64A 5K0GA 1EG2A 5LSAA 1VBFA 4OBWA 2IH2A 2AS0A 2JH9A 3G8AA 3UA4A 2I9KA 3FPEA 4HGZA 5GP1A 1XJ5A 4GBED 4AZTA 2YX1A 3KQMA 2BZGA 1KYZA 1SQFA 5DXJA 2OYRA 1AQJA 3UFBA 1QZZA 4M7RA 3A7DA 3ELYA 3BUSA 3O31A 3FTCA 4F84A 4YMHA 2C7OA 2FK7A 3PB3A 4KDRA 2ADMA 2NXNA 2ZIFA 3PT9A 5FULA 4E30A 5K0NA 2YXDA 1WY7A 2NXJA 5HEKA 4X61A 1P39A 3DMHA 1FPQA 2XYVA 3UWPA 1OR8A 5EPEA 1I1NA 2AOWA 1IXKA 2NP7A 3KQOA 1F38A 4GOND 2ZCJA 3KPYA 5EGSA 4IWNA 3FUVA 2EJUA 1JTFA 4C05A 3RIEA 2ORED 3ELDA 3OZRA 2ZBPA 4C07A 3LSTA 5KVAA 3M6XA 5K0EA 5E1BA 1G8SA 3OFJA 2EG5A 4V0QA 2H1RA 5C0OE 2BM8A 3HA5A 2ZIEA 1EJ6A 2QM3A 3BWMA 4CTKA 1ZGJA 5EHIA 3FPFA 3KQSA 3WSTA 2ZVJA 3K0BA 2FYTA 3DXZA 3AJDA 5E8JA 1EJ0A 1FJXA 2ZIGA 3P9IA 5CVUA 3PX3A 5EOVA 5FCDA 5E1MA 10MHA 4OQDA 4P7GA 4R05A 5DTQA 4RTSA 3HM2A 3EPPA 3LX6A 4GOOD 4CKCA 1NV9A 2AN4A 2Y1WA 3NDJA 5LQAA 3DLCA 1QAQA 2JHAA 4PINA 1HMYA 4E31A 3FZGA 3CJTA 3MAGA 4GOMD 5FQOA 3DMGA 3LCVB 3TKAA 2IBSA 1L9KA 2HTEA 4R6XA 1P1CA 3D2LA 3BWBA 2PV0A 4DM3A 5GOZA 2PX2A 4C03A 3GGDA 2P7IA 1D2HA 1HNNA 3LDGA 3R3HA 1EIZA 1VLMA 1M6EX 2G71A 2PX8A 2P7HA 2XYRA 4FR0A 3VC2A 3MERA 1SVUA 4YUWA 1XDSA 3CJRA 2XYQA 1P91A 2PWYA 3KQWA 4GC5A 3GRYA 3HP7A 4XUCA 3BKWA 1JTEA 4RSRA 3C6KA 1JG4A 3KHKA 2O06A 1JQDA 3AY0A 3KR0A 5ICEA 3DTNA 4MQ4A 4QQNA 1R00A 5E9QA 2JHPA 5FHRA 5D1NA 3P2EA 3V8VA 3M4XA 3UZUA 5CVDA 3P97A 5CD1A 1KPGA 2GLUA 3ID6C 1IM8A 2EJTA 3BT7A 4HG2A 3G7UA 2BM9A 3BZBA 2BR5A 2NXCA 3GRZA 4PIPA 4BLUA 3E8SA 3OE4A 1O9HA 3FUWA 3IV6A 3DR5A 2PX4A 1X1DA 4GOLD 5EQJB 2HMYB 5F2KA 4POOA 3R24A 3ORHA 3DMFA 1SKMA 3FPGA 1NW6A 2XVAA 3SSOA 1RJFA 2K4MA 2VDVE 3ER8A 5CCBA 1R8YA 3G2MA 4GC9A 3RW9A 4PCLA 5DSXA 3R9XB 3A7EA 2IH4A 5DM4A 5FQNA 5JUWA 2BR3A 2ZSUA 3DLIA 5FTWA 3KR2A 1L3IA 2G72A 3OU7A 5G02A 4X41A 5ICFA 3SGLA 1IY9A 4FSDA 5K09A 3O4FA 1QYRA 4AUKA 3HA7A 4F86A 5K0CA 2ZZNA 4MTLA 3HTXA 2UYOA 4KWCA 3LL7A 5GINE 3MB5A 4ER6A 5DRTA 2OKCA 3BWYA 3P8ZA 3R6TA 3G2QA 3IYLW 2O0LA 5HFJA 3HVKA 1O9GA 2ZLBA 3HVIA 5EMKA 3V97A 4AZWA 5LQNA 1NV8A 3HCBA 4HTFA 3THSA 1Q0TA 9MHTA 2B9EA 2IH5A 1SQGA 3OE5A 2H11A 2YUIA 5K0BA 4RX1A 3JWGA 2ESRA 4Y30A 2GB4A 2QYOA 3GRVA 5FA5A 4C06A 2PJDA 2WK1A 1R8XA 2B25A 2ZBQA 2PGXA
chains in the Genus database with same CATH superfamily
5K0GA 3N2KB 1MEOA 1EK6A 3EH1A 4MYRA 4ZU6X 2OD7A 1U8TA 2EFJA 1UKAA 1GU0A 1X7YB 2OG1A 2QD3A 2XCUA 3MS2A 4X9XA 4CI0B 1W52X 4M1MA 1H93A 5FHQA 1Z34A 4AZ0B 1T4BA 1FU7A 1Z6QA 4IVNA 3S2EA 1N6OA 3B9PA 3VH4A 3DEKA 2DY1A 1EZ1A 3MCUA 5G1OA 3VOTA 2L18A 2P1DA 5G41A 5K3DA 4E5PA 4YREA 4E94A 1FFCA 1YONA 4RZQA 3T1QA 4CIBA 1GQOA 4LXXA 3THXB 1WY5A 3Q12A 5E0OA 4PZUA 4B3XA 2P30A 5LPNA 1UEIA 4JSYA 4KGDA 5DNWA 5HTOA 1PGPA 4Y9TA 2YKGA 3GELA 3IILA 3DKPA 2WD9A 3LXRA 4YAEA 2O2XA 1B8PA 4G23A 1SXJC 4F4FA 3ZYCA 3INNA 4W5TA 2ZXUA 4Q3DA 1VL6A 1BDHA 1DDGA 2AXEA 4FFNA 2GPJA 3BORA 2BGTA 2QD5A 2VP0A 3BIXA 5TV2A 1NUTA 2OGZA 1A9SA 3WGIA 2RI6A 2BFBA 4KUEA 4RPHA 4RJJA 3KVVA 1Q17A 2HRBA 3EGDB 4JT4A 1INLA 4LXYA 5DBOA 2AMLA 5CM8B 5E2AA 2CJWA 2B7LA 3BCHA 1LTHR 3G0IA 5LDGA 4D8UA 4TSFD 5BYJA 4D79A 5KYYB 2PSEA 2JFVA 2EV9A 5BNTA 2H7YA 3JX9A 4KSBA 2BBSA 5KSYA 1KOGA 4WL0A 1HOXA 2QVLA 3RJ9A 1ND5A 3QFRA 4I4TF 3SBDA 1TECE 1Q1QA 2Z5GA 4JI1B 1TVFA 2ZSBA 3BFVA 4Q1AA 5G0WA 4FMCB 2NYRA 4MVWA 1OGJA 3IP5A 1IOZA 2HGZA 3HCRA 5P8WA 4GMDA 3STVA 3HK2A 2W6NA 4ZQIA 3C3MA 3DZJA 4BAZA 3LCCA 5HJ7A 3NNDA 4CEIB 1MC5A 1DWQA 4BO0A 5B3KA 5AXBA 3EYAA 3NM4A 3Q8WA 1TMKA 3CEJA 5TS3A 3ECAA 4QNMA 2R1TA 2YINC 4RZSA 4TWZA 4P3XA 1Q0PA 1ZJ6A 4KXNA 3VX4A 5F7XA 4OQFA 4G3XA 3EGEA 1N36B 1VSBA 2JARA 3RARA 2CUTA 4WLOA 2GLXA 4JYBA 3Q2IA 2FPGA 3GCXA 2OA0A 4CIAA 2PNJA 1KOFA 2H16A 4HQRA 4A8PA 2BFFA 4BWYA 4EX7A 3MWDB 1T4GA 2CE2X 4PQYA 3GYGA 2PRYA 1MT0A 4LHSA 1E1DA 5CR9A 1YC2A 4MQUA 1IZ8A 1RM5A 3DULA 1E9SA 3AESB 3EQ9A 3K9FC 2ZAYA 2AJCA 3EFOA 3WLEA 1M2WA 2VP3A 3M6WA 2XQFA 3OVMA 4YNBA 2DWQA 5TMBA 3K2QA 3IQZA 3TIGA 1KI9A 3PHJA 2CDNA 2AE1A 1BDBA 1NXPA 1NQ5A 2C3YA 3I2YX 1XQ9A 3LBYA 2QN3A 1J8FA 4U7WA 3T3DA 1JHUA 4M9RA 2H2WA 2IHVA 3WRVA 3B70A 3HBAA 2Q7OE 1P1RA 3WYCA 5JAHA 3IAS1 3GLGA 1CRWG 3FTFA 1MABB 1VTKA 1XMVA 4QG3A 4GL2A 1PNTA 5T4BA 2Y1XA 3GCGA 3L7MA 4RIEA 3H9CA 5ITZA 2PBRA 2CNKA 1U0HC 2IF0A 4AS2A 2FXIA 2YC2C 3GJSA 2G4LA 2PZAA 1CZHA 1K63A 4AZ3B 4JI2B 2LTAA 3TTSA 1S3GA 1UPUA 4LZWA 3RRJA 3PNPA 1GT91 1R0KA 5JCXA 1UDAA 3EMBA 3DOCA 2IXTA 4GX2A 2ZYHA 2GJAA 1YCFA 3QE3A 5LM3A 2XVMA 1X38A 4FZ3A 1VZ3A 4P34A 1UM8A 1ZI6A 2D2EA 1WCXA 2R8EA 4QDXA 4R1PA 2M6KA 5BW4A 3ZJTA 3PFHA 2PZ8A 4S0XA 3B1JA 1E6UA 4QL3A 5D3QA 4P0TA 3WGJA 2CBXA 3HN6A 2RIPA 4NCKA 4C88A 1AS3A 2HYIC 1GQQA 2A59A 4RSMA 4D4JA 1JHQA 4GR4A 2VR1A 1G5RA 3HN2A 2F55A 2YW2A 5KDLA 4DKJA 4V0SA 2A6PA 2BP7B 1XNHA 5GJVC 3PQ8A 4JUAA 1G5PA 2IYLD 3U49A 1Y5MA 4PNZA 1OHHA 3LK6A 3PCXA 4D9FA 1LCIA 2Q0SA 2EL7A 3T3EA 1AKRA 2IPLA 2K7FA 1P9LA 1RPNA 3DXXA 4Y0VA 1FYDA 4MPRA 2FZVA 1Y5LA 5LCXA 1BAPA 3UCXA 1GITA 3Q15C 5E9AA 3QMVA 4Q3KA 1QK3A 1O57A 1PTJC 1RKQA 3AIKA 3HEBA 3NASA 2H9AA 7MHTA 3IC5A 3ZD9A 3SQOA 1VKZA 1M1YE 2FP3A 3NVMB 2R7AA 3P9XA 5B7NA 2WAAA 3BJIC 4BKQA 1HL3A 2CL7X 4UUPA 1A7AA 1I10A 3AILA 4KX5A 4ODIA 2PE5A 4HWTA 5FLEX 4TL6A 1K7YA 4JT8A 2ZDQA 2J41A 1Y63A 3EWAA 4PNHA 1C1YA 4DRXA 5KVVA 2E5FA 2GCOB 4HX2A 2A1TS 2FNAA 3H4IA 3I2JA 4Q9DA 4QUGA 4BMXA 2VG8A 5J63A 3ZV6A 5L4SA 4KNWA 3ZU6A 1HKHA 3ECCA 2CUNA 3GA0A 3SM9A 4MMYB 5A9TA 4HNVA 4JYAB 1NNEA 1JG3A 1WXXA 3JV7A 4N5IX 3S55A 1HYQA 4EQ6B 2TMYA 4N5MA 1Q50A 1RJWA 1YIOA 2DRIA 4PM4A 3OZEA 3RG2A 1AKUA 4ER7A 4UU1A 4LNUA 4ZHSA 5F2EA 3PQCA 4FBMA 3PJFA 1Y4DE 2J9XB 1TUGA 2IZ6A 2QJFA 2ZI5A 1CT9A 2QLLA 4MW6A 4A16A 1HBJA 2WLSA 3G2NA 4HH1A 3ETGA 4DNXA 3W5DA 1HLDA 4WXHA 3D4IA 4CG3A 1GGMA 1BXKA 3PRKE 1X9HA 2X0DA 5CVVA 4AX8A 3EIFA 5HRCA 1TYCA 4ERNA 1CIJA 1QJCA 1LEHA 1F2TB 1U04A 5I9TA 1FVFA 2IS6A 3LZCA 2VK1A 3MWKA 3TOZA 2F2TA 2XB8A 2B30A 5BYKA 2SBTA 4WN9A 2DT5A 2IS1A 4BEJA 2W70A 4HQKA 3U1BA 3GUYA 4MMZB 5HIMA 4KFCA 1U3TA 2FZGA 3PWKA 4PO8A 1RIIA 3KWFA 3RT7A 5DGXA 2OB2A 2R47A 3GJRA 4IEFB 5IDYA 1T1RA 1T2DA 5CTAA 4KPGA 3LUJA 4M37A 1O5OA 2DECA 4INPA 3D4NA 4TOIA 2VJKA 4LYHA 3TJRA 1R5OA 4QYMA 5C5CA 1B1AA 1Y7HA 2IJGX 4W6ZA 5FAXA 5FI0B 4CWAA 3ZWBA 2GKGA 3H8VA 4P98A 4URWR 1KJ8A 2QAGC 4QFCA 3IO3A 1GR1A 1BNCA 2RH9B 3NTXA 4K9LA 1UDRA 2FN4A 4JB3A 3SMVA 3KSDO 4DVGA 1UIMA 2PIDA 1QS0A 2ZUDA 4FDVA 4OATA 1B73A 1B4DA 2Y0DA 1ZI9A 5AM4A 1HL7A 5AKKA 3ENVA 2FPRA 4NOMA 3AHJA 4M8KA 4JIMA 2B8JA 3M5PA 1EYZA 1P4GA 2QLMA 4R2XA 2W0MA 1DJPA 4MP8A 2C7QA 1HX7A 3BDAA 3LAWA 3D31A 4DRYA 2PVSA 1X94A 4OHUA 1ESNA 2C2OA 3FVTA 5AKZA 2NM0A 1Q0LA 2EJWA 4UNIA 1REQA 4BJ5A 1XCJA 3CV3A 2L42A 4DGQA 2P4EA 1OYYA 2HPHA 5BT8A 2ZWOA 4OK5A 2BFBB 1O3YA 2YOFA 1AN0A 1PT6A 1Q5PA 1XCBA 4G09A 4GRIA 4KIUA 4PWZA 4Q4LA 5I9MA 4CMGA 2CJWB 2I4MA 1NKTA 4RKRA 3DE6X 1TZJA 2XDWA 3QIAA 2HU5A 1T4CA 4W99A 1GQYA 2FHPA 3MILA 2QEQA 3ORQA 4CCSA 3JTMA 2PKYX 3KSMA 2W2MA 1L7EA 4NYIQ 5G3YA 2NPIA 3EA4A 3UMMA 4CT0A 1KZ9A 2XUHA 4UQPA 1IH8A 2HQ1A 5EHNA 4ZEOA 3WLRA 5BNZA 4QJ5A 5JANA 1H1DA 4YP6A 2V7XA 2XUAA 2Z2ZA 2A5FA 3G2OA 2JATA 1EK0A 4WNIA 1X8LA 1Y6ZA 3UEOA 1T1IA 4K6FA 3WGZA 4RM2A 3L1JA 4ND5A 5T67A 1W73A 2AQ8A 2JAXA 3HCNA 3RS2A 1V4NA 2F8MA 4A27A 5B58C 4A82A 4TTQA 3UXMA 4LWQA 2A4KA 1CJVC 2E4XA 3FA2A 4ALKA 4EYOA 3KDSE 1TMOA 1M6HA 1VJRA 2X8WA 3MQ2A 5EZYA 5A3VA 4EAAA 1RWBA 5ALZA 4D02A 2FPGB 4AQ7A 4E5VA 4NNPA 5CU7A 3L6DA 4XXHA 1IY8A 1U8ZA 2YMLA 1ZESA 2RBKA 4I19A 4NY1A 1UBMS 1OF1A 5FOUA 1NP3A 4JVLA 3BRQA 4D0RA 3U4AA 3V1LA 2UYHA 1H2ZA 1L4GA 2R6FA 4R1QA 4I4NA 3GC6A 1U2DC 1YRQA 1DFIA 3CLHA 4OB8A 4EB6A 5EXSA 4ZOEA 3N86A 2N0SA 4FI3C 3RK1A 4BNUA 3EFOB 4I3FA 1N8TA 5TF4A 2R1ZA 1T9ZA 3GT3A 4K03A 4PVDA 5LBUA 1RMTA 3PC6A 5JISA 4Z86A 3LLVA 5DXJA 2XZLA 2VF4X 5JWHA 1SRQA 4XGIA 5BQPA 3S1SA 2O8BA 1RYZA 4RZXA 1T9KA 3ZWOA 4PX3A 1BX3A 4BV2A 1EQ2A 1V2GA 3V1MA 3AWDA 2ZPAA 1RIFA 3LVBA 3W8RA 4LUCA 3GLGB 5CG2A 1GXSA 1VE1A 2SKEA 4COKA 4YFVA 1H2EA 1M2JA 1NLZA 4H59A 1RRFA 5ITZB 2EKBA 1GPLA 1RWQA 2XNCA 1WQ4A 1DX6A 1N6KA 4J43A 5H4HA 1SC6A 4QT4A 4BKPA 3Q7RA 2QMQA 1JJIA 5DI3A 5CIQA 5D00A 1G3MA 2QR3A 3PHIA 4QPDA 3LXXA 3HR8A 4AVYA 4HFNA 1ONSA 1KORA 1VM6A 2AFRA 2GXSA 3LYLA 4PIVA 4UUBA 3VOBA 4DN6A 4F6RB 2QTLA 2HSJA 4GNKA 1Z7WA 4TTSA 3WOHA 4YXWA 1H9BA 2BD0A 1P8JA 1RVV1 2C94A 3I9NA 1GQFA 2VBGA 3I4LA 2FYTA 5HSGA 1Z0UA 5JJ5A 2QL7A 3GEGA 3N0TA 3N8IA 2ZIGA 3GCWA 2MMGA 5JSYA 4OUDB 3KYDB 4ZOLF 4EHIA 1O6CA 1ZEMA 3GNQA 2ATIA 3N8NA 5A06A 3EPPA 5KJCA 5LQAA 5TLSA 2VIIA 3HLKA 1U2GA 2DH6A 5KNBH 2ZREA 3LCVB 1R4NB 5D7BA 3A28A 5ED4A 2CNOA 4MUNA 5DCLA 2GCGA 3SJZA 4DM3A 1XKQA 1F17A 2PX2A 2CL0X 1L7OA 1O2DA 1KDVA 3O94A 2PX8A 3L3BA 3E15A 4I9HA 3L92A 2AHOA 1IK6A 3C3JA 1M6VB 4KMSA 1SVUA 2FG5A 4WCFA 1W5EA 4PZPA 1JR3E 3BYZA 3G8CA 3VHRA 1A77A 2NLOA 1Y3FE 2EP8A 2ZDGA 3EF1A 2O06A 5FXMA 4MDYA 5A5DA 3AY0A 1XO1A 3R41A 4YJDA 3QUQA 4CL0A 4D46A 4QHSA 3DTNA 3ZZMA 5I7UA 2FUEA 3QKIA 1CERA 3SQDA 5JMWA 2V6FA 1KMNA 4GX1A 4DQVA 3P0IA 4I9UA 4LJ4A 4XD2A 1MBZA 3RU7A 5AJTA 1GA4A 1Y82A 3EGOA 1R0LA 2WDPA 2V7PA 3VO8A 1W30A 4RA9A 5AK5A 4YRNA 1DU4A 4LS3A 1FP7A 4Q00A 2ZXEA 1AK2A 4ITUA 5E7JA 3DHVA 3Q3HA 5F35A 4K0RA 1Z6PA 4XZ3A 4QEKA 4L4YA 5FLXA 3TDKA 1HE8B 4R8VA 2B34A 2H1OA 1JWBB 2RBEA 4QGAA 5DBGA 5KINB 6AT1A 1EP2B 2VDVE 3GEEA 4BNGA 3D1LA 1TTQB 2WM9B 1OZ0A 1W1UA 3SHOA 2H7VA 2R5NA 3FPCA 4LNUB 3IR5A 3O2SB 1RRKA 1H5NA 2ZSUA 3EPRA 4WX2B 3HN7A 2F9MA 2NADA 4OI4A 3KUKA 1QZUA 4E6PA 1IY9A 2V58A 1PV1A 5EUMA 3AHHA 2WQ6A 5SY9A 4NYMQ 1M1XB 4FE4A 4HOYA 1QFJA 4MKIA 2BGMA 3VAZA 1NMXA 3BE5A 1TUEA 4DCCA 3FCEA 5LZ8A 5L8VA 1MEEA 3KB6A 2I6SA 3P8ZA 1CFJA 4BQOA 5WRFA 2PXHA 3W0LB 5G3ZA 3QXCA 2IHJA 2JVKA 2QORA 3V97A 3L49A 4WN9B 4W1SA 4B3GA 1T3LA 3S7ZA 3IR7A 2DFKB 3DE0X 2XJ9A 1VLHA 5D8DA 4RIGA 1EKXA 3QOYA 2YUIA 2QG6A 2F67A 1TTHA 2AFVA 2F17A 1P2TA 4Y30A 3TR5A 4ENPA 1Y8AA 2G6TA 1MA0A 3G9XA 5A04A 2NUAB 2J31A 2DPXA 2XUIA 2Z58A 4AJNA 1ISJA 3UW3A 2ZVDA 1B0AA 1D04A 3EZLA 4IWYA 4L78A 2LDXA 3HRHA 4A10A 2LPMA 1XXHA 1M6YA 1P75A 3PUXA 3OPMA 3AQIA 3ZY4A 2XWPA 4WXPA 1Z2AA 2PKQP 3LNCA 5HE8A 1PJ8A 3RB8A 3LD9A 3N7UA 3PFFA 4JI5B 4ZI7F 4Q24A 4MUKA 3UBTA 4CMEC 4X93A 3H4TA 2CVQA 3AGPA 3U4HA 3VOAA 4NXNB 5F1KA 1C41A 1BWRA 2MSKA 2ZJ8A 3GGOA 2HLNA 4F60A 1NBOA 4QBHA 2I7XA 1QONA 3T9AA 1M2OB 1NRJB 4HMOA 5JJCA 2I80A 1UIRA 4RF4A 3U3XA 2BGGA 3KZ1E 5JPIA 1KYWA 1JFFB 2D2VA 2AQHA 4Z3DA 1OIWA 3MN1A 2HXSA 4RVCA 4EARA 1CYEA 5EPUA 1REQB 4WSOA 4KV9A 3EXIA 2AG6A 4DC9A 1TCCA 4DAOA 1T5TA 4DBVO 3BH6A 3ESYA 1JEQA 1Z6ZA 3BXHA 2QPAA 1NAHA 3QPDA 4GXNA 4OYYA 4XGQA 3T7EA 4DY4A 3COJA 1C4OA 1R4MB 4B4OA 5JSQA 2PGIA 3WHLA 2GCEA 2VAVA 4DQXA 4DM7A 3O8BA 1WTCA 1KBQA 1T4CB 3A25A 3BD9A 3GVHA 4AJJA 2R6R1 3CX4A 3NBFA 5L4LA 5CDTA 4MCHA 5IARA 2VSXA 4P22A 1VLLA 2GZSA 4FGJA 2OBYA 1Z7BA 2PIAA 4GPEA 4P3YA 1S3FA 3HFGA 4JC8A 5CW2A 1BGVA 5K3FA 4C30A 1BHSA 4EKIA 4EUEA 3OZTA 3EH2A 5LXTB 3BWDD 3AEXA 4GLJA 2NNLD 2O48X 1UDCA 3D8HA 4MPPA 1NJGA 2Q4TA 2ZUSA 4I5IA 2E37A 2I1VB 4GP9A 4PV7A 2XD4A 4G63A 4X3PA 3TMYA 2PT5A 2V1XA 2ZS8A 3H1EA 3I52A 3I3SR 5F9HA 4RHCA 4KQHA 5AK4A 4DIFA 5AI4A 1RQXA 2EGUA 2W9XA 3FWNA 4FSHA 5EZYB 2YWRA 1AQUA 3IHLA 3NHYA 2VQEB 4HDCA 1ZN8A 2DR2A 1OU4A 1NYTA 4QBTA 1C30B 4AULA 4UVHA 3DW1X 2PU5A 2A0YA 2XHEA 5AK3A 1QU2A 4EB6B 4I1YA 5AYVA 2FW7A 1RM0A 3MJVA 2G9NA 2UZ1A 3LT2A 4P9NA 2J8ZA 4BTVA 2Z6QA 3PGMA 4XQCA 5LWQA 1KFJB 3KZKA 4DB2A 4AU1A 2FQYA 2QRUA 4CLRA 2X40A 4EVRA 4HQOA 1YGYA 2X3YA 2AOUB 4RLSA 3M4YA 4JEHA 3D9QX 4LCJA 1Z2PX 1U9CA 2HOQA 2I76A 1MO4A 4Q1CA 4AXXA 2J3LA 3IHKA 3E48A 4J16A 3I37X 5DWVA 4CCWA 5EWLB 4DIEA 2CLFB 5BT9A 1SG9A 1MV8A 1QZTA 3E5NA 1DBSA 3WL4A 1VL1A 4OSPA 1SK8A 1GPWB 2IPAB 4JK3A 1GXSB 2ZULA 3HNPA 1KJYA 1MPXA 2G0TA 2ACWA 2I33A 1CF2O 1O9BA 1WDLA 1YJ8A 2IIBA 2OO7A 2YY7A 3K96A 3TDMA 2BFDB 3HYTA 1OH8A 2RGUA 1UMBA 2AXQA 4LTNA 3SC2A 1JKXA 1ORDA 1Y5NA 3EISA 1GA1A 3O8OA 2VZEA 1P9RA 3B38A 4LYAA 1YZ3A 5M3BA 1F2UA 5KNCA 1C7QA 1LBIA 1N6PA 1UBSB 4EMTA 1NP6A 1XUOA 4WFKA 4GVLA 3OZ7A 5AI5A 1DCTA 3KU4A 2Q27A 2WF8A 3DNMA 5KYNA 4S1NA 3U80A 4HGPA 3ZJUA 4LG1A 5BR8B 3KSBC 1CHDA 1NUQA 1MIHA 4PYLA 1FNSA 1BOOA 1VXOA 2ZQ5A 2YJ4A 1M1NB 1A0OA 2PX5A 2GZ2A 2XPCA 4DWOA 4U8HA 2OBXA 1JECA 2L2QA 5FTJA 4C5CA 2ZM6B 5I4BA 4HN4B 2AL7A 5IU6A 3GHHA 1AGRA 4J0IA 4K9RA 3ZEIA 3X1ZA 2H8KA 3GBSA 1TZBA 2JFNA 2OQIA 2ODAA 4LGYA 1JIJA 1ZY2A 4HVTA 1QFYA 1NI3A 1K8RA 2PGJA 3O9MA 1WLYA 4RV9A 1T2CA 1CEEA 4QBKA 3VNUA 5B6JA 1E7MA 5DNCA 4B79A 1HNWB 4QM7A 1UKVY 2ORYA 2B8NA 4LOLA 4UHHA 5ARCA 4Y6LA 3C5CA 1ORTA 5HIKA 2WC1A 3WA7A 1QPZA 2O8FA 4KQIA 1P31A 4RF3A 1JHAA 3I5UA 4WCFB 1LX7A 4JXJA 2YCLA 2PBZA 1IBRA 3FAZA 4M1KA 4PLVA 1UK6A 2LD4A 3DV2A 3TQRA 4JXZA 1ENZA 1VP9A 1PT5A 2A67A 5EIBD 3R76A 4F1KA 2ORIA 2PGDA 1B26A 2AFIB 4I9GA 5J58A 4CIWA 3IT3A 4CMCA 3BK2A 5ERGB 5CXUA 4MRPA 1I51A 1M1ZA 2A9FA 4AKGA 1M5UA 3BS4A 4KUHA 4P83A 4X94A 2WIAA 5AKGA 5EINA 3RS7A 1TC1A 1O94C 2G4CA 5EXEA 1HA3A 2BEWA 4OHWA 4R1OA 1Q7TA 3MLAA 2H18A 2JJMA 4DJAA 3EMKA 3PFKA 1BEEA 2I62A 1PEYA 4YQEA 5FO0A 3ZE1B 4EMBA 2Q3JA 2O7RA 4KN5A 3D5EA 4QG7A 3WLSA 5EE1A 4C5BA 5KYGA 2AA3A 2V0CA 3ABRB 4Y2XA 2CMDA 2CLLB 2YV3A 1QIJA 1Z07A 3FMIA 2ZUCA 4YB8A 4ENVA 4LWPA 2J3IA 3GJ5A 2OCGA 4PFKA 1Z35A 4KTTE 1RE1A 3QYPA 1G5TA 3SLGA 5AVTA 5IJ9B 2RJOA 2WJ6A 1DEAA 2WA2A 3I1YA 2ENWA 2VJYA 1F9AA 1PT8A 2Z09A 3LUBA 5LA6A 5MFZA 2P41A 4H6VA 4XEUA 1RYNA 1UP4A 1KA9H 4DQDA 5B3LA 5I7OA 5C37A 1L1RA 2POQX 4PCAA 3ND5A 4MWDA 2HA5A 2A7XA 2YIJA 5DNVA 4C43A 3GZNA 2QJTA 4UMFA 1HEYA 2CCKA 3KUDA 2ZGVA 4MV0A 2BH2A 3AHDA 3WRWA 2F4NA 1LJLA 3BF8A 4LN1A 2NO4A 2X86A 1NIJA 2Z1MA 4ZOBA 3ZW9A 1N6NA 3ZGVA 4ECEA 1UJMA 2Y4NA 3E0QA 1G17A 2F8TA 4QPPA 3FBWA 1LS1A 2UVPA 1YKSA 4M86A 2D1TA 4AG5A 3EOZA 3IOEA 1OX6A 4NDAA 4G5HA 1SFRA 4L6CA 4UVEA 4E32A 2YZ7A 4RVDA 2UUAB 3NTOA 4D56A 2Q9AA 5AW1A 3V5NA 3MCZA 2OP0A 2ZBUA 4BV8A 3FPJA 2FGJA 2EXXA 2X9NA 5DBEX 4ZKEA 2AN5A 1CQZA 2J3JA 2PMCA 4O4LF 4U7PB 2ECPA 2O1EA 2H0RA 3IKMB 1GY8A 4GSLA 3B60A 1LRJA 1EFRA 4CQNA 1ZQ9A 2EGGA 2GYVA 3LPMA 3FDFA 2O07A 2Q8QA 3BL6A 4XLZA 3NDPA 4BE9A 2ZETA 1YNOA 3OCXA 3OJWA 1QHHA 3UXEA 5EJ8A 2XMCA 4FFRA 1IYZA 1HO3A 5G4LA 2NU8A 1VG8A 3IUEA 1GKLA 2VHQA 3RPEA 1JEQB 3TJMA 3W1VA 3WYFA 3TZCA 2A3NA 3HYRA 2AT1A 3GJYA 4H15A 4RORA 1UK8A 3EVBA 3TW6A 8AT1A 2PV7A 3BMXA 2JAPA 3GFQA 1NXWA 1HKUA 3RS0A 3K8QA 3WWCA 4BYMA 3F7NA 5H68A 4G25A 1TAQA 2G6BA 2PKXA 4TLLB 3F7TA 4CGYA 5KJ6A 1USWA 2ZWMA 3DF9A 3BEOA 1U8UA 4IKEA 4Y2YA 2A7QA 2F43A 4RLHA 1VSVA 2FFAA 2WYOA 3IP8A 4K05A 1XZAA 3WBJA 3ZGYA 3CPHA 2QQEA 1EDEA 4LHXA 4D3XA 4HP8A 3DVAA 5KX5F 1RZRD 4RGBA 4OKIA 1W7AA 3D3NA 1NDUA 4K26A 4X7BA 2AKEA 5ED0A 1NVBA 3HCEA 3TQSA 2PT6A 1Z6YA 4RESA 3WWOA 3OWOA 2I6FA 4WCFC 4HAVA 1GU7A 5SY6A 1YF3A 2KX7A 4F3YA 1F8GA 1Y6RA 4C78A 1RE0A 2JG3A 5FT9A 2YV5A 3K8OE 1GSIA 3KR9A 2DP4E 1WSWA 3CUWA 3Q3JB 4ACBA 4XUDA 3SYNA 4OA5A 1M6WA 1WMFA 4F2PA 1QFMA 2X14A 3OCJA 2C04A 2G07A 4EUHA 3QP9A 4ZK6A 3IE1A 3V3KA 1F06A 1KPHA 3EIHA 5AJZA 4DPKA 3TL6A 3F6YA 3GFTA 3W9UA 3DNPA 2J9RA 4FOTA 3GVPA 5T64A 3F5FA 4BX8A 5AM2A 2V5AA 5JVDA 2UZ1B 4N7JA 5JS7A 1DC5A 1V95A 3WAJA 4IDOA 1YB4A 5JCZA 1OLSA 3GPDG 4GVXA 1JVSA 1DAEA 4CLRB 1RS0A 3R3SA 5A62A 5IAKA 3O0TA 2I4IA 2P6MA 2XOKD 2IVZA 3G5MA 5C81A 4B6OA 3HJFA 5JQGF 2F3PA 3NU1A 3W2FA 4M7RA 1Q19A 1ZVMA 2GHIA 2TS1A 3PHLA 4LPKA 4Z9BA 4DKXA 3A0UA 4LFBB 1EE9A 2NXNA 1EUZA 2ZIFA 4OFXA 5EIBC 3I92A 3WWYA 4BDSA 2UUBB 1RLOA 2B9VA 1I7QB 1GGHA 4KQXA 4ZPJA 3UWPA 2HC9A 5EPEA 2X3FA 5FNVA 1UMBB 3SC2B 3ZE9A 4LSWA 1YR9A 5D5HA 3U4QB 2ZCJA 8ATCA 2V65A 4MQEB 1TK9A 5BWBA 1CUGA 1F2UB 2RB5A 3SZGA 1VECA 2EJBA 2BH9A 2FG7C 4L4RA 3GAFA 1DARA 4WT7A 3OOHA 3U4IA 4A1OA 3WK7A 2QBYA 4B6JA 1ORVA 3GP8A 1QJ4A 1ZRNA 3ACDA 1MUUA 1IJEA 1HQYE 1U5CA 2JFXA 2YWXA 3H8WA 2B83A 2BMAA 2H92A 1E1MA 1O95A 2X23A 5IKOA 1YD7A 3WSTA 3DWGA 4EGJA 1NG9A 3M9LA 4DEVA 3QWIA 3JAWB 3VGPA 1HNXB 1EJ0A 2I71A 3P9IA 5EOVA 1YAJA 5E1MA 2H4HA 3UY4A 3VI4B 1SWWA 1G18A 3BHMA 1PVOA 2VWPA 2Y1WA 5TIIA 2FMUA 2AWOA 4DR3B 1E0DA 3ZLVA 4XI9A 1HLPA 3IQIX 3ZDBA 3DVQX 4IFEA 2A8YA 3ESQA 4CI9A 2WAMA 1EWRA 3W3AA 4OGFA 4OQMA 4WACA 4QXRA 4G37A 2O8FB 1TZMA 2X5OA 3AR6A 1Y4ZA 3ZZ0A 1AH2A 1XAGA 2WHXA 1XG5A 1ZA2A 3CZQA 5AJXA 1ZH0A 1XA3A 3HWRA 2D7CA 1DKLA 3KQWA 1VA4A 2PWYA 1KO8A 2JHFA 2MR6A 3LX4A 5IJXA 2Z30A 3TJZA 1ZITA 2OM6A 3CO5A 3NANA 3EW9A 3GJ3A 1AKWA 1U99A 2OHJA 1NE7A 2HA7A 2Z6VA 5EAIA 3N8GA 3R6LA 3GRCA 4M2LA 7GPBA 5IM4F 1BX1A 1IIRA 1J49A 4OMUA 3QXJA 3HEAA 3ML1A 1Z68A 4RIIA 4HMPA 9ATCA 2UZ3A 2XYPA 4XSVA 4IPTA 1RPAA 4RGQA 3SS9X 3WBFA 5FV7A 1GRRA 2G04A 3E1SA 1IEWA 2QHXA 4TMFA 5H81A 4DV0B 1UMCA 5BQOA 1Q2XA 3SK0A 2HF9A 2BMEA 5DW3A 3UGTA 1NW9B 3S5UA 1NULA 5CCEA 1E0SA 1P19A 2DTEA 5JS8A 4AURA 4C4YA 3MRXA 1ZK0A 2Q3MA 3T6KA 4LIPD 3E84A 6REQB 2FA9A 4PU0A 1H6BA 5FQNA 1XZMA 1TYEB 2Q46A 4PQRA 4UATA 4MVJA 2GOYA 2G72A 4IJMA 1Y6GA 5ALSA 1T4DA 1LRLA 2OENG 3QUAA 4O2BA 4L4SA 5CEEA 2E1PA 5LA6B 1I94B 2ZQYA 4ZJYA 2C7GA 1W87A 4ZI5A 3UC9A 5I3CA 5JSUA 1EFRD 4HDMA 1U8FO 1I9CA 4H2DA 2P9CA 2XF8A 4OYHA 1USUA 5EMKA 4AZWA 2IK8A 4IDQA 5FOSA 5AJUA 4BFWA 2B9EA 3MNFA 1M7BA 3RLIA 4I0WB 4ND8B 1XN4A 4C6RA 2H2HA 1E7YA 5CX1A 1XTTA 3A4NA 3SX4A 4N82A 5EXXA 1S8OA 1C50A 3QHPA 5FWXB 3NI2A 1VMEA 4QX6A 2UVPB 4RBNA 4WFJA 5IYZF 5TQJA 1NY6A 1X9GA 3TVYA 1P0PA 1CUSA 1P7CA 1Q1GA 2OQ2A 2E82A 4EG4A 3W9SA 1BDJA 1ECJA 4LCEA 3OETA 4X8LA 2JDIA 2Q2OA 4DIMA 2CNLA 1VCMA 4B32A 4J16C 1NURA 2V96A 4V39A 2C78A 1CULC 3JQ7A 5COAA 5AK0A 4FOLA 2CVOA 2ODBA 3PJDA 4LJKA 2AR7A 1NBHA 4K8RB 2ARKA 1KI6A 5E7IA 1LV8A 2OLEA 4I4LA 4DCTA 4ME6A 2IEZA 1E7RA 1TA0A 3USES 2YMPA 3ZZ1A 4MHOA 3EPLA 4UQOA 4HD8A 1AUPA 2VJLA 4MEAA 3PX7A 1Y3BE 1EVIA 3LKVA 2WU8A 3F96A 4X90A 2HHCA 3IIMA 1M0SA 4JVNA 2HFKA 3LKDA 4J1TA 1OZAA 3ZY2A 3T7IA 1QHHB 1RQ7A 1S2NA 1TCVA 2HT6A 3LIPA 1CP2A 3PNYA 3RJ5A 3REQA 3GLFA 1AT1A 4JC0A 4UASA 4CMHA 4G5XA 4Q1EA 2NU8B 2UUPA 2WYIA 4G4SO 1NL3A 3NBYC 1G291 3BTVA 1SCNE 4GI3A 3WGTA 1JDBB 1UFKA 1GQRA 2VXBA 3DXYA 4G2TA 1QCCA 5CAEB 2IYSA 2KSQA 1QYIA 1H4QA 2Q1TA 2Z2XA 5MF6A 1WW3A 4CL3A 4KI7A 4OLFA 1Q6YA 4Q7EA 1QV6A 2UUOA 4HZIA 4D4GA 2EBHX 1FDSA 2QW8A 3ZCRA 3BZWA 3UVEA 2VF2A 1Z17A 3B3JA 2C5BA 1NWCA 1PFVA 3AIMA 3L7YA 3NJRA 3C1OA 4FMCF 1TGYA 2ZI7A 3VR4A 4AN4A 4QASA 1PJTA 2FPWA 5AM5A 2C7BA 4P82A 4PN3A 2C0QA 4OBXA 4I3GA 4KXVA 4BVBA 1ZO8A 4GZLA 2YHAA 4Y2HA 4IXDA 1KJNA 4E51A 2H63A 2Q5CA 3A9TA 3EGIA 1HYBA 3JQQA 1V41E 5A6SA 4NMXB 1Y6FA 1Z37A 3N0RA 1TZKA 2ZR7A 1OAOA 4HGYA 2O2JA 4IIJF 4MCIA 1P7ZA 4FWBA 2XKBA 5TF0A 3UYKA 3Q6NA 1K66A 3E3LA 4IJVA 4Z0HO 1UBCA 4JZYA 1ORHA 3TQHA 1YHNA 2OC4A 1ZD5A 2GAIA 4JI0B 3LVRE 3L0IB 3ZLJA 4KDEA 5BN5A 5HXAA 2CK3A 5CYOA 3IKJA 1LC3A 2N42A 5F1PA 4RTKA 3OO0A 4K9PA 4DMCA 3RADC 3U37A 4BXOA 3CTMA 3TAXA 1W48A 2NN3C 4B1FA 5C18A 3VC1A 2NZ8A 5AW6A 4FFOA 5CJ2A 4GM1A 1V48A 3OOSA 5JVDB 4WOCA 5BR7A 2MMCA 3KEQA 3B1XA 3IULA 5LQRA 2R44A 4U0KA 4M98A 5DM70 3V8EA 4P4SA 1PJQA 5LB2A 1OLSB 4M83A 1VL5A 4CVNA 1X1SA 2JJ1A 2OO5A 1O95D 3CZMA 4GZMA 4YRRA 1OC2A 4WKNA 1WCYA 4M1EA 4ZV4A 4EY7A 3NHBA 2J7KA 2O05A 2GXQA 4PZZA 2J0QA 4KO3S 4W5JA 2PMFA 5TMPA 1T8UA 1V8FA 4U2FA 1L5HA 3H5NA 2I3BA 1E3EA 1PJ2A 2NSJA 1GUFA 3LS2A 4QJIA 4OK6A 3F71A 4Y7CA 4ZREA 5GGXA 4D4MA 5J59A 3WFJA 2OEPA 1OBOA 3QELA 3ZIAD 2G88A 3PQFA 3AI3A 3FIJA 1FZQA 1RI2A 4JJGA 2QRNA 4OL9A 3D0RA 2X19A 4H7JA 4TVBA 4AKTA 4EL5A 1PDVA 2QSZA 3CM0A 5ESXA 1XQXA 1E5DA 3P9CA 4BTEA 5K8JB 2NTYC 3AJAA 4RCZA 4B4UA 1G19A 5AOVA 3SE7A 3ZKWA 1NJ6A 3NKFA 1U9YA 1OFVA 2NSYA 3BXEA 3H5OA 4NU6A 4QUKA 3V6MA 1KK0A 3I62A 3WZLA 3RFFA 5DTMA 3GD7A 1WEKA 3R7WA 4BBZA 2W2TA 2AOVA 1CJTC 4M88A 3ZHSA 3RS8A 3P0FA 1GNQA 4E5MA 5DM1A 3THYA 3ERCA 3BFKA 2JHCA 3EARA 4JJ6A 3T34A 3NHZA 5EP4A 3SBEA 4D57A 3V6LA 3T7TA 2VCEA 2HCRA 4JLUA 1KVUA 2RAUA 4JB0A 1J24A 3M6LA 2V98A 2WWVD 4G4GA 3MGGA 4KH0A 1S4MA 2YZNA 2J07A 3LYAA 4MUEA 4DGSA 3M3DA 3A2MA 1DRUA 5F98A 4JQSA 2J30A 2RBGA 1YL5A 3I9V6 4H7PA 1O8BA 4DQ0A 4JR1A 1ONPA 1PK9A 1T1GA 4HFJA 2FR8A 3A3KA 3PUHA 3LRPA 4LOHA 4MULA 3VR6A 1GSOA 4YMGA 5TPZA 5F23A 4C29A 1GL9B 4LXGA 1IPEA 5FPHA 1JBEA 2VJOA 4GKAA 4AMGA 4HRVA 2P4SA 2VP9A 3EDQA 3MJRA 3NDIA 4BYGA 3RNOA 2WNHA 1K2WA 3UG7A 2P69A 3GJ4A 1W8IA 2FN8A 3DE2X 3RQSA 3DE1X 3UV7A 1ODSA 1E1KA 3MELA 1PR1A 4JVMA 2G7ZA 4PQGA 5ALXA 3R40A 3IEVA 4NS1A 2NU9B 1K68A 3M49A 3HUEA 3EVTA 4AUMA 1JSLA 1EBBA 1I8TA 2XMGA 1AQNA 1K7FB 1G21E 2KB0A 3N70A 4GLLA 2N9UA 1JDJA 5C4MA 1GJRA 3OFKA 2DOKA 4JKOA 3WGHA 4R81A 4NWIA 1KBOA 4G5QA 4L27A 5JAIA 3HDYA 2Z5FA 2JI9A 5ALPA 1UBEA 3FZQA 3R5TA 3AEYA 3IUYA 2JDID 3L8YA 3QYFA 4XFJA 1PGNA 4HXFB 3UHJA 1ADFA 1TA4A 3DTTA 2Z98A 2BE9A 4ZXFA 1YJQA 2ZE6A 4BDTA 3GDFA 3LCUA 2YNMA 3ZJ4A 4O2BB 4GM0A 4Y2GA 3EE6A 2ZJBA 4KXYA 1RRMA 2F8LA 2QPTA 2Y77A 1ONNA 4OXNA 3WZMA 1NA5A 3FYDA 5JZBA 3NRBA 3HS3A 1TQ4A 1DAIA 5F77A 2RC6A 1BHQ1 2GJ8A 1Z4JA 4REQA 5DT2A 4HDMB 4Y6OA 4BQEA 5ER9A 2YJNA 4GG1A 1LX6A 2EKZA 2GZHA 2WJGA 3HXKA 4WBSA 4E7PA 3ZWVA 3I83A 2CDCA 3A6EA 5G4KA 3JS5A 1MC1A 3Q7EA 2FF5A 3TRIA 5DTEA 2WWFA 4PBTA 1SXQA 3COVA 4RABA 2XZPA 1EP9A 3PXXA 5CX1B 2YS6A 4FN5A 3VU8A 3H3JA 5IVPA 1T15A 2H2FA 3WNBA 1AZTA 3JD0A 4EO7A 4YVFA 4YP9A 1P5ZB 5J5AA 4RTRA 2P9HA 3MMSA 1OPRA 1FDTA 2DMRA 4KYIB 1YKFA 3D6HA 4LMBA 3JQ7B 1JR4A 4OQZA 1ONBA 3RSQA 2BEVB 1AA9A 5D84A 2Y0EA 4YP0A 4X66B 3WZ2A 1P4JA 1BVYF 1KI6B 2IZOA 3JWEA 3P52A 1KSFX 3VR4D 4BNJA 4CGZA 4Y8VA 3IERA 2XTMA 4KQWA 1KOJA 1O7JA 4Y2UA 1T9GS 1IY1A 1FP6A 3GFGA 3C43A 2GESA 3A1WA 5EE9A 1S96A 1T10A 1IZ7A 4ZOCA 2FPSA 2ZJAA 3DZHA 3DMYA 2DE0X 3VTFA 2HNKA 2ZR9A 3RVDA 4BFVA 2IQ5A 4GKKB 2X4IA 3FNHA 4HXGA 2R87A 1P1BA 4J7AA 2ONZA 4JVOA 1WDTA 4BP9A 3REQB 1TW2A 5B4UA 2R65A 5JAPA 3DM5A 3RFTA 3U19A 2IU0A 3BTOA 2B3TA 5I48A 4RH3A 1SKYE 1Y4SA 4JT2A 3CSSA 2PU7A 5FPSA 3ZE7A 1HDRA 1G6KA 1NYRA 1RI1A 3LVQE 2X6TA 2I2WA 3OTWA 1GPUA 1O95C 4U2CA 1QB7A 1K88A 1SXJE 4FC7A 1Q6ZA 3K0CA 5J9FA 4Q7LA 4BKUA 4UNPA 1U9ZA 2VK8A 3K0FA 1NVGA 2GNAA 4CV2A 4EDHA 3O47A 2B5VA 1P4RA 3U39A 3JQ6A 2VHCA 3H1FA 2ZJ3A 5ILQA 2QRQA 3HPQA 5E0KB 3VHLB 3VI3B 3H5LA 1VE6A 3R44A 1EP3B 5IJ0B 1RWKA 3A6JA 5L6MB 4FBGA 4IO1A 1YO6A 4BNLA 4CW7A 2O4CA 2I3DA 4G8DA 3WXBA 1Z36A 3PTAA 3OX3A 5DASA 4YQFA 4TQ9A 2QAIA 5FLYA 4WN3A 2JJ1D 5ALKA 5A6SB 2IFTA 1WNTA 2HH9A 4AKHA 1X3SA 4XDZA 1I4DD 3LH5A 4QUDA 3EDRA 3NH6A 3CZAA 3GV0A 4TROA 2HLDA 2JKVA 2D4AA 3G0OA 5AFSA 5JZSA 4C89A 3TINA 3X1JA 4HHEA 4WZBA 2BR4A 3BXXA 2V6IA 2XUGA 4MH0R 4LOIA 5BN5B 5CBPB 3SS7X 5CURA 4PHTA 1JUDA 3GDHA 2X22A 4O4IF 4EI9A 3O3CA 3KOMA 4AYTA 4NXMB 1Z8NA 4Z5XA 4B4KA 3M33A 2BMVA 3FYCA 1GM5A 4D92A 2PZBA 4BXOB 2VAWA 2RAPA 1TYBE 5AVKA 4U7TB 1V5IA 2FZCA 4M9XA 2HBRA 3IP7A 2X2FA 4MQ6A 4F98A 4PNEA 4K87A 2YJZA 3CNOA 1I0LA 4Z53A 2DJIA 4IVRA 3JARB 4P4SB 3BWXA 3B1FA 4DMKA 5B4TA 2HSDA 2IODA 3AKEA 4N01A 2YUTA 1UFVA 1DZ3A 3VBEA 4ZGBA 1KAOA 1T5OA 3L7JA 3G8DA 5JCJD 5FTLA 3NRCA 4LHYA 3KQMA 1KYZA 4JN6B 3BRWA 4GE3A 1L5HB 5L3ZA 3ZWMA 3DYIA 3ONDA 3K9NA 1F5SA 5FPKA 4EFKA 1Z8FA 1LLUA 1LVUA 3NGLA 1NSYA 4BFUA 4BLTA 3EY4A 1NI4A 2B2NA 1GAQA 3CEAA 3CLTD 3QELB 4GPZA 3TIVA 5IF3A 5L9AA 2NXJA 2ZJ1A 2LV8A 3P2YA 2ECOA 4QFBA 3VQTA 4P1ZA 4V1CA 1M34E 1OR8A 1XFDA 2WZBA 3EC7A 3IEMA 3KQOA 6NULA 2V7QA 2R6CA 2A78A 1EGHA 1XX6A 1QIIA 2HO4A 4YXFA 4NMMA 3ZKWB 5J4YA 5ELXA 1VGQA 1E2DA 4NPCA 4PLFA 3FKSD 3E4DA 4QUIA 3OZRA 1TKCA 3UGKA 3AVTA 2ZBPA 3OKPA 3ZXXA 4EP1A 3FMGA 2CHGA 2PWAA 1SULA 1GCAA 4MK4A 5ICMA 2DQSA 3PFBA 4V0QA 5AW9A 4INZA 1K1EA 3PGVA 4D8WA 3KALA 5DDIP 4FQ7A 3H2HA 1N5IA 2VA8A 3OE7A 1BSVA 4FMBB 3DTVA 5IZCA 4XDYA 3B3QA 4ZZ0A 1Z0AA 3T9FA 2IYFA 4L02A 1Q83A 3DZCA 3EAGA 2IUFA 2OV3A 3I0MA 3MSCA 4FYYA 4HMQA 4OQDA 3FNGA 5CT4A 3NV9A 3WL6A 4TYYA 3LX6A 2BKVA 1LDGA 2FX5A 3IAHA 2QUIA 6ADHA 1QQ5A 3MK31 3HY6A 1JPVA 4PINA 1W4LA 4DBLC 5EP1A 4E31A 4YRKA 3P45A 4CF3A 3ZNPA 2EKQA 1AXEA 4A2PA 3HYCA 2HQRA 4WIAA 1OFUX 2O8VA 3IX7A 4JX8A 4I7EA 4KE6A 5GOZA 1UEXC 2VHVA 3GEBA 4AJ4A 4HBZA 4J1TC 1IULA 1EIZA 2NZVG 4ZOAA 1J0EA 3W2GA 4CR7A 2WF6A 3CNHA 4PLCA 4RJKA 1UAAA 1QM5A 2VATA 2IA5A 3WE7A 1O0BA 2YNMD 3BX1A 4A1FA 3WRXA 3NAGA 1ORWA 3H18A 4OG2A 2O54A 3K70C 5JCOA 3HWWA 5LNK6 1JMKC 4NNJA 2P11A 5IUNC 5BMVA 3IEUA 2HADA 2FEWB 4YDRA 4L6AA 2BYTA 3PUVA 4PRLA 3VDQA 2B2XA 2J33A 3BXFA 3HC7A 1XK6A 1UZMA 2PYIA 2GLUA 3W78A 4BQSA 2C9DA 3PR2B 4E2FA 2PFKA 2RKWA 2VVTA 3MINA 4MS3A 4PO1A 2XECA 3OE4A 1O9HA 3FUWA 3B36A 3EBPA 1NZFA 2PCLA 4FNGA 4TZKA 2QL9A 1SC4A 3DE5X 2HMYB 2GHRA 2FEPA 4F71A 2FSPA 3I09A 3PFCA 2LP4Y 5LP6F 1GG9A 2WINI 2XE6A 4RGVA 3BBLA 3R8CA 4IIHA 1OAOC 3RW9A 1FMLA 1H6DA 1IB0A 3T7JA 1PS0A 1U1GA 4QFDA 2IH4A 5JUWA 4IUDS 4PICA 4NBNA 3IOYA 2V1UA 4PAMA 3TFOA 5FTWA 4JLSA 1GL6A 1SOWA 4AW9A 4FSDA 5K09A 2X0JA 3W3ZB 2QZ9A 1KO1A 4LY3A 4KQ6A 4MYCA 5KYTA 4HDNB 5F78A 1J00A 4H4DA 2QG4A 3HKBB 2XIQA 1G63A 3TPCA 4RENA 3TTUA 1QO9A 1XVUA 5JNTA 3H2SA 1FXWF 2BKEA 1TDJA 3EUWA 3KG2A 1YR1A 2PLNA 3HCBA 3KKOA 4KTVE 4R01A 5ALOA 1Q0TA 3FPKA 4S24A 2R11A 1YQ9A 1XA0A 1KVQA 3A9SA 3B51X 3NWPA 2COEA 4ARSA 3L06A 1R8XA 1ESDA 2Y05A 2B25A 2PGXA 2C92A 4R4JA 1FP4A 1H0SA 4P7JA 2FQXA 4V0LA 5LUAA 1G8GA 2XLBA 1VKOA 4TLBA 2XGMA 2MTBA 5GOTA 2Q3HA 3E9CA 3ZBUA 1JI0A 3DDWA 3EEYA 4AFNA 4BMCA 3GA5A 1NVVQ 4ZPXA 3OKFA 2FX2A 5D5QA 3BDVA 3CR8A 5U4XA 4RA6A 4CDGA 2IY8A 2QUJA 2O20A 1PJAA 2AOXA 5EZSA 2DTXA 3QE4A 1TJYA 3ZE0B 5I7FA 3N8HA 2OHXA 1JAYA 2DR0A 2GWRA 1V5GA 1QG2A 2R97A 3ANLA 4YRAA 1SG0A 1I3KA 5FUVA 1KQPA 3GLHE 2NP6A 3TRHA 2QYTA 1CY7A 4GP7A 1QH9A 2QVBA 1IRIA 4OIFA 1RFGE 2HLDD 3G68A 4OAQA 1GZSA 4IYJA 1Q1ZA 4YCDA 1M0TA 4KX3A 3GPLA 5LQCA 2ZCUA 4O29A 1G2IA 4CEJB 4XARA 3ZX4A 5EY5B 1MAHA 1Z0FA 2G8LA 3DFUA 3A36A 1GN9A 1TLTA 5J2TA 3OAAA 1NF9A 1O8CA 5DEOA 3FBTA 1C8LA 3ZG6A 3K0FB 4D3DA 2FUCA 3H2KA 4RLFA 3WQBA 2IC5A 1P2SA 2TMDA 5MGNA 1KXJA 2HBYA 3QENA 1MXHA 5EHGA 2W58A 1C0IA 5LXTF 4JU8A 4LHEA 1Q12A 1JGTA 5LLSA 3S2GA 3ZU5A 4OHBA 3B3FA 2N3ZA 1LKZA 2GF9A 2DHEA 2Z5LA 4F3TA 1G7SA 4BE7B 1N33B 1M7HA 3KVOA 2GEDA 3G0HA 4IIUA 1JFVA 1OILA 3KE8A 3PQ5A 1G41A 3WMFA 5COQA 3AB3A 3CE6A 3F6EX 3I76A 2P75A 4YV7A 1LY1A 3HA3A 4WA7A 4AY4A 1XVIA 1N2CA 3BRWD 3DEIA 3HXQA 3Q9UA 3LHFA 4AD8A 3BIFA 2LUOA 2EKPA 2N47A 2IEDA 3HVHA 4WZBB 3W6OA 3U7QA 3A1CA 5FDFA 5GM2A 1UBTS 5F4BA 2WVAA 4OJMX 4RQAA 1SB9A 1KDRA 3ZJYA 1NN1A 3NHAA 4UUMA 5H3LA 4A92A 4BO8A 721PA 1ZFNA 2IPMA 5FOTA 1J07A 2E4WA 5HZHA 4FHDA 3EWSA 1PO7A 4YPOA 4O4JF 1RWPA 2Q1SA 2YXLA 2V7QD 3SX0A 2DJ5A 3B7GA 4LNHA 4OD0A 4RKFA 3I32A 2OXCA 1S8FA 1H1LA 1AKVA 2NAPA 2R3SA 3FJ1A 1WOYA 1P72A 2CC2A 4XVRA 1A82A 1I5RA 1PZNA 2IU6A 3B1WA 3IDSA 5JJLA 3MGKA 2VDLB 1KR5A 3CVYA 4L4UA 1S9HA 1NBME 4RCVA 2QTGA 1OWMA 1XZJA 4WERA 2OQVA 5B2ZA 3QX8A 4Q16A 5HIAA 1JBQA 2FOLA 4R6WA 5L3VA 2JZNA 1IUOA 1TMYA 2W4MA 3I9JA 5DHTA 4DS3A 4JQCA 3WK6A 3DTVD 2IHBA 4TKUA 1M8GA 1T5HX 4DUPA 1WP4A 1PL8A 2CEAA 1WR8A 4BN5A 4UAGA 1JSCA 2ZSKA 3OJ0A 4YP1A 1R18A 5KAPA 3RYIB 3DKKA 4F04A 4B09A 2QG9A 4IILA 1F7UA 1XTSA 3OLZA 3BILA 1L2TA 3BGIA 3RREA 1HEUA 3N2YA 4ZN6A 4UW9A 5LQJA 3AF6A 4CM6A 4E1AA 3BWCA 3LBHA 5LZ5A 1D9ZA 1PRYA 4BX0A 2FMKA 2FLKA 4LY6A 2DBRA 4ALMA 1WPRA 4CNQA 2FR1A 3UBMA 1JZQA 5JY1A 2B21A 3H5RA 2HHJA 4DV3B 3E18A 1PS9A 4DT1B 1FFAA 5LZ9A 2FN3A 2OUIA 1CKEA 3R7LA 5IS2A 4Z3OA 1P0CA 3IXQA 3NT5A 4FS3A 4JELA 2G9VA 1K08A 3R75A 3DTVB 2IP1A 3V42A 3D2AA 2BFCA 3AEKA 4NECA 1GAJA 1X7GA 2IE8A 4DA7A 4ESVA 1JQBA 3QV1A 3UOWA 3L8FA 4RTMA 5TQ0B 1CY0A 3JY6A 5ETJA 3AR8A 4NJOA 3S8YA 4QATA 4H3SA 5KU1A 3N3AC 5IMBA 1I5OA 2A0XA 1V3VA 4K6MA 3FOBA 4ID3A 13PKA 2H51A 2QLBA 4UHBA 3ED5A 4HYEA 3QXXA 1WVMA 2OP1A 3CH6A 4F5EA 1M9NA 3GAAA 5J2UF 1X1RA 1EVQA 1I4WA 4HRYA 1A1SA 1EP1B 2QL5A 3NR2A 1B6SA 2ZW9A 4YECA 4TXNA 2FRXA 1Z08A 3TRDA 2XWJI 3I6ZA 4PYMA 3HACA 3EVDA 4X3CA 5KTPA 1TJPB 3IOCA 2C4TA 4L4ZA 4LECA 1I6WA 4QUAA 4P0PB 4BMPB 2IUYA 1DKPA 4QXOA 1DCMA 1GZ6A 3EVZA 5CA1A 5LOVF 3ENZA 2V74B 5BMVB 1BJRE 4OI0A 3KAJA 2G8NA 3K0CC 3SZRA 3U44A 3EXAA 1ZIPA 2CZGA 1RQGA 4L72A 4OQ4A 3N2LA 3FLMA 5A0FA 5TS2A 2WIFA 4B6EA 2E6UX 3I2IA 5KJFA 3PF9A 3SXUA 1YDHA 1JA9A 1W0JA 3A70A 2J59A 2QRZA 4MLZA 1YJAA 3GLKA 3HRIA 4RTPA 4ZO6A 2WEKA 3MINB 4MS3B 3ENNA 1F4LA 1RZ3A 1VIVA 1GQ2A 1NVUQ 2WBLC 4TS9A 5DM0A 3RODA 4AKSA 3EDYA 5IH3A 4EPVA 1JH8A 1US8B 3LL4A 3U3RA 5JZMA 2I1QA 1F48A 3QLJA 5FEUA 3JATB 1O54A 4NFYA 3DDOA 3NWEA 1PI3A 4NZMA 3JZFA 3FFAA 5AKIA 1AZWA 1HETA 1PBNA 2R4UA 4E4RA 4F8EA 5IN4A 5F1YA 1KJQA 3L7IA 5IAOA 2FDRA 2NVBA 1ANKA 1ND6A 2O8NA 3NFYA 4Q4JA 3MCVA 2R79A 3LHIA 4BQNA 4B3TB 2CUKA 4KDCA 3VNAA 4LGVA 3OMLA 3RHZA 4BNZA 5DT9A 3O7MA 5GGYA 3RT1A 2H1LA 3P2OA 1II9A 3WGQA 3K09A 2LIVA 2B4KA 7MDHA 3EEOA 1E1CA 4U6NA 4XEHA 1RZVA 2VH5R 2R1VB 2VP4A 3IHTA 4HB2A 4C4AA 1YZTA 1Z13A 4FCTA 4CV3A 3QKWA 2PTGA 3K6JA 1P5HA 2JK0A 1VKHA 3LCJA 2HK9A 4A8JA 4DTCA 3OAAD 4CJXA 3SKXA 1M2VA 1YA4A 2JGDA 4BGIA 2XTJA 1ZNQO 1YU9A 2CNBA 3ZHBA 3NIFB 1BQEA 3EIWA 4XM2A 4YRDA 1ACLA 2R62A 1KYYA 3FX2A 4RTLA 4BB6A 2WSBA 1YE5A 1Z82A 1ULHA 4YRFA 4BLQA 4C6TB 4UULA 4X1OA 1ZKMA 1SCKA 1J1ZA 2QAJA 1QIKA 3DP7A 3NT2A 4GBJA 3QEJA 4NENA 4C0XA 2BHNA 4AMBA 4EPRA 5HP4A 3B8EA 1MQAA 5EJGA 2FETA 5TVKA 3MHPA 5BV7A 2DWUA 1AIPA 3OKAA 4IEEA 3BH7A 4NL4H 4YEDA 5LJIA 1KS2A 1E9RA 1MU0A 5EN4A 1OBHA 4BHTA 6LDHA 4BVHA 1DBQA 2H6EA 2RHHA 4Y2TA 3SDBA 4EB3A 2WTUA 1DRJA 1YZYA 1ISPA 3DONA 3WBBA 1IHPA 3CF0A 3ZK7A 3OX2A 1Y6QA 2IXFA 3FFXA 2DFPA 1VYVA 5K6TA 5DN6A 1KS9A 2RIRA 2YWFA 3LQ2A 3HCDA 2BUAA 4GKBA 3CMCO 4WW0A 1E3IA 3EASA 4J90A 3F8TA 4YRQA 2E5WA 2WF5A 3KYIB 3G2PA 4FMDB 4HVAA 5E3HA 5IZCC 4RQUA 2EERA 1Y1KE 4HC4A 4CNBA 5B1EA 3UC5A 2REBA 5KMGA 5CFPA 3VTKA 3PE3A 1FY2A 2FX3A 4JZKA 3I2HA 4QOEA 5JAQA 3FSEA 1Y9DA 1A8HA 2UZ0A 2Q4DA 4OL0A 2OOSA 4HADA 4IMPA 3DOFA 1XZDA 3LGXA 3PA8A 4M9QA 2G67A 3OM8A 4MUMA 4PYIA 3UUWA 5IVIA 3GJ8A 3ZCPA 1XQVA 2DPLA 3RVQA 4NV0A 4YRPA 3T3GA 1NXXA 1ZRMA 1E58A 1VPLA 3TZHA 1T24A 1I24A 3HMQA 5BNIA 3GZJA 4QELA 4EIWA 3JPYA 4PX2A 3RVRA 4MB6A 3SCZA 1N2CB 3RUPA 1MJFA 3RDPA 3AR2A 3ZD8A 5ALRA 4X8MA 2DUWA 2J08A 4MO2A 4UPDA 4DLSA 1TF2A 3WVNA 2M6LA 3U7QB 4UCWA 4YP7A 3WRXC 2GFIA 1DUSA 1O6ZA 1W0CA 3BTUA 4H6XA 2XRMA 3WMEA 4RJIA 3C7CB 1A8UA 4LBYA 1YZNA 4OREX 4RHFA 4PFJA 4F4HA 3VJMA 4IDAA 3IRVA 3NW9A 4GX5A 3WGNA 3NLLA 1W88A 1ZLYA 2PL5A 2R7LA 4NYIR 3ZUGA 3JD3A 5AP9A 1JQAA 3E5MA 3LA6A 4OLHA 2DKOA 4S1PA 1H2BA 4LZLA 4A15A 2OBFA 4EPYA 2ZE5A 3O4GA 1M54A 3ELUA 3C14C 1KARA 4DA6A 2IH2A 1R6XA 3D4PA 2VUIB 4LF5B 2OCAA 1A71A 1U3DA 2ZIZA 2QNBA 2VTDA 4HGZA 4LOJA 4L4XA 3WGGA 1S2OA 2RGBA 3NUGA 2R60A 4FFPA 3AQ4A 1GR0A 1VRVA 4TKUB 1XJ5A 4MGZR 2YX1A 4WE3A 1IOWA 4QAQA 2ASEA 1ULBA 2Z95A 4XGNA 5KC8A 2WAXA 1N6LA 3RKUA 3BSYA 2HRZA 1EWVA 1Y8QA 4EAQA 2EFDB 4EHAA 1T9HA 3NOVA 4RD1A 2PA3A 3PVZA 5BRAA 2D59A 1LF0A 1RLMA 1Q7RA 5GZ1A 2W93A 4FYVA 2YC4C 2HSEA 2UYYA 1I7PA 4XWKA 2H5JA 3NQ41 4R2LA 4MDEA 3LBIA 1QDEA 4UREA 1PJRA 3H3FA 3QNMA 1TM3E 4GOND 4QLOA 5E4JA 5AVXA 2VT2A 3MS4A 5JJIA 3GB9A 3L6BA 1QVWA 3PKZA 5A5EA 1QKKA 1IATA 5C53B 3N58A 3L0PA 3I04M 3IEKA 4EECA 3A0RB 5JU6A 4D5EA 3RUCA 3QU4A 4ZZ1A 3GLIE 4FW9A 4TSRA 1TK2A 1G9XA 1MOSA 3E9YA 2JGRA 4LNAA 2RGGA 4C0JA 3UH0A 2ZIEA 1G7TA 2QM3A 4UNSA 3AEKB 3UK6A 4ZWNA 2O8EA 1DAKA 4M22A 1K97A 1AY0A 1W0JD 3PQ3A 2HZBA 1XTJA 4WGFA 3VXKA 4D9EA 1SMKA 5DTJA 4KPFC 1UAYA 2Y68A 2G5CA 4LK3A 4X62B 1E3SA 3HJUA 3H4VA 3HM2A 1OE0A 3OTQA 3NP7A 4CKCA 4V0NA 1L5VA 3TRFA 2VA9A 1TTTA 3MGAA 1FNNA 3L1HA 1THZA 5T4EA 4C9BA 3PKJA 3DMGA 3L6RA 3DGFC 4OBEA 2C07A 2I6QA 3TIXB 1P1CA 4ENWA 5IJAA 4OM8A 2I7DA 4F2GA 2NGRA 5L45A 3DHEA 5TVGA 2OGSA 4C03A 1MC4A 4MVJI 1AURA 3LDGA 3TUIC 1AC5A 3WA6A 4C1NA 4F9TA 2C3UA 4NCHA 3P0EA 1XRMA 3MD0A 1T9DA 3V1UA 3BKWA 4RSRA 2FW6A 2QROA 3C6KA 4FXPA 4QWMA 3AMVA 1MNQA 1JQDA 2SCUA 3DB2A 3MG9A 4LWZA 4RK7A 1OUMA 1CUVA 1OC4A 3FJYA 2HJRA 4UDYX 4BLOA 4RE6A 4BNMA 3HUNA 3IPLA 3U44B 4BUZA 5EUBA 3A6KA 3OP4A 3SXUB 4S1TA 2HDNB 3NRJA 2AZ4A 1CXZA 4PAWA 1KEWA 3LP6A 1JA0A 3MT9A 1P7VA 4DV2B 4NCXA 5K3AA 1KH3A 5KYVA 1DAMA 3G7UA 2LNDA 2MYPA 2Y9PB 1WUHS 2C97A 2WOJA 3DMPA 4TQUS 1ZSNA 2OR3A 3DEFA 3IV6A 4BX9A 1NUUA 1B14A 4MCAA 3T9BA 1R10A 3IBYA 3ORHA 4ZV7A 2O3RA 3FPGA 4FIZA 1UKZA 2X6RA 3P9RA 1PUIA 4KGZA 3BQNB 3ZHRA 3EGXB 2XB4A 4QPJC 2BWJA 1ZGBA 4TMXA 3EAFA 3I2FA 5IEBA 1YMQA 2CJFA 4MP6A 2BDEA 4IQ8A 1UOPA 3N3BC 3I6YA 2NPFA 5A2QA 4X41A 1OAAA 4Y6QA 2CNWA 3CWCA 4Q4JB 5I9NA 1A5AB 2DGDA 1LVHA 3FF4A 3PUJA 2X58A 4HAOA 4PLPA 3SHWA 3U56A 3P9SA 1II0A 1HM5A 1ZVQA 2QTHA 3O5AA 3H13A 2UXDB 3NX4A 5GZ3A 2XTNA 3MJFA 1Z45A 2JA2A 4MR9A 1E1CB 1PR0A 4XFDA 3Q5EA 2G9UA 2HXYA 1ULAA 2QE7A 4AJ1A 1PX0A 2QTVA 5L7WA 2OD2A 4HY3A 1J7KA 2PVPA 5KC9A 4EUNA 3VU1A 1XJ0A 5CYGA 1ZOOA 2ESRA 4FYIA 5C8YA 1MKYA 3LCRA 1UDBA 1M2VB 1PQYA 3CH5A 3I8OA 2E0IA 3HB4X 3VH2A 1W9HA 4DDMA 2YDXA 3BKXA 2PGAA 2ZUEA 1GCOA 3EMDA 4N0QA 4X95A 1L1FA 4J2OA 4NYMR 4KU4A 2PO7A 3ANXA 3M1YA 3RAJA 1TM2A 4U7FA 2WIGA 5CH3A 4UOEA 1UOEA 2PSSA 1JQEA 3SD7A 2XCSB 1QAOA 3G5AA 1WZNA 1R37A 2DPMA 3D43A 3TLKA 1XLVA 2C9ZA 3VR3D 1BEZA 4CKYA 5IUJC 2XRZA 4ZTZB 3ZGXA 4HLUA 4NENB 1PZEA 3CA8A 1USVA 3HCPA 1DB3A 4FKZA 4KXUA 3VDNB 1KIMA 1MGOA 1USIA 5ECYA 1JWLA 2ZZMA 5KNDD 3PE4A 3KKEA 3MUEA 1NR7A 4C0LA 4DQKA 2EX1A 5AJHA 3H87A 3HXOA 5HK8A 1RBYA 1SD1A 1VXRA 2GK6A 2Y66A 1K75A 4HB0A 1A8PA 4IXWA 4NOKA 3WLNA 4CKWB 4U8GA 2HY7A 2GAAA 3ENQA 1OBVA 1CX9B 1P1HA 4F1JA 1WMBA 2QE6A 3HCFA 5K5EA 4G1FA 4BU0A 2HMTA 5DHQA 3JQCA 4Z2YA 1QANA 1WKBA 3K05A 2VHJA 4RF5A 1FIUA 5DP1A 4WWHA 4GYKA 4CZ2A 3MCAA 1MAWA 3MWEA 3LIIA 3TTWA 4KWHA 4WECA 3MFQA 1Y3IA 3FD8A 2ZTHA 3Q88A 3ZX5A 3JQGA 2QUAA 2O0MA 4KL8S 5KMGB 5F33A 4KH1A 1NNLA 2XKAA 2GRAA 3G02A 3QKTA 1WS6A 1S2DA 4RHXA 2DQ4A 4HEA1 5A3SA 3MXOA 4NMHA 2YHIA 5TGZA 3ROQA 4MQLA 2GFQA 3K0HA 4NJEA 3JQEA 4B71A 3IP9A 5I9SA 2XCTB 5GONF 1FOEB 2H5EA 3LA8A 3T5BA 4MVYA 3WI7A 5I51A 5DH9A 4RD3A 3ZGOA 4WK2B 3W9YA 1CEYA 1AKMA 1YVDA 1ZU4A 2GVNA 3AERA 3L8HA 4OX9Y 5EWJA 2IF2A 2QXYA 2VUTA 4RK5A 5T5QA 1IQ0A 3IAUA 5FBQB 5HFAA 4Q9HA 3T9CA 5IT5A 1RRCA 2X5NA 1ADGA 2A1IA 4YUAA 1CY4A 2Z83A 3D4OA 1ZYUA 1ZPDA 4P2BA 5HBRA 1Y8CA 3ZOZA 4HDOB 5SYAA 4O1MA 4PE5B 4P4TA 1OFHA 5BSUA 1N1DA 1RXYA 2YVAA 1R4AA 3PHBE 3WWPA 3FDZB 1EDBA 2WMNB 3PX2A 5CP8A 1M6NA 2A5JA 5B2FA 4D8XA 4GGMX 4IWXA 1UXKA 1ECGA 5J4LA 1W88B 4O3MA 2MCFA 5K0LA 2OLJA 2V8OA 2R8XA 3DE4X 1IWOA 2PLAA 1QG0A 4FCCA 4OHZA 5CDGA 1VPTA 3EA0A 3GEIA 1YC5A 3FUXA 4EVSA 2BGLA 1DTWA 1MC8A 4GYWA 3TZLA 3Q6IA 2PUDA 1MT3A 2WU0A 3KX2A 1V7QA 1U0FA 1E96A 2WILA 1LBQA 2CHUA 4MQBA 5ADUS 1LJ8A 1TC2A 3LCMA 1KTVA 2IZ7A 4HDSB 3RWOA 2DY0A 4Y6SA 2W4QA 5GTDA 4WA8A 2DSNA 1T3HA 3RC3A 3STTA 9GPBA 5I8ZA 1Y8QB 2AN9A 3VYWA 1KI8A 1X80B 1DKQA 1AF4A 1HYHA 3OT1A 3PD0A 4IIDA 1MHTA 2PMWB 2GZAA 3AXSA 1A9OA 1JR3A 2VSNA 1QP8A 2YV4A 3URKA 1PZMA 4BLPA 4EHJA 4QVIA 1K06A 4MEBA 2JGIA 2O1SA 2VWQA 3FW1A 4FE7A 1KSGA 3UMGA 2P0AA 4BQPA 2X5JO 1H4TA 1NSFA 1YR7A 2IHZA 3MTIA 3O8DA 2P27A 5AXDA 5H9VA 2Q4EA 1GN8A 2H4WA 1K7CA 2QMZA 3AR5A 2C5GA 3I01A 1L7RA 1K3FA 1KO7A 2YYZA 3K09C 2DUJA 3C87A 2AZDA 3OHPA 1DC4A 2HA6A 5EVJA 1Q7GA 1ULTA 4DJ5X 1DRWA 4B35A 1YDFA 4O1IA 1E9BA 3A4IA 3O3MB 4HRAA 3SQMA 4BX2A 1IPFA 4FOSA 4IQFA 4ZI3A 5K0TA 3VVBA 4A8JC 2J3EA 4FK8A 2X1VA 3D3WA 2RK3A 4QJBA 4R2HA 4UXJA 2QMOA 3K4QA 3IB6A 4S0ZA 3PR1A 1QTNA 5E9JA 1RJGA 2O8EB 1PNRA 3MWYW 4OFWA 1EHCA 1J8QA 2BZ0A 1SCJA 1GDHA 1VJ0A 4NESA 1NMEA 2YWCA 1IUNA 1EK1A 2HRQA 1ZWKA 2G76A 4CKCB 1ILEA 3V4RA 1MW9X 3KOXA 2ZB7A 3TRKA 1RMYA 3VH1A 1E2LA 5CLIA 4DANA 1KDOA 2YYAA 3M6FA 3K31A 1UDWA 3O74A 5H82A 3WLAA 1CQIA 4P3PA 2QXUA 2F9FA 1DC8A 4M1SA 1DINA 2VT6A 3ROMA 1QGED 1R6DA 2FQ1A 3L4BC 3ZCQA 1QH0A 4D4HA 4DNPA 2VRCA 5AVOA 4LJ5A 3CZPA 4ZEXA 3B7PA 1WPXA 5SYMA 3O8QA 2GO1A 2FK8A 3KVRA 3K9BA 1SVWA 2CNWD 2SCUB 1L8QA 2Z9CA 2Z9DA 3H75A 4IXMA 4J29A 4RKWA 3UO8B 4E5UA 4EHHA 2V0GA 1HT0A 4ZICA 2OCKA 4I50A 3II6X 1KMHA 3KKKA 1NF2A 3JR7A 4Y2RA 2QM7A 5I9BA 3TEMA 1TK3A 5ALDA 5L3QA 4CR8A