1INLA

Crystal structure of spermidine synthase from thermotoga maritima
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
295
structure length
285
Chain Sequence
b'RTLKELERELQPRQHLWYFEYYTGNNVGLFMKMNRVIYSGQSDIQRIDIFENPDLGVVFALDGITMTTEKDEFMYHEMLAHVPMFLHPNPKKVLIIGGGDGGTLREVLKHDSVEKAILCEVDGLVIEAARKYLKQTSCGFDDPRAEIVIANGAEYVRKFKNEFDVIIIDSLFTEEFYQACYDALKEDGVFSAETEDPFYDIGWFKLAYRRISKVFPITRVYLGFMTTYPSGMWSYTFASKGIDPIKDFDPEKVRKFNKELKYYNEEVHVASFALPNFVKKELGLM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase
molecule tags Transferase
source organism Thermotoga maritima
publication title The crystal structure of spermidine synthase with a multisubstrate adduct inhibitor.
pubmed doi rcsb
total genus 91
structure length 285
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 1inlA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1inlA01
2Y1WA 3GJYA 5GIPE 2ZVJA 3HCFA 4RVGA 2G72A 1UIRA 1XDSA 4HGYA 2C7QA 2ZFUA 3CC8A 3QOXA 4AUKA 2NXJA 2ZTHA 2EJUA 3C3YA 5HZMA 3WSTA 4EVIA 1O9HA 4RTOA 2B3TA 1XDZA 4MHTA 4QDKA 2G1PA 3LCVB 1QAOA 2OXTA 3MTIA 3TPZA 1VL5A 3PX2A 4DZRA 4NECA 4V0RA 3GDHA 3ELWA 3G8BA 5EHIA 1DUSA 1R8XA 1X1BA 4BP1A 3CJQA 2OPBA 2P3QA 3FRIA 4C06A 2VZ9A 4E33A 2B2CA 3KQSA 3P2KA 5JR3A 2NXNA 3DH0A 3THRA 4EQZA 4KVZA 1XTPA 3KQVA 1NV8A 5DX8A 1QZZA 3TKAA 3EEOA 2VDUE 1R8YA 3HA5A 4RTKA 4LECA 2P3OA 3EGEA 4P7KA 1NW6A 1DL5A 1YZHA 3SSOA 3SVZA 2H1RA 3T7SA 2AOTA 5KQRA 5EVJA 2PXAA 2P41A 3K0BA 2GB4A 5GM1A 3FZGA 3KQYA 4ER3A 2ZZMA 1EG2A 4ISCA 3LGAA 1L3IA 5HIJA 5B1SA 3A7DA 3CBGA 3DMGA 3KR1A 2P7IA 1XVAA 4PYOA 2C7OA 3HCCA 4B17A 1SQGA 3SGLA 2UYHA 2P1DA 2ESRA 2R6ZA 3G5TA 2QYOA 3NDIA 3KHKA 1SG9A 5EMKA 4RTNA 3GRYA 4MQ4A 2UZ4A 3LX6A 4CXMA 3BKXA 3K6RA 3TMAA 2ZWVA 3JWGA 5EGSA 1KYZA 4V0QA 4XCXA 4X1OA 2GAFA 5K0FA 2FHPA 5EMMA 5E8JA 3VSEA 1Q0TA 2DPMA 3BGIA 3GGDA 4PIMA 5FWAA 4QTUB 1SUIA 3AY0A 3UJAA 3M6WA 3V97A 3ER8A 4YUZA 4PCAA 5K09A 1D2HA 3HNRA 2B25A 4MWZA 3OPNA 1RJDA 3R24A 4ER0A 5JUWA 3OFKA 3DXXA 3JWIA 4PONA 3IYLW 2G8NA 3Q7EA 5G02A 5GP1A 4DQ0A 4GOND 1ZGJA 5E1OA 2HV9A 1RI4A 2QM3A 3D2LA 1VP3A 4C03A 3M6UA 3E7PA 5CVUA 1ORHA 4OQEA 3EMDA 2F8LA 4GOOD 3O7WA 4WVLA 1QAMA 3GXOA 2B78A 4YUYA 5EQJB 3T0IA 2OBFA 2YXLA 1AQJA 3DXZA 2EJTA 4BY9E 1IM8A 3B3FA 3B89A 4QDJA 2G70A 4FT2A 3Q87B 4YV2A 2JG3A 2AOUA 4AX8A 1V39A 2EX4A 1H1DA 4JXJA 3MCTA 4F86A 3KKZA 3VC1A 3KQQA 5E1MA 5HILA 5BXYA 2CKDA 5EMJA 2ZBQA 3OU7A 2GH1A 3OU2A 1BHJA 1P1CA 4YV0A 3KPUA 2Q41A 4PYNA 3PFHA 4PYQA 3LPMA 3FUUA 3SM3A 2NP6A 3HVJA 4RTLA 1Y8CA 3FUXA 2IP2A 3OE5A 2GA9A 3UJBA 4ATNA 3A4TA 2PLWA 4OA8A 2VS1A 1KP9A 5LQJA 5DRTA 3DOUA 3M6XA 2O07A 4EMSA 2JHCA 1O9GA 1T43A 2PV0A 4OBXA 3ERCA 3OZRA 1D2GA 3IHTA 3MAGA 3HCDA 4PWYA 1I1NA 3ELYA 3LKZA 3BWBA 3RODA 2OB1A 3FYCA 1D2CA 3G2QA 1X19A 3HCEA 4R8RA 5EZQA 5K8VA 5KYGA 5GINE 4ER5A 1WXXA 5LQNA 2AOXA 3PT9A 3FUWA 4GUAA 4DMGA 2ZBPA 2GS9A 4YUXA 3KQWA 3ELUA 4P7JA 3G88A 5DTRA 1JQDA 1G38A 3KPYA 2Z6UA 5DSXA 1KIAA 1EJ6A 3KPVA 3R6TA 1ZHFA 3A25A 3QOWA 2B9EA 4RVDA 2VP3A 4RWZA 3V8VA 1BOOA 2FCAA 1NW7A 2WA1A 3NJRA 5DX0A 5E9WA 5P8WA 1JR4A 4CKCA 3P71T 4M7RA 4RX1A 4E30A 3OZTA 1RI2A 1XCLA 4YUWA 3SSMA 3M70A 5C9ZA 4DA4A 3SXJA 5K0BA 4HTFA 5K0NA 5KS2A 2ZWAA 4FSDA 1XCJA 1G55A 1I9GA 1QANA 3DMFA 4KWCA 1NKVA 2P7HA 4E70A 2PBFA 1X1AA 4OX9Y 2ZIGA 4R8SA 1AV6A 1SVUA 4CKBA 5IKMA 4DCGA 4HH4A 5E9JA 4PYMA 5FULA 1NE2A 3KQMA 1G6Q1 4CTJA 1L3BA 3R3HA 1JG3A 4K6MA 1XJ5A 4LG1A 2AR0A 3UJDA 2WA2A 3EVBA 1G8SA 1VP9A 5EC8A 4UOEA 3OFJA 4KW7A 3PTAA 2YR0A 3FTEA 2NP7A 2IH5A 3EVAA 5DXAA 4BLWA 4CTKA 4U7TB 2ZCJA 3LSTA 3LL7A 3GIWA 3OZSA 5EOVA 2Z6QA 1JG2A 3DTNA 2AS0A 3LKDA 3G7UA 4FT4A 4PYJA 3G5LA 8MHTA 1ZGAA 2AOWA 3JWJA 5DPMA 5T6BA 2ZLBA 2JJQA 2PKWA 3EGIA 1R18A 3PFGA 3P9CA 5ICCA 1VLMA 3UJ8A 3I64A 2ERCA 1IXKA 3LCCA 3NDJA 5DM4A 5LQAA 4PIPA 4A6EA 2R3SA 1L3CA 2P35A 4RTJA 4DF3A 5K0CA 2BR5A 4OBWA 2PVCA 2AVDA 3G2MA 3OE4A 5FCDA 4IV8A 3DP7A 2ADMA 2NXCA 3BUSA 3HM2A 3PVCA 2AVNA 2HWKA 3PS9A 1PJZA 1XDUA 2XBMA 3BWMA 4ER6A 3ORHA 4C08A 2DULA 5FADA 5FHRA 3FPFA 3NVKI 3NWEA 2HTEA 4QVKA 3G89A 3UZUA 5MHTA 3CGGA 4RSRA 4E2XA 1NBIA 2I62A 4LWPA 5DT2A 1JG4A 5E2AA 5K0JA 2EG5A 5EKXA 2HNKA 2NXEA 4AZTA 3AJDA 3GRUA 1BKYA 3I53A 5D1NA 3TM4A 3EVFA 1VE3A 1RI3A 3HVKA 3HEMA 1JG1A 2PGXA 4OA5A 2XVMA 3EVEA 5F2KA 1TPYA 3HCAA 5FHQA 5EPEA 3G2OA 3UWPA 2PT9A 2YXEA 2AN4A 2YUIA 5HFJA 9MHTA 3KR0A 2IDJA 5DM1A 4ER7A 3GRVA 2IPXA 4C4AA 2ONYA 3MQ2A 4YMGA 5C1IA 3MERA 1TW3A 4AZVA 1QAQA 5HOQA 2N47A 4A6DA 4GBED 5CCXA 4FR0A 2HMYB 3CKKA 2Z6AA 2P8JA 3F4KA 3GCZA 4RYLA 1F38A 4AZWA 3O4FA 5CVDA 3TLJA 5K05A 2PY6A 3I9FA 5FTWA 5E8RA 3TKYA 1KYWA 3I5UA 4XUEA 5EMLA 1YF3A 3TRKA 2A14A 3R9XB 3OU6A 2PXCA 4QTTB 4X60A 5LSAA 1FPQA 4POOA 5DX1A 5FA8A 3EVGA 4DKJA 1NW3A 4HG2A 2EFJA 5BP7A 3LBYA 4P58A 4RTQA 3C3PA 4HTFB 3AWIA 3DXYA 3EVZA 2E5WA 3I58A 3FPJA 4O29A 4MIKA 5M5BA 3A26A 1NV9A 3R0QA 4H0NA 2G71A 4X61A 2C7RA 2PWPA 2YVLA 2I7CA 2VDWA 4BLUA 3EVCA 1ZQ9A 5EKUA 3KQPA 4PGHA 3GWZA 5DRYA 5K0LA 2GLUA 3CVOA 3KPWA 3ME5A 4HC4A 1JSXA 4G56A 2ZZKA 2I6GA 1ORIA 2LD4A 3LDUA 2XVAA 5HEKA 1N7JA 3E05A 3KQTA 2JH8A 2PX2A 4MTLA 4PINA 3DULA 4XUCA 10MHA 2UYOA 2CMGA 2HR1A 3SR4A 1FJXA 3FRHA 4RTPA 3M6VA 5GWXA 4GEKA 3JWHA 2QE6A 2OO3A 2PWYA 3LHDA 1L9KA 1M6EX 4QQKA 3TR6A 2FYTA 1OR8A 3A7EA 5FQNA 1VQ1A 4RTSA 3FTFA 1SUSA 1KHHA 3KQOA 4Y30A 5DTMA 4EKGA 2NYUA 4ZTBA 3FPHA 3MTEA 1BC5A 3T7TA 4KRGA 3HP7A 3KU1A 4GF5A 1KPIA 4BLVA 5BW4A 1AQIA 2JHAA 2P40A 3PB3A 2IH4A 2K4MA 3MGGA 4KDRA 3BKWA 4M37A 3G8AA 3E23A 4GOMD 3SX0A 3UBTA 2ZW9A 4YV1A 4Z2YA 4PGGA 1HMYA 2ZIFA 1JQ3A 3B7PA 2FK7A 5K0GA 4KIFA 1EAMA 2CWWA 3ELDA 2ZIEA 2FRXA 3P8ZA 2QRVB 3EMBA 4QQNA 5IH3A 4RVFA 4E31A 4KDCA 4IV0A 4E2WA 5KVAA 5EIFA 4FZVA 4RV9A 3FUTA 4E2ZA 3CCFA 3DUWA 4X63A 1B42A 5E9QA 4M38A 3UA4A 3P97A 3A27A 5HIIA 2BM8A 3UA3A 4U7PB 4GC5A 3BXOA 3KPJA 1YUBA 5ICGA 2OYRA 4OQDA 1WG8A 4Y2HA 1KPHA 3DMHA 3LDFA 3CJRA 3GNLA 2JH9A 1IY9A 1ZG3A 5H02A 3B5IA 3UFBA 5KQSA 1RJEA 4DCMA 5CIYA 3B3JA 2OZVA 3FTCA 1M6YA 3P2EA 1P91A 5EG5A 5K03A 1P39A 3MB5A 5CD1A 1PRYA 1HNNA 4FSXA 5EEGA 3E8SA 3C6MA 3GRRA 3EPPA 3NWBA 2BM9A 4QPPA 3OCJA 1G8AA 2JHPA 5DWQA 3TQSA 4PNEA 3MHTA 3UJCA 5LQRA 3NMUF 1KR5A 4C07A 1R6AA 1WY7A 5CM2Z 1N2XA 1SQFA 3BGVA 2YX1A 4F85A 2XYRA 3NTVA 1TW2A 2XYVA 2AN3A 3C0KA 4X41A 5DLYA 1YFJA 1P1BA 1G60A 5T67A 2CMHA 1RJFA 5U4XA 2ORED 3GO4A 3PX3A 3NW9A 1U2ZA 4PYIA 1R00A 3EEYA 2AOTB 1N7IA 1YZ3A 2PJDA 3DLIA 4BP3A 3DR5A 2ZULA 3FPGA 1YB2A 5DM2A 5FA5A 2OB2A 1Z3CA 2WK1A 2ZBRA 4P7GA 5CVJA 1UFKA 5T64A 1L1EA 3TM5A 1INLA 1F3LA 2UYQA 3P9KA 3UJ6A 4C04A 1R74A 2IBTA 5DXJA 1JTFA 3P2IA 3EGVA 2AOVA 2PX8A 3IEIA 5E1BA 1VBFA 1X1DA 1MJFA 2AZTA 4P7FA 1FP1D 5GM2A 4FGZA 1VPTA 4R6XA 2AOUB 5FQOA 2I9KA 5EHGA 5LQUA 3FYDA 2ZZNA 5EIWA 3ER9A 4QPNA 2O0LA 2BZGA 1XXLA 1RI1A 3VYWA 4WXHA 5K01A 3PLAE 5ICFA 2H00A 5GOZA 3HA7A 7MHTA 1SKMA 3SSNA 3NVMB 3VC2A 4L7VA 1RJGA 3CJTA 2KW5A 3HCBA 3O31A 3X0DA 4CKEA 3S68A 1EIZA 4HSGA 4QVGA 3GRZA 3UJ9A 1NT2A 3LECA 3FTDA 3FUVA 3RIEA 2BR4A 1O54A 4IWNA 5D1HA 4HGZA 4R05A 5HIMA 5CVVA 3BT7A 3DLCA 5ERGB 3H2BA 2IGTA 2H11A 3BWYA 2IBSA 3RW9A 3REOA 3GU3A 2YXDA 2PX4A 1X1CA 2IFTA 1RI5A 2CL5A 4KIGA 3MCZA 3ANXA 1JQEA 2Y1XA 4DM3A 2PXXA 3C6KA 5K0EA 2BH2A 1NW8A 1FP2A 3G2PA 3KR2A 1FBNA 2BR3A 4GOLD 1MHTA 1AF7A 1EQAA 4R6WA 5BW5A 3FPEA 4E2YA 1YFLA 2XYQA 2PX5A 2V74B 3QV2A 4PYLA 2O06A 3TOSA 5F2NA 5ICEA 3HTXA 2AN5A 3P9IA 4PCLA 3UJ7A 4LWOA 3ID6C 3HA3A 3M33A 1NW5A 4IKPA 5CVEA 4GC9A 5DTQA 4AZSA 4YMHA 4HRAA 3U81A 4RVHA 4F84A 3L8DA 3LCUA 1ZKDA 4GQBA 4RTRA 4RTMA 2GPYA 4C05A 5FWDA 1DCTA 3THSA 1UWVA 1NBHA 1WXWA 4YUVA 2OY0A 5E1DA 2QRVA 1I4WA 2ZSUA 3BWCA 4M36A 5CUQA 2FPOA 3P9NA 4FP9A 2IH2A 2P3LA 3LBFA 5EEHA 1JTEA 1WS6A 3AXSA 5DM0A 3T7RA 4EKIA 5EZSA 2NNWB 1EJ0A 2V7EA 2O05A 3KR9A 1KPGA 2UYCA 2PSSA 4E32A 3TFWA 3B3GA 3BZBA 2IDKA 5F2OA 2QY6A 3SMQA 3IV6A 2O57A 3HVHA 1QYRA 4CWAA 1Q0SA 4FS8A 2YQZA 5FUBA 1M0EA 5C0OE 5LQCA 5E2BA 1KXZA 5LQKA 3AXTA 1JSZA 3M4XA 5CCBA 3BGDA 3EVDA 4XUDA 2IIPA 2OKCA 2PT6A 2C7PA 2ONZA 2FK8A 2YTZA 3LDGA 4PYKA 4EK9A 5HIKA 1WZNA 5LR6A 2VDVE 1VIDA 5GIOE 5DSTA 3HVIA
chains in the Genus database with same CATH superfamily
4CKBB 4KXLA 3GEBA 3F5DA 3O4IA 3P9RA 3JZMA 2EWMA 3HCFA 5CVTA 1J0AA 2AMLA 1VCMA 2WDZA 4EO4A 2OZEA 1BAPA 4LWQA 5ICSA 5K5EA 1EWTA 2ZJBA 1MTZA 3UUGA 4ZOCA 3S7TA 4IIXA 4AUKA 2GK6A 1OY1A 4A8PA 1RQ7A 3ND9A 4RTOA 2PJUA 2B8WA 3LM8A 4HHEA 3RYFB 1NYTA 2HRCA 3I34X 3TI7A 4WOPA 4PLCA 3SZ3A 3AWDA 3W1WA 3HDJA 3HXOA 3F9RA 4WGGA 1QRUA 1FUYB 1N78A 3PG5A 1YDWA 2PL1A 3B6EA 1Q1EA 3EFHA 1K66A 1WMDA 2W22A 2JDID 4FR2A 1YQEA 2Y05A 2C5EA 2FRDA 2JK0A 2WM8A 4DV2B 4ZANA 3VPHA 1HH4A 4QOJA 3ZY2A 4D7AA 4TKVB 4B3RB 4YMWA 3UOWA 2BDUA 2WJ6A 3CY6A 4M8KA 3OO1A 3UJPA 2HA3A 3O4HA 5FUXA 3ABOB 4CG1A 4CMIA 3OJ0A 3T38A 2H5LA 1U65A 1V95A 2HK9A 2JVIA 3AIIA 4ZRNA 4EF6A 4BN4A 1WHTB 1LBHA 3H19A 1C3OA 1MJ5A 3SSOA 2C61A 1IY1A 4BNUA 4MWTA 4DIFA 4KK4A 1D1QA 4MVCA 5CNIA 3K0BA 3SY8A 5FR1A 1V5FA 3L0YA 4UUAA 4ER3A 5IBCA 5KYYB 2I3AA 2OG1A 3AVPA 4HWKA 4I4NA 4C3VA 3T5PA 2O8NA 2XQJA 3O8OB 4FFDA 3KR1A 2ZI7A 5TX7A 4K5QA 2BI7A 4MDFA 2FPIB 5HS4A 1VYHA 1PZFA 3IJ5A 4YT8A 3W5DA 1ULTA 3LVBA 4L2IB 2PEZA 4RKWA 3TMAA 1QF9A 1M7GA 2F4NA 3MT9A 4LQDA 3Q85A 3VGJA 5T3YA 1FDTA 4OMCA 4X1IB 4F4UA 1EDZA 4Z6KA 4JMLA 2QTHA 4YRBA 1QHHA 3U4HA 1ZOPA 3TW8A 4B4WA 3V32A 3NYWA 2GEUA 1JQ5A 1XCOA 4UHCA 4QREA 1QV7A 1N1EA 2ZTUA 1U5BA 3V1LA 2ZBDA 1KOGA 3BWEA 3FOZA 2XQFA 3KWFA 4L28A 3ROXA 3UJ3X 5K9ZA 2PWAA 4PZDA 1DUIA 3UGJA 4ZKDA 2A9QA 3VSCA 1NNEA 2P30A 3NBZC 5E1OA 5LZ8A 1DKOA 3ZHRA 1VP3A 5FL7D 1ZS9A 3RKSA 3QEJA 3KE9A 4EW6A 2ZDHA 1CUAA 1GN9A 1M0TA 1GQFA 3QEMA 4B5LA 1REQB 1VBKA 2E4XA 3FN4A 2VZ8A 3UAZA 4S24A 2J9XB 4XX1A 3INRA 4QDJA 1GKYA 4WN9B 5FBKA 2WYWA 3S5JA 1PZXA 2G7ZA 3RGWS 3T1OA 4FT2A 1I3NA 3CIFA 4PBTA 4Z51A 1YKGA 2QMEA 1NQ5A 2VHZA 4MQMA 4DHEA 3GRAA 5KTSA 2XDQA 4D57A 1ORRA 2P9TA 1ACMA 3UTCA 2FA9A 5AFSA 4R9VA 4MV4A 2O2IA 3UH0A 5EGNA 4YQYA 3OJXA 5ALTA 4PYQA 3E3OA 3PFHA 1ODFA 3PC7A 3ZHSA 3PJDA 3IOBA 3LTNC 1JWAB 1EFVB 4MRSA 4RTLA 1QFYA 4DC0A 5AK6A 5D3MB 2WUVA 1HE2A 4RGBA 5DHPA 3SFTA 2XW6A 4FGJA 4QDXA 4LC1A 3HADA 2QAIA 2ACVA 3ECCA 4CMKA 3EPKA 1DEXA 3H6KA 4AP5A 3QM1A 1ZW6A 5DHRA 3TTXA 2WMYA 3LHFA 1SCNE 1OXSC 4GPTA 2H4WA 3BWBA 3BC1A 4DUGA 1Y5IA 4FN4A 2NQTA 3RODA 3VYTB 1O0SA 1EX1A 5K8VA 1IN4A 1WMBA 4LYGA 5EQTA 1W75A 4JA0A 4GDFA 1WXXA 3FDZA 1V1RB 1WDWB 1DOZA 1VHWA 4ONEA 2AK2A 4ND8A 3GLIB 1UUFA 5GONA 3VYSB 3F0TA 2XIJA 4IV5A 1YQUA 4U6QA 2F4VB 1CZKA 2ZJ0A 5DSZA 1LV8A 3QOWA 1ZU5A 2DR2A 2ERYA 3FH0A 4ARUA 1F8XA 2RGXA 3WS7A 3A1TA 1BOOA 1ZVJA 3GLHB 2J3DA 4RPCA 3NCTA 4CPDA 4UHDA 3FOCA 1X92A 3CB2A 3FCYA 4EJ6A 3GV0A 4RX1A 3I6YA 1S7GA 4YUWA 4MWDA 3ZKAA 1DJQA 1P33A 4D9CA 4YJ2A 4E5YA 1XMPA 2HF7A 1VPEA 1KMHB 1YK0A 4X6UA 3VDMA 3RB8A 2J9YB 4IIBA 4MMXB 1ZI6A 1CF4A 3SQDA 4FJ0A 3KE8A 1ODIA 4HNGA 2GJSA 4D5GA 4EKEA 1ZK2A 2A7XA 4P83A 1QDLB 3T7CA 4LG1A 4BWYA 2A1TR 4OLFA 3EDRA 4F3CA 1AKRA 3GBVA 3MF4A 3C2QA 1VP9A 4TVSA 1LZKA 4WLUA 4Q02A 1Q5PA 3KWMA 4UMDA 1ZH2A 3ZLVA 5K2OA 1PKEA 5CFLA 1HT1E 1P4GA 3HSYA 2WT8A 4LYYA 4YAWA 3LSTA 2W2PA 3KUXA 3VNRA 1YRQA 2Y9PB 4IHJF 5CBPA 2CHFA 2DLDA 2B7BA 3GHYA 1JL3A 3SFVA 2XXAA 1FS5A 1XZMA 3QU4A 2QTAA 5LP6A 2X7HA 1P7CA 1QGUB 3OE7D 2H1FA 3QX7A 4I81A 4IF4A 4BCDA 1SXJA 2FEPA 1EDDA 2G9UA 2OENG 3P0RA 3AUSA 5EJ2A 3LCCA 2ERCA 3PC6A 4YP7A 1PR4A 1TMOA 4IFEA 3RVNA 1Z47A 3ZIAA 2XB2A 1YVEI 2P35A 2RKWA 2WYUA 4RLQA 2BH9A 5EZYA 3WR5A 1K7YA 4DRXA 2GASA 3V7NA 3H3XA 4RIEA 5DYGA 4P0TA 5LYYA 4P31A 3CO5A 5K3BA 3PT5A 1LVGA 4JJGA 1N25A 2IV7A 4KQ6A 2YN0A 3LLCA 4BBJA 1NW4A 1P29A 4I8IA 4M21A 3AHDA 4N5IX 4TTQA 4E88A 4UPEA 3Q7PA 2VCEA 3NBQA 4TRJA 1D0IA 1PFKA 3SHQA 5FYQA 4UMEA 2FEAA 1UXHA 2R68A 4XWTA 5HQTA 1AS2A 5AOCA 1P44A 2FZ5A 4KXYA 2ZSEA 3TZEA 4I8XA 1FY2A 4EBFA 1CQPA 3IPRA 2WJWA 3NX4A 3JVDA 1SU4A 2FR1A 4ZJYA 4Q01A 3BMQA 4F71A 2O2XA 3EZYA 3JQFC 1N9ZA 3OTQA 4G8JA 4Q00A 1RE0A 3Q5GA 4D9KA 3OOYA 4HX2A 3I2KA 1PWHA 1KFBB 2VWGA 1FF9A 7ADHA 1WW2A 3ILVA 4RY8A 1VFNA 2C5AA 5EWJB 3TLGA 3NNDA 3D1VA 3K05A 2FX5A 3RF6A 4C89A 3L7IA 5IJXA 1T2UA 4NYIQ 3INYA 2RGUA 1UOEA 4ZVSA 3WGZA 4ARSA 1K7XB 2A5GA 2G88A 3ED1A 1R0KA 5A4KA 1QR2A 3ER9A 1NIPA 4FHEA 2QMUA 3O6VA 1O94D 1GL9B 4KU4A 3WJAA 1XZEA 1U8TA 4OJNA 2XZOA 3IEKA 4TN5A 1OBFO 1ZD5A 3OAAD 1TK9A 4KO8A 4UNSA 2AF4C 3T5DA 3HWX1 2GUWA 5JMOA 1ODTC 3EVGA 4D0LB 4DKJA 3RLIA 2EFJA 4GIBA 4ND4A 3L7DA 2ZUDA 2QUHA 3AUJB 2J45A 3H1EA 1OYWA 3RABA 16PKA 2EKPA 1UK7A 5LD2C 4MIKA 2C4MA 3Q3GE 4RD0A 2PUCA 1EUZA 5DIZA 2C7RA 4YRIA 3D5EA 4RANA 1OFIA 3BMOA 4H1TA 2A35A 3BTUA 1F8FA 5F23A 2CBXA 2NTEA 3KPWA 3MQ4A 4PSKA 3LT0A 3B6KA 4CGYA 3E2IA 4M83A 4PG6A 1PJ8A 1V9CA 4NU5A 4Z9XA 4CF5A 4Z49A 3KT6A 5DBEX 4IQFA 3S2UA 4CMCA 2RHMA 5ESXA 3RRXA 3I30X 1TTTA 2CMGA 2OO5A 4WEOA 2C58A 1HZZC 4YFVA 1C4XA 4F2HA 2PRYA 3L5OA 1EWRA 3TR6A 1N8KA 1RJWA 1VB3A 2WKSA 4QJIA 4IIJB 4YJ2B 1JEDA 3CSUA 2Q27A 4XJXA 3I01M 1JFFA 1X94A 2FI1A 2G5PA 3AI2A 2EX0A 2HCFA 1W76A 3C70A 3EPJA 1Z0UA 5AKKA 4DS3A 4ETNA 1EU1A 3L4BC 1O8BA 1TZMA 1XZGA 2QG9A 2QMZA 3IO3A 2B4KA 3NH6A 4WCVA 3SR0A 5JQGB 1SEPA 1KAQA 1PD1A 1V4NA 5LBIA 1JE1A 5DO9A 1PZHA 5EE5B 3UTDA 2IT1A 1IZ9A 2XHZA 3B20A 1Z6PA 4LZJA 4A10A 2MSDB 3D8BA 5B3AA 2OQIA 4ND8B 1RAGA 1TMGE 4P4GA 3KB1A 5IRCD 3DFKA 2QD2A 4Z9BA 1CY1A 2G6TA 3GRPA 4YACA 1IXRC 4XX0B 1WW3A 5KNLA 3QVGA 1CUJA 2NTNA 2Q6TA 3LCMA 4K6KA 2VTBA 4EMUA 1Z83A 4D9MA 2I8LA 4OIFA 4XJVA 3D0RA 3JD1A 4Q47A 3RRMA 2HQOA 1ZRNA 3M1IA 4DVGA 5BMVB 4V0LA 4PZCA 2D1RA 1AQYA 1G8GA 1UP4A 5F5LA 2CEAA 1W36C 4MW6A 4X3CA 1HE4A 1FB5A 3B5IA 2Q9AA 2QL7A 4JB3A 3OQNA 4DQLA 2GAOA 3KOUA 4XQGA 2OZVA 3L79A 3FNHA 1P39A 1CDDA 1HWYA 1JBEA 2DTDA 4QT0A 3ESRA 3EPPA 1TZJA 2BM9A 4B3HA 4HLUC 4R4JA 3TTWA 2OLKA 1DV1A 1G21B 3PDWA 2Q4BA 4H6XA 4L4SA 3L0IB 4IRUB 1SZCA 4N5LA 4UNQA 3HDVA 5TPWA 2WJAA 3ZE0B 4B3XA 2EF1A 3BGWA 4IDBA 4F85A 3EZ9A 2QTZA 3QA3E 1OJLA 4URWR 5A1JA 1G60A 1T1SA 4OATA 5HRCA 4RACA 4QTYA 4C22A 2QX8A 2AI3A 2QUBA 4OFZA 3V8PA 3BM5A 2HPVA 4GS5A 5GMOA 5JQGF 1WD7A 3E5MA 4NEHB 4B74A 2JNWA 1E9DA 3VGPA 1CS0B 2VEOA 1XN4A 4WACA 5LJIA 4IMIB 1P1HA 4YRJA 4LXIA 2ZBRA 3PI7A 4B48A 5C8DA 4B3SB 2XXAB 4ID9A 1NUHA 3WLFA 4Q4AB 5J59A 1ISRA 1IAQA 4Y9UA 1T8UA 5DFAA 3N1UA 5F7XA 4IDOA 4XWGA 5E1BA 1TKRA 5GM2A 2WKQA 1XZQA 4QQRA 1FP1D 4RKRA 4D9BA 3JD0A 4IIEA 4EM6A 1C1DB 1J70A 3G13A 5EHGA 3VNBA 5L3QB 4OH1A 2GTHA 1I3OA 2QLNA 3ENVA 2YJ5A 2IKQA 2RDMA 5JMTA 1N6LA 3B2QA 2X6TA 3DEYX 3VYWA 2VWPA 4GOJA 2FLWA 2Q7OE 2AMVA 5D2CA 2B36A 2L18A 1FXWF 2AYYA 3QVWA 4IOKA 4XM2A 3K4HA 4JVMA 1T0IA 2C92A 4ASUD 2IOYA 5EWLA 3ZWVA 3C1OA 5IDXA 1DKQA 4FONA 2VRBA 1F4LA 3W6UA 5IANA 4JGGA 2PJZA 1QBKC 4DCCA 3TZQA 4E4RA 1JRLA 4YJHA 5ERGB 1T8WA 2GGSA 2WSSD 4WXMA 1JLRA 1NG1A 4TV8F 3RW9A 2NU8A 1QGDA 3DDHA 3VISA 2HJWA 2IYVA 4HGNA 5KMGA 3MCZA 1JQEA 1XVTA 2HA5A 2PXHA 3KSRA 5C8YF 2BH2A 1KVSA 4HJXA 4R2XA 3TTVA 1TAUA 5D5HA 4J7UA 1DAHA 2ZITA 3O83A 1UJ4A 4Q12A 4QBKA 3K70D 2X7XA 4E2YA 2XYQA 1NATA 1QNLA 2O06A 1F0KA 5C1OA 4OHBA 5JD4A 8ADHA 1JQLB 3ETJA 3HCPA 5EHNA 3QFCA 1CKEA 4RQAA 1YUMA 3TFOA 2ZYVX 3UY4A 3AF2A 4OYHA 1PG5A 1Z4OA 5BOSA 4G81A 5LMNB 2ZTLA 1MAVA 4G0VA 4FNAA 3CE6A 4K03A 4ZK2A 4HQRA 4UQOA 1L5OA 4FOLA 5A4MS 2C2KA 4GFDA 2ZB8A 4GBMA 3SYRA 4N12A 4A2QA 3X2EA 3P9NA 5FXMA 3PVZA 1FE8A 5AW2A 2P3LA 3LBFA 3NM4A 3E9DA 3R5JA 3A6DA 4HTAA 3WIBA 3X1MA 2R44A 2AJBA 3MT0A 5KX5A 3EBPA 4GZ5A 1DEHA 3QUBA 1ZRHA 3HWSA 1F1JA 3MWJA 4I9GA 4M0EA 3BGSA 3Q8MA 2W2LD 2PSSA 1BW9A 3DMTC 5JXIA 4XARA 4LDPA 5AJYA 5C3MA 1J4AA 1CLEA 2CLIB 2RARA 2W8BB 4FS8A 4JDUA 4LJAA 4YROA 5D5QA 2PSEA 1AKQA 1MC8A 3K1AB 4DV7B 1WVMA 1MOPA 3AFNA 1Y4DE 3PDJA 1WPQA 5BUZA 3VV2A 2W2TA 2W2KA 1UM9A 4HNQA 4EI2A 4O25A 3CQ9A 4RAOA 4JI1B 4DR7B 1YQDA 1TA0A 3VR3D 4ZZ0A 3HVIA 1ZJ4A 2VOEA 3ORRA 5D85A 4FS3A 2GF0A 1UKAA 2NO9A 2R7LA 1RHKA 1G3MA 2O7VA 2V0NA 1ZUNB 2JLVA 4QULA 2R6FA 1XDSA 4HGYA 5LQSA 4X3PA 2QOEA 4BNNA 1E0KA 4L51A 4MB2A 4RM3A 1WKVA 4XYEA 2X5NA 2I7DA 4DLAA 1GPWB 2C1ZA 2DGDA 5F3DA 2VPTA 1GCAA 1RAIA 2PFKA 1AO0A 5JNLA 1LTKA 4NAUA 4KNWA 2OXTA 3VMFA 5A3RA 1N1GA 1IQ0A 3OECA 4DSNA 3ELWA 1IOZA 3ONFA 1R8XA 1X87A 3ULKA 2I6SA 2JGNA 1C9NA 3NATA 3P2KA 4TYQA 1ZJWA 4AKIA 5SYMA 3VYRB 3BERA 3JARB 4W9NA 2CV0A 1YL5A 4BTVA 3ESXA 1E96A 3PPWA 2QJWA 1PX2A 2AFHA 2QDXA 4X6XA 1GR0A 4U9HS 3CF6R 4IVNA 4ND5A 4D74A 4RKYA 3CCBA 1Q1BA 2Y68A 1E61A 3DZKA 3PUYA 5FPHA 1DL5A 1Z2NX 1NOIA 3RLFA 3CS3A 4MI6A 1JH9A 2VYFA 1Z36A 1G6KA 4GLBA 3WSWA 2EZ9A 4BQNA 1Z2AA 4BX3A 2Y1KA 4ISCA 2Z2YA 2DSTA 2ZI3A 1QHNA 3KKNA 3KV3O 4NESA 2V7BA 5DCLA 4C3UA 4F0JA 4F4IA 1N8SA 4YRMA 1MC5A 2W6CX 4JNCA 3ZXYA 4I4IA 3VR5A 4R2HA 3E82A 3ZGVA 2DRIA 3GUZA 1Z25A 3KHKA 4L4YA 3LX4A 3KZ1E 1BYUA 3AOGA 1IY0A 2XAUA 4UJ3A 4P3PA 1GDTA 1E1QA 4GWKA 2P4UA 2FHPA 3DA8A 3NVDA 1V2HE 4GEGA 2DECA 1Y6ZA 4MQEB 5DNVA 3RSCA 4B3TB 2H8KA 2OP1A 3GZJA 4UQLA 2JIMA 1CUUA 1S9DA 5KNDD 2PRKA 2A0KA 4MX8A 1UZUA 1YB4A 2SCUB 4LJ7A 2PT5A 1MN6A 3PIDA 5BVHA 3UAWA 2GPBA 3PQDA 3G2JA 2FMUA 1JEQB 4D44A 5TGTA 3EOAI 1GGHA 3E35A 3EHDA 4M7WA 4YP6A 2VTDA 3HJAA 3O9ZA 3D3QA 2HV9A 3ZFQA 5B58C 5AVRA 2YVQA 3LC0A 4WBSA 4AJ1A 1KI2A 4R1SA 5K8TA 5F3WB 1YB1A 4MINA 3L41A 1V5GA 1T6XA 3OHMA 1OBVA 4P6VF 3S5UA 1C1YA 3D6UA 4DRXB 5I7WA 4KIWA 4DIBA 4Q4AA 5JJIA 4JLJA 5J1TB 3JV7A 1NA5A 3DXZA 4MA5A 1JB1A 5TY0A 1KDVA 3GVHA 2C96A 7MDHA 2JAUA 2G70A 3L7AA 3C1UA 1G5TA 4YV2A 4MJLA 2EX4A 3EIHA 2I2CA 2ZRMA 4JI8B 3O2JA 2PLNA 1KI8A 2KPOA 5E1MA 2P62A 4JVNA 3EFOB 3I9V6 1GUYA 5B7GA 4I55B 4AJIA 2ZT8A 1QIJA 2ZKLA 3LPMA 4F5YA 5JISA 1NIJA 4NBTA 5JSHA 3M6AA 4I0WB 1YZYA 3T5GA 3TGWA 2R1UA 3IE0A 3L7YA 4RHYA 3ZR4B 4D42A 4EY3A 4EKYA 2CV1A 1G3UA 1KP2A 1KI7A 2BFFA 3TIVA 2RHCA 1A98A 4X8MA 4ENVA 1V8ZA 3L06A 4QYTA 4NCJA 3SVLA 1Q15A 2XDAA 4MYSA 4EMSA 1TI7A 1EM8A 3LF2A 4LJSA 3M5DA 4PC7A 5EJ8A 5JV5A 3WXMA 1EVIA 4D1YA 1VGQA 4TMTA 1RC1A 4KPFC 3C1TA 3HXPA 5A4FS 1QU3A 3E9CA 5GINE 2PO5A 4CGZA 1NMYA 1O77A 1XELA 2XOKD 3HJGA 4N0PA 4Q21A 4RXUA 2X8JA 1K88A 1HOXA 1OWPA 2O8VA 3FUWA 2J9FA 2VXYA 1JMYA 4J0CA 2O2DA 4MUJA 4WK4B 2OXFA 4Q3BA 3GF4A 1E1MA 1UKBA 2GCOA 4IXMA 1A1VA 3ZZ1A 4KQ2A 1G38A 2OZLA 1BYIA 1F48A 3GG9A 1U28A 4LVUA 2D7CA 1R2QA 1TF5A 4P38A 4YRSA 1LF0A 4GM0A 3T12A 1A72A 5EJ7A 2AB0A 2A92A 3JY6A 5A3VA 3A10A 3PHLA 1ZDMA 3LPLA 4IMRA 5SZKB 3OM1A 1YHYA 4KG7A 4CL2A 1KFCB 2Q6VA 3AHJA 4I36A 4H9KA 4I19A 1PGNA 5C9ZA 5B53A 5K0NA 1NQXA 1YR7A 2WQZA 4V0KA 2O8CA 2FWIA 3K9GA 5JCPA 1U8AA 5AXDA 4WZBB 1SOVA 3B1KA 5KTOA 3D81A 1XAGA 2YWDA 2B98A 1O5OA 3QLTA 2WYOA 3CZ4A 3R7NA 3KQMA 1XKXA 2JGFA 3K1AA 2BEWB 4P4LA 5E6UB 1WLSA 3SMQA 3NV7A 2UZ3A 2O8BA 2HQRA 1ZAYA 1O96B 1QZXA 1OPRA 2HMVA 1A9SA 2P6NA 3DTTA 3NC1C 3OJEA 3P52A 4J1QA 4JT9A 1P3JA 1Y5RA 2DFNA 1ZUWA 2P4QA 1K3UB 4JQSA 4KN9S 1Z4MA 3QKRA 1LNSA 3PFCA 2F1KA 2IH5A 1CYEA 1FS4A 4Y2XA 4EG8A 4RPKA 4FMBB 1ZVQA 1I32A 5BSFA 1Z33A 1XLTC 3ZE7A 2WEKA 4EFKA 4H7FA 3OC6A 3TQTA 1I2BA 2Y6UA 3IS3A 3OEED 1Z62A 1LLFA 3GARA 4RA6B 2DQSA 3IERA 1DQNA 1U0BB 5FBQB 1QOZA 2YWEA 3NDJA 3Q8KA 2GAAA 3U3ZA 3T1HB 2F43B 1XPJA 4MQ6A 1YE8A 4RPHA 3UHOA 4RTJA 1R8QA 3OWXA 3VZRA 4DF3A 4DYHA 1UBLS 2GFHA 2PVCA 1FVFA 2J07A 2V03A 3H99A 3UWMA 1Y9EA 4I6GA 2FVXA 1BG6A 1R10A 1HYHA 2ODNA 4UNNA 3BUSA 4CT4B 3GB9A 5CB6A 4NCBA 1B23P 1TZCA 3NEPX 2E4AA 3WHIA 5EZ5A 1H2FA 4GBJA 2X1MA 4NZ9A 4IXNA 1B26A 2VH5R 3EPRA 1JVSA 3ZV4A 3L05A 2PUTA 1URPA 3NWEA 4GE0A 5T4EA 4R1NA 3SE0A 4TZKA 2NUPB 1LQUA 3EEFA 4HAOA 1T36B 2MYTA 2ZJAA 3CUEF 1W85B 4J2HA 2HI0A 1UKVY 3UT0A 3EVEA 3GCXA 4DSZA 3W3AD 1ZCFA 5BRNA 5BVGA 3HCAA 1FLNA 1N0VC 2R2GA 3A36A 4V3CA 3IRVA 4S2UA 5FT9A 3SQXA 1E8MA 4I5GA 1XO1A 4AMYA 4GKJB 4UHKA 3KXLA 1SHJA 1NN3A 2FMFA 1M8JA 2PN1A 2YV4A 3M0EA 2R2AA 4W9NC 1P5JA 3VPXA 4CF3A 3GDFA 2C2MA 3KETA 2PK3A 5DEOA 3FZYA 5JCJD 3RU9A 1RPTA 3T41A 4AAYA 3Q0TA 4M46A 3OQOA 5KDLA 2N47A 4GNKA 3S55A 1B43A 4B81A 1X1TA 3FMGA 4II3A 4MP8A 5IM4A 3HVUA 1EP3B 1YOBA 4AZWA 1EHCA 1S01A 1YR1A 2M32A 5K05A 4TV9F 2PY6A 2J48A 3CM0A 4QT4A 3CX8A 5WRFA 4OM7A 1I94B 1M2NA 4AJ4A 2P9EA 2FN4A 1RLTA 4CVNA 2E6KA 1DQYA 3S2SA 5F9MA 3RAFC 4OK6A 3IIKA 2GFQA 4PPQA 1CJMA 4WVFA 2JJMA 2OWDA 3NBYC 4U8GA 3UMVA 2WHRA 3KL4A 3RJ5A 3C3PA 4KOEC 5G1NA 3EVZA 3QHPA 1QTQA 1CNFA 4PNZA 3TX6A 3ZLTA 5M34A 2HV8A 1I36A 1EBBA 1U04A 3QY9A 3E7FA 4M8SA 4QJ4A 5CFOA 3EEIA 4BLUA 3GLFE 2YJTD 1R50A 1TCBA 5BW6B 5C34B 4LKRA 1T0UA 1N2CA 5AP9A 1GNPA 1GG8A 3BXPA 4QTXA 1JKFA 1FBTA 2QRPA 1DAEA 1NJ1A 4UCWA 5C8YA 5GZ3A 3L4KA 4TXMA 2PGLA 5E4TA 10MHA 2JH8A 4ZCPA 3WJ7A 5JECA 2UYOA 4Y6SA 1B1CA 4B71A 3SR4A 1C3OB 1TCUA 1YJBA 1IJBA 2ADFA 3PYMA 4IM7A 4TXNA 1MXHA 3DGFC 4P4UA 1MX9A 2DWPA 2P2NA 4M9UA 2O3RA 4IRXA 5FPTA 4I4LA 3V8RA 5A7FA 4XWOA 1XIVA 2FYTA 2OPHA 2HW8A 2KJQA 3A7EA 2JFVA 3TINA 1KY5A 1SUPA 3KQOA 3Q3CA 1CR6A 2FUEA 3EIFA 4GMHA 4L8LA 4IZ6A 2J0UA 4TL6A 4TV9B 4YT4A 1FW8A 2GXSA 1P80A 3A6GA 3MPOA 2QZSA 1ZC3A 1AQIA 4M0FA 2OAEA 1H05A 4HDSB 1HDCA 5CA1F 3SR3A 4JGBA 2HHJA 1BJRE 1XVLA 3CWCA 2P2ZA 2RGWA 4JT2A 4YV1A 2CCGA 4UVHA 3CUSA 3FYUC 5TQ0A 1OZAA 1ULAA 2YYSA 4N3CA 2A9PA 3MD9A 1KZHA 2J3JA 4E31A 2X7JA 3P8ZA 1XRMA 3EMBA 1KDTA 1BS9A 1A5SB 4H7DA 4F97A 5L3SA 2Y76A 2ZAYA 2DPGA 3U4IA 3FUTA 4R7ZA 3MINA 4DUPA 3I37X 2QN8A 5FUYA 1WMEA 1S4MA 1OFHA 3NHWA 2HF2A 1YXMA 1GJRA 1XTIA 4PLYA 1YDGA 4IHKA 4ABYA 1FZQA 3OKCA 2HA7A 3AEZA 3A9UA 4BN5A 1A88A 1E3IA 3K4QA 3RTAA 4HNAA 3WLKX 1SUCA 1GGVA 4XDHA 5JRZA 1KAEA 1QKIA 5CK4A 3U4DA 2NZ2A 4X5OA 4CUJA 3KV1A 1WXFA 5JEEA 3BDAA 1DJLA 3OCJA 5DWQA 3U7JA 2IHZA 1W2WB 1KR5A 5ALVA 4INZA 4ZDWA 3TEMA 1PDVA 5D8DA 3GZ4A 1SQFA 3ZHUA 4XGRA 3K6KA 1WWKA 2AN3A 3WMEA 4ZU3A 3R0JA 5T67A 2HBYA 1KMCA 1YV9A 3I2HA 1PHPA 1HQDA 5JSQA 3K3PA 1WBBA 1VHQA 2A6PA 3IUBA 3C16C 3NIGB 2X0RA 2V6BA 3F49S 4UE3S 4IGAA 4PNPA 3PJEA 4W99A 4HQOA 4C76A 3L4EA 3PLRA 4L5CA 4XWWA 3DR5A 3AM5A 1I2AA 1P7PA 5CB4B 3HGMA 3IEVA 3R9XA 3ZDCA 3FTQA 3PRYA 1L1EA 1UP6A 4LHZA 2I7TA 3OMXA 3QXCA 3HY4A 1Z5PA 2X8AA 4J0KA 5KCMA 3VSBA 3IKLA 2PL3A 3RS3A 3W6NA 1HDOA 4FHGA 1N2BA 1L5WA 1YC5A 3CLRC 3OIWA 4LTMA 3EIWA 3O8BA 1GL7A 4LHWA 3DMRA 5HF9A 1E4EA 3FYDA 1VG8A 3DO5A 3UKDA 2QM8A 2IS2A 1E1CB 1XXLA 1Z38A 3FIUA 3IX7A 3ZBQA 3T9EA 3BFVA 4JSRA 2I80A 2GDJA 2J3HA 2QP9X 3GN1A 2D1TA 3VC2A 3T34A 3HCBA 1OROA 1G66A 3X0DA 3PEVA 3S68A 3ZIUA 3E3AA 4CKEA 3LWBA 4J7CA 2OK8A 3DCJA 4RZXA 1YQGA 3AK4A 2HSGA 1P73A 1E3WA 4FFOA 5LOVA 5E6SB 1EFTA 1CZLA 2YH2A 1UODA 4QYIA 3VTKA 3E9YA 4BDSA 1GXSB 2ECPA 4R40A 4Z9FA 4ZA2A 4MV3A 4LKOA 3SDBA 1CRQA 1HLGA 1Q22A 1T36A 2I6UA 2ZGVA 4RY9A 2Q7DA 2RHGB 4G4IA 4PLHA 3UENA 3C6KA 3UICA 2YY6A 2IE8A 2Q2NA 4UQPA 4ZIRA 4NP6A 1P4AA 4XH9B 5EERA 1HDZA 1SBZA 3WK7A 2QW1A 5GV8A 1IYZA 4MV7A 4M0PA 2GPAA 3AVUA 3QEAZ 1ZUIA 3VOTA 3AINA 1OTYA 3BE4A 2QF7A 2XIQA 3OT4A 1U8UA 1WMSA 4FYWA 4LWOA 4U39A 1XBTA 4GC9A 4DLYA 1TA4A 1BD3A 1UWCA 1VSBA 3PRHA 3EUEA 4BPRA 3BRCA 1UWLA 2CHGA 3NEJA 4I4TF 5E1DA 3A6EA 3FOFC 3FBTA 3PL5A 5AI8A 5LLSA 3KOXA 1R9MA 1X7GA 4EY4A 1QYXA 1UAAA 1UCFA 2IOHA 3A37A 4Y6PA 1D6MA 1NL3A 3T54A 3WRYC 2H8GA 4FNGA 4YN3A 4BB9A 3N53A 1K0FA 1NLZA 4OF4A 3WLNA 2Q9UA 2NNWB 1BE0A 1PFYA 2XBLA 3I73A 4KV9A 4PG7A 2RGDA 4E32A 2PZFA 4FX2A 2LPMA 4QYXA 3LP8A 1UMDA 3LVQE 2AUMA 3P9XA 3PQ3A 1D4ZA 2DPLA 2FW8A 1JZQA 3CF0A 1Q7EA 1ZNWA 1Q0SA 3L46A 1VTKA 3N07A 3RROA 2HBQA 3ZY4A 1LC3A 3K5IA 3AXTA 2UYHA 3WB2A 4QRIA 2E55A 3D7NA 4ZAXA 5A1TA 2R7NA 3GN2A 4MA0A 5BRJA 1KF0A 2YJGA 3COSA 4PHHA 3V1YA 1U8CB 2EDCA 4P80A 3VR1A 4NMWA 2R87A 4YT5A 2X6QA 1IN8A 1A4IA 3WFJA 4ZVRA 1ENOA 1YVPA 1R1DA 1W9HA 1YNSA 3O84A 1WXQA 4QBFA 3SI7A 2B3DA 1BMFA 5FFFA 1WSAA 4J03A 4RMHA 1PGPA 1UDAA 2EBUA 3OEYA 2PKYX 1CV2A 1P0FA 4G67A 1DB3A 2C98A 5J58A 4KXMA 3JALB 2ZSIA 3Q6IA 2LV8A 5HCIA 3L1IA 3KXIA 2LIVA 4MHTA 4ZT5A 3HZRA 1KARA 3ZJ4A 4AY2A 3QVUA 4R01A 4F6CA 1M7BA 4N7BA 4NYJR 1MPTA 2XMCA 3VNVA 2EBWA 4I66A 3FVVA 3VC3A 4P9NA 4RF5A 1QG0A 4FE4A 1D03A 1EXMA 4HZUB 4C29A 5CFZA 1AQ6A 2JJ1D 4OAOA 1SUWA 3GLGB 2GXAA 3WZ2A 4NR0A 4JI5B 1BH2A 2VDUE 3EEOA 2OZPA 4MEJA 2JFQA 4MCIA 4GVPA 5COBA 4ZPJA 2C20A 4WCFB 4M0KA 2RG7A 5CX4A 3OPVA 3T7SA 2IF0A 4IXWA 3REFA 4KLNA 1HQKA 2P41A 3HUFA 4CLRA 5EHXA 3FYHA 1ADGA 3L0PA 3EQ6A 5K7SA 1GTRA 5B36A 2LGJA 2GCGA 1S02A 2M1XA 3GGCA 5ADWA 4WTOA 4G2TA 3OO0A 1O89A 2IYXA 3EW7A 4MI3A 4F5DA 2BRUA 1KJYA 2JC3A 4B17A 1SQGA 1QVWA 3LY9A 3AIKA 4ILEA 3HXMA 1DRWA 2QYOA 2R751 3AY3A 4LY9A 3S1AA 4RTNA 1RWKA 2IVFA 4CXMA 4LFCB 3JWGA 3WWZA 5T4FA 3S8EA 4NU8X 2X1VA 3D6FA 3DEJA 3DL2A 2G0AA 2WICA 3VSEA 2F3UA 3WLSA 2AZXA 1N6KA 1DC5A 1WDLA 4ECAA 3BTVA 3ROPA 1HKUA 4JZYA 3V97A 1HSOA 4EB8A 2JFPA 3FSEA 3TMKA 3KLMX 1U7DA 3QVGB 4XB1A 4RAQA 3I6ZA 1ML3A 1CJCA 1EZ4A 1MB9A 2RH9B 3HNRA 3KO8A 2GK3A 4FC7A 3RAJA 4EG5A 1RJDA 3QFSA 4EHNA 2DPXA 5IYZF 5TXGA 2V4MA 1N8NA 4PSDA 4S1VA 3LCJA 1Z63A 1GRRA 3NRCA 1XZAA 4KJXA 3I9MA 4FWTA 3FTNA 3D2LA 2FDCA 4EG3A 3DM5A 3K9CA 2WG0A 5K8IA 1ESMA 4DDTA 5G40A 1U8EA 4QDOA 2W6QA 3DAHA 1C0PA 3RC3A 2OD9A 2B78A 2RH8A 4BV2A 5IM4F 1CQWA 4DY4A 1AQJA 3DKIA 1A97A 2ATXA 1JPVA 1NQTA 4FZ5A 3ZHYA 1LS6A 4MAAA 4ALIA 1KY2A 3T5BA 3ZY3A 4B3JA 2QRHA 1L4BA 2Y2UA 5FO0A 1H66A 4ZALA 2VNSA 3MCTA 1RLOA 1OREA 1N6HA 2DY0A 1CNEA 4M98A 5HILA 1SBCA 2IZ5A 4BQPA 2EW1A 1OA1A 3GVIA 4K7JA 4Y98A 4S04A 2XE6A 3W3ZB 3GPLA 3FWYA 3RYHB 3FUXA 3DWEX 3OE5A 5AIBA 4OBBA 2VTBB 1Q0RA 2X13A 4PLPA 3RUCA 1Z0SA 5LQJA 3H1AA 3M6XA 4BMXA 4RXTA 2O07A 3DYBA 1I10A 1QONA 1ZIYA 3QLUC 4IFTA 4DBVO 2EU8A 1O9GA 2GO7A 2NV2B 2XAAA 1AJEA 4EYEA 4ARBA 3CVJA 4PO3X 3LKZA 1IZZA 1UJMA 1LK5A 5CEEA 1CT9A 1FFXA 2V7VA 4OQFA 1BDHA 3A6JA 1E0AA 5KYGA 1U7OA 3ROZA 4ZO4A 1K92A 2X1LA 1XYGA 4FNMA 4ZAFA 1N2IA 4ENRA 4XSVA 2V6FA 4G9BA 2PWBA 3BXHA 3LU1A 2YWCA 3X1XA 4EO7A 4F1KA 5L9AA 5DTRA 2NMVA 3G88A 3NM5A 5TC4A 3CRQA 3PPXA 2FQXA 4ZARA 4XOIA 2FR8C 2XCIA 1IRIA 5A62A 3HP4A 1BCRA 1VJ5A 4DDMA 4X62B 1D6SA 3GJTA 3T99A 1WA5A 1M1YA 5I7VA 1JXAA 2Z1DA 4HRYA 2IOFA 1Y1RA 4GGPA 2DBVO 4XM0A 3DZIA 3GELA 5ITWA 3IKMB 3V8VA 1K2VN 1KYVA 4PZUA 1L5HA 2WA1A 3ZZTA 2YCLA 3P9PA 1V7ZA 1X1QA 2F17A 1JGTA 2B6NA 2F1IA 2UVPB 3P71T 3DKVA 1CF2O 2BY4A 2ZRDA 3QG5A 3RQSA 4DV0B 1FYEA 1YJ5A 1BXRB 3EE6A 3VHXA 4P5PA 4BKQA 3BJIC 1F2TA 5FI3A 3UVEA 5CB8A 3D3WA 1NVDA 4S1NA 2IYTA 2PBFA 1X1AA 2Q4TA 1QGOA 3BMXA 3IEUA 4NCAA 1NVBA 4OBEA 4YMTA 3G0CA 1QH0A 1E7SA 3B1VA 5ALFA 1TGYA 2C59A 1KK2A 1ENPA 4O1IA 4QASA 4EGQA 3NHFA 4Q03A 1HE3A 1I6WA 4YLYA 2H06A 1J07A 1NXSA 4DB4A 1Q12A 2WA2A 1RP1A 2RHDA 5I4KA 3V8NA 4KREA 3VPGA 3EVBA 4M89A 5DWVA 1H2WA 6REQB 1YKSA 2XRZA 4LF8B 1S3IA 4O2BB 2X3YA 3E1SA 4U7TB 4AMVA 4D3SA 1HX7A 2II6A 3PQ2A 4Z3KA 5HE8A 3GIWA 2Z6QA 2ZJ5A 4B8WA 3DTNA 4EL0A 1UJCA 4HT3B 2O14A 4G3XA 1MMFB 1IQUA 3AYXB 4LMRA 5P21A 4AICA 3E0QA 4TT8A 3RVMA 3TOZA 5KQGA 3DEKA 1TAHA 3PWKA 5FTKA 1XL0A 1GTMA 5J63A 3EY9A 3VC7A 2R6DA 4IUBS 1A5BB 2QPAA 1L5YA 3FPSA 4WA8A 4P34A 3EEBA 2R3SA 3OA0A 2GN2A 4JL5A 2BOVA 4E4YA 3TQCA 1II0A 3CWQA 5KYXB 4WECA 1AC5A 2GBLA 2PKQP 3G2MA 2BFEA 4R16A 4K26A 5FOVA 6AT1A 3MELA 5C5DA 2YASA 3NHBA 3P9SA 4XLLA 5L3SB 4BPBA 2QV7A 1D2NA 3KB6A 4IYJA 4RIIA 1P5RA 4QJ3A 3MS4A 4C7JA 4WLOA 2LCFA 2ZSFA 5CHYA 3ZUGA 1N5OX 2GI4A 5THKA 3L93A 3KEFA 1DRUA 3NVKI 4JVLA 3C8HA 1F06A 3TW4A 1AB5A 4B73A 4W5OA 1IB6A 2WFAA 1ZAKA 4EYKA 2WDPA 1QIFA 1CEEA 2RK3A 1N9KA 4B46A 4MDYA 2JGLA 1AGYA 4JLNA 1U3VA 4DCJA 5KOYA 1BVHA 1VE3A 1W19A 3V4VB 2ZSDA 2PIDA 1OBOA 2XVMA 3HKCA 5ENVA 5CXQA 2ZUFA 1U0RA 3D6VA 5FHQA 1K7SN 4JB8A 3TB6A 2YXEA 4OK5A 4CMEC 3JQBA 3QF7A 3UIEA 3PGJA 2DBYA 1EHYA 3KKKA 4YMGA 1FNMA 4FWIB 4MKZA 4KC0A 1ZO8A 3VSDA 5C8VA 3MTGA 1TW3A 3C98A 4V1CB 3OI7A 1P1FA 1I6MA 2BGUA 4H1VA 1RRVA 5G1PA 3ZGOA 5MFPA 1Z16A 4BMCA 1J9ZA 2X14A 3GPDG 3MB8A 2HMYB 4XD7A 4M8NE 4QO7A 1CZUA 4BX9A 3I9OA 5C32A 4P5DA 5JAIA 2B7LA 3KD2A 2ZIVB 1BA3A 1PS8A 5LA6B 3CR7A 1KJ9A 2B0JA 5FA8A 4FD3A 5ESWA 3H5VA 2P6RA 3OQ1A 5DYWA 1V2GA 4NE9A 5BP7A 1UC8A 4L73A 2E4ZA 4UBOA 3EBLA 3ETNA 4FEEA 1UQUA 4UEOA 4RTQA 5JBIA 3LFTA 1C7JA 3I58A 4LRYA 5CHEA 3ETEA 4WLNA 1A5TA 4CMHA 1JFSA 1S1MA 2J4CA 3I6QA 5ALDA 1GKLA 2I7CA 3B1WA 5FEMA 4F6RA 4E11A 1OBHA 2VDJA 1P2GA 3AMVA 4KQHA 5DYTA 5K0LA 3V2HA 4DPKA 4IHJB 3ZH2A 5BQ3A 1K7CA 3QIVA 3WADA 1RBZA 1E3SA 1QR6A 5TEVA 1ACJA 3TEFA 5B58T 2CXSA 2LD4A 3I76A 1LH0A 3LDUA 3QMWA 3LWDA 4CRWB 1N7JA 4PINA 5CR9A 4KR9A 3SQLA 1KP3A 5IPFA 1T9GR 2B30A 1EKXA 3GRKA 5EXPA 5F78A 1Y7PA 4X90A 5F9HA 1ECBA 4L4RA 1NBME 3EGXA 3IVAA 2UUPA 1GPMA 2OCIA 5DBIA 3U1BA 4MDEA 4F38A 2RHWA 1C1HA 4OP1A 1TLLA 5LQMA 1B7GO 4FINA 4PCUA 1PJTA 3CIOA 4H7IA 3STXA 3C3CA 4D45A 4NDAA 3KSBC 1D0SA 3L4BA 3G0DA 1L7NA 4L76A 4QNMA 4N49A 3VUFA 1PTJC 3BSYA 3TIFA 3CBQA 2RI6A 3U48A 2JJYA 3QBVA 4IGEA 4ME6A 4U2BA 4PNHA 1Y1QA 3DDCA 2JZCA 3RRBA 1Z6YA 4RLHA 1TLFA 3GLTA 1FFXB 1RCFA 2ZW9A 6LDHA 3L9WA 4HN4B 3DBVO 1JIKA 2HNAA 3M5PA 1ITZA 1U98A 2X41A 2TMYA 1Y8QA 3N0RA 4FQ8A 4L4UA 4ZOQI 3PE6A 2XVYA 6REQA 4HQFA 3QU7A 3AU9A 3HEAA 2MTBA 4HCJA 4Q5IA 4EDFA 1PZNA 1OVGA 3I92A 3PUHA 5EN4A 3WRXC 4BQOA 5JIBA 1FMLA 4RV9A 4ZOEA 4XD2A 5DN6A 4LTDA 3N59A 1G18A 1B42A 3D64A 1P2SA 5DASA 1TXGA 2EYQA 3BBLA 1PQWA 3EVNA 4J0EA 4DIUA 3RUFA 3L7JA 4AQDA 1Z6AA 3ODPA 4EJFA 5HP4A 3G9TA 3EA0A 1T6BY 3CPEA 5B6JA 1AKWA 1PJAA 3RVQA 1JHMA 3L0DA 3B70A 3TRFA 1MNAA 3TAHA 1H8ED 1KNQA 3UO8B 4DCMA 3SN6A 5ALYA 3WRVA 4HLUA 4JYBA 1I4EB 3BB4A 3P4XA 4H6PA 4XYBA 4WESA 1Q7GA 1Y4SA 2EJCA 2HHCA 3BD9A 3ANTA 3VZDA 3NUZA 4B80A 1KBOA 4PNEA 5AUQA 4E13A 1DFGA 1OX5A 1VIYA 4TL7A 1WY7A 1U0FA 1WSWA 3AHFA 3M1YA 4DSUA 3WLIA 2P0YA 3PXEA 2WHPA 5HIAA 1JSCA 2P4SA 1FRNA 1LX6A 3C0KA 4MV8A 1M2OB 1J8QA 2CJWA 2EFHB 3ETDA 1V11A 3EFOA 1IBKB 2YNMC 3B2NA 5K6RA 4GI1A 2EYUA 5D3KA 4G5SA 1T9AA 4US0R 5KYYA 4YP5A 2UZ1A 2YNMA 5DM70 3ZTYA 3G0HA 3GNQA 1VYUA 2B8JA 4N3NA 1S96A 2UXCB 2JFYA 4DGSA 3FG9A 1JAXA 1UDCA 3SC2B 4ZCRA 2XF2A 3DKPA 1WV1A 4P7GA 4Q7QA 1GQOA 3NHKA 3UJ6A 4DQXA 2NO5A 1WTCA 5EXDA 2D06A 1U0NA 3KFVA 1IDN1 3D02A 1XVUA 4I50A 4MPRA 5BT8A 1VM6A 3A1EA 3EDCA 5ALJA 5H59A 1E1RA 1HBJA 4FDVA 3WAKA 1OD6A 4OQQA 4R6XA 2IC5A 3IAEA 3KZMA 3UV3A 4RLSA 4HDAA 2HRDA 1PGQA 4M1WA 3RHTA 4CMGA 2VDPB 5A7GA 1CUCA 4AX4A 5TPZD 3IKVA 4PIVA 3U7EB 4PPFA 1DMSA 4CEHB 2EFCB 2HPZA 4QFDA 521PA 4UZFA 3WLRA 5JTUA 4CLEA 5IVHA 4IIUA 1OFUA 3AI3A 1LI7A 2Z4SA 5CIWA 4Q1BA 3ZWYA 1DT5A 3H5WA 3HS3A 1FNNA 3QPCA 5HF5A 4XVRA 1J2JA 1DBQA 4WJLA 5KBYA 1ZYUA 2YWHA 1FYVA 4YAIA 1NU6A 1T4DA 2P27A 4ZO9A 1QZTA 4MQFA 4WI1A 3GD5A 5CNMA 5JZMA 3TN7A 3USZA 1M3SA 1H2RS 4HUJA 1IHDA 4I9HA 5KOHB 2VDQB 4W63A 2FSPA 3CRRA 1GKKA 1SD2A 2FPRA 1MHTA 4GMGA 4JOQA 4Z5XA 4LHVA 4NZZA 3PENA 4DQUA 1WUYA 3C7KA 2HEIA 4YMSA 1E5TA 1OT5A 2PH5A 1QYWA 3EARA 3OIVA 1UOQA 1BE1A 2CWDA 1QWSA 1YZLA 3BJEA 3QX8A 4FYYA 4JC4A 4Y2QA 3UXHA 2O50A 4MP6A 4MV0A 5AI0A 2VT3A 3O90A 3I8SA 3KVVA 4DJTA 5J4LA 1V16A 2F8TA 1T9HA 3GJXC 3KFXA 1JWLA 2GPYA 2GYYA 4QXRA 1XRJA 4L72A 1T25A 2VT7A 4FUTA 1U1FA 1AY0A 5ALSA 2WT9A 3EC2A 3B1JA 3BQMB 1VCNA 2A9FA 1U1GA 3V8QA 4R8VA 4I46A 1YASA 1EAYA 3H13A 2DCMA 2Q3FA 3JQAD 4V03A 3FETA 1HFEL 1PLLA 2OBYA 2OWEA 4PLVA 1GNLA 3JVIA 3J80A 4U7DA 1KZ1A 1NFRA 1BHSA 4LBZA 5BVGB 4PTLA 1RXYA 1TCCA 2XODA 1LZLA 2IDKA 2OAQ1 2ES4A 3BZBA 2QLTA 3HDGA 3D1LA 4WL0A 4TYYA 2UVDA 2V7TA 2QR3A 4RV5A 1H4QA 1JV2B 2PJRA 4H27A 2O7RA 3OX3A 2CFOA 3Q7QA 4EDHA 5BQ5A 3STTA 4ICIA 1H1TA 1PUJA 2FMTA 1V0JA 2ZT7A 1FYWA 1Z4IA 3RPEA 3WB1A 5A4JA 1SBQA 2PA0A 1HV8A 4G5XA 4D9GA 3H2SA 5LLDA 1J8MF 4H1WA 1E1DA 3AL3A 2ZVJA 3DDZX 2E21A 4Y18A 2X86A 2OMEA 4IR7A 2PNFA 4TSFD 1C3VA 3PF9A 2DKOA 4JROA 4BDTA 2BEKA 2W2XA 2Z2ZA 1V7QA 3D8NA 3RBXA 4JBNA 3EQ2A 4GM4A 4MR8A 1U3TA 2BTOA 4FD2A 2JB9A 3WQQA 4QQ8A 3LCVB 1KMIY 1EE2A 4KLCA 2IXBA 3MN1A 1ZMTA 3PX2A 5IDYA 5AXBA 1A82A 1HY3A 3OPQA 2Z4RA 4DLSA 3IIEA 2RONA 1RWPA 2P3QA 2ZJ2A 4KGZA 4FEYA 2RI1A 2FU5C 1R4ZA 2VP9A 3DH0A 3R23A 4GPIB 1AF4A 1BMFD 5CXSA 4EFLA 2DERA 4Z4IA 1AGNA 4NYIR 5JU6A 2WIKA 4QLOA 1RM4A 2YWRA 2BJHA 4CM1A 1A27A 2FOLA 1N5JA 4POAA 1HDIA 1FUEA 2PZJA 2XCTB 1Q77A 4MLZA 1NXTA 2H1RA 2HRZA 4CUKA 4IH1A 4KO4S 3J7AC 3LVRE 2GB4A 1IBSA 2C97A 4ARAA 1G5PA 2XJ4A 3OPMA 4EHJA 1PS9A 3A1SA 2REQA 4V1CI 1RYBA 3GK3A 4FYXA 5JZBA 5LL6P 3AT1A 3UAVA 4HGOA 2VDWB 5HFAA 4AN4A 3BMQB 1Z73A 2WYVA 1GUZA 2XMRA 3R0IA 3CRW1 4HEA6 3X1KA 4URUR 3BFJA 2M1ZA 3V9AA 4B82A 2GR9A 1DT3A 1DG1G 2BHTA 3GA0A 5LYJA 1A7UA 1EM6A 2Q3BA 2QYHA 3CW9A 5ALUA 5BXQC 3X1YA 4GKAA 4FBLA 3UK0A 3BDIA 3EZGA 1TKBA 4GW3A 1SXIA 3GPIA 1UKZA 1YIAA 2ZRGA 1T5SA 4QUHA 2GT1A 2B92A 3HZZA 4K8RB 4B4UA 3PGVA 2GCNA 1UBTS 1XLWA 2J3EA 1MEEA 2GKGA 2VYNA 2YZ2A 2Y0PA 3U7QA 5KNCA 1GFZA 1YTUA 3VU9A 2ODAA 1CTQA 3QJ5A 1P4SA 2ZG6A 4HKTA 4ZOAA 3D6MA 4KYVA 5LCXA 3ZOKA 4QNRA 2CLOB 1SHUX 1DJMA 3D7MA 3SIXA 5JCXA 4DQ0A 2Y67A 5FTLA 2VHXA 5IXYA 1QX3A 3TUIC 1FRVA 1CIVA 2GHQA 2LE0A 4KFTA 2UZ1B 5HGJA 5CA0B 3P2YA 4FFLA 2CZCA 4MROA 2OHVA 5CVUA 5PGMA 5BMOA 4MQUA 4J94A 2F8LA 1OI3A 1GA6A 4U9IS 5ES3A 5A7HA 4KIUA 4H1HA 4EUSA 2DT8A 3T0IA 1E3DA 3E9MA 1NUPA 4O1HA 4V38A 2DEUA 3LOPA 4LQCA 1A4UA 3W9UA 1DAPA 4WADA 5H81A 1N2EA 3CEAA 5E3JA 3FOBA 3B2EA 3OCXA 3E22A 2JIBA 4A2PA 4JEIA 1IPFA 1TA9A 1H1DA 4JXJA 1EP1B 1HYGA 5H83A 4IG4A 1CYDA 4LBYA 2P2GA 4EEZA 5KYKA 1XNGA 5EMJA 2YVUA 2A0FA 2GH1A 2XVZA 4GI5A 4UW9A 3LPDA 5MF6A 3K1YA 3LFUA 2ZUCA 3IV9A 4M1MA 4O4JF 2PE5A 2C1XA 3G9QA 1GSHA 5IX8A 4K3UA 3QPDA 5BYJA 2R79A 2TECE 1OLSB 3I9JA 1IXSB 2YHIB 1SA0A 4QBIA 3LPCA 2B9VA 3CVYA 2FRDC 4NDZA 3RYTC 1W4BA 1V3VA 2JHCA 2RHLA 4PSVA 2Q2WA 1KJQA 3HLKA 4L0QA 3RWMB 2VYND 4D97A 4DSAA 3QVXA 3OZRA 2IJGX 2A30A 1CRLA 1BDIA 1GNTA 3DT9A 1AA6A 2J3IA 3DDSA 3AM1A 4Q4JA 2MHCA 3R7AA 1JXQA 3O1HB 1Z8FA 4HS4A 3FYCA 2H29A 4U7FA 3WDLA 4V1CA 3P2OA 4F46A 3OURA 1CUGA 4Y9DA 2H1WA 4R0MA 5L51A 1PK8A 2AOXA 1HDYA 3BMCB 4XYLA 1KSJA 1MR3F 1YDMA 5LQNA 2UXDB 1Z7BA 3IODA 1EFDN 2H3HA 4M8IA 4P7JA 4X7RA 4BNMA 4UOZA 3KZKA 5KOIA 3NB0A 3GJ3A 3D7KA 2VDOB 1OHHD 1YR9A 2VWHA 4XX0A 3ZI4A 1SIOA 1YMVA 1TEHA 3ZW7A 1UKEA 4NOKA 1E6MA 5EKTA 3RIMA 5EUBA 5DZSA 3N39C 1RM3A 1AVTA 1ZHFA 2PX3A 3CLSC 4Q24A 4GZLA 8AT1A 1G1AA 1WQ3A 1YZNA 1LRLA 5BWBA 4YEDA 5J4YA 1NW7A 3SS7X 2BFMA 4RGYA 2PU5A 4M7RA 3NBKA 3ZWKA 2JLRA 4ZPXA 2KI5A 3OIDA 3VMMA 1LLQA 4Q3LA 3W5HA 1Z34A 1XCJA 2ONJA 1G55A 3WHKA 2I66A 3RS2A 3C6QA 4GLFA 3VTZA 1AO3A 1XRSB 4RY0A 3WLHA 4BTLA 3KD3A 4MUKA 4M3NA 4NCHA 1EE9A 4XPZA 4ZEXA 3OWOA 1SC3A 3DSRA 4HH4A 1Z26A 3W34A 1RDFA 2G1AA 3WGOA 1Q0ZA 1NE2A 3EDQA 3IGFA 1JG3A 4Z4CA 4QXAA 1TJ4A 3ZV7A 3A1WA 2HUPA 4MVJH 1LJLA 4DQDA 2O5VA 1NT4A 1W88A 4X0EA 3WTBA 3IUMA 4QHSA 3N5KA 2H16A 1FS6A 5JWOA 2PGOA 4YJKA 4TRRA 1HLDA 1QP0A 2GLXA 3JAKB 2MSCB 2WB4A 4IZHA 2ZCJA 1Z88A 3SQNA 1UH5A 1E3JA 1EYZA 5L4SA 1GTZA 2VHEA 4FW9A 4L15A 4REQB 3UH1A 4ZJPA 4HO1X 5EQDA 8MHTA 2PKWA 4YXWD 4FYHA 4ZI7F 5K3FB 1YMQA 4PSUA 3UJ8A 1E2JA 3NUGA 2YHBA 4U5QA 5KEIA 1OX4B 1PFVA 1T3LA 2ZI4A 3CUVA 3DP9A 3NHRA 1B00A 3KBBA 4N6GA 4ZIRB 1LPMA 1AURA 1LK0A 3FCAA 2IX3A 3SC4A 3CF2A 1HYBA 3O3CA 4W1SA 2O7QA 2PFGA 3MVEA 5JROA 4RK6A 3NGMA 3VO1A 4W5NA 1BQEA 4JMPA 2D7JA 3CZCA 1DKPA 3EXHC 3HM2A 1K4MA 1Z9BA 2AE1A 2AVNA 2XVXA 3HKEB 5F1PA 4DW8A 1VHLA 2XBMA 4DLXA 1BQ4A 1L5QA 4GKVA 4OU4A 821PA 4EPTA 4K0KB 3A3PA 4LJLA 2ONKA 4ZVMA 5JAHA 5C5IA 2XOKA 3U3JA 3GVXA 1ZW1A 4ARVA 2DJIA 1HSZA 4W5QA 1EB8A 1AKUA 1RHJA 4FEGA 3KJFA 1NBIA 2I62A 1R6XA 2J5KA 4QAJA 1VG1A 3ZKWA 1LWOA 3TCXB 1IMOA 4KDFA 4ZCTA 1NPYA 2HNKA 2W7TA 2CV2A 2PCLA 1YL7A 2X2PA 1Y4AE 1RI3A 2VBCA 5A3QA 1FFAA 1E2FA 3P2MA 4EQ6B 5F2KA 1XZNA 1W4AA 3ZZ0A 1T4CB 2Q5FA 1C3JA 4TMVA 3V46A 3CW8X 5CJJA 3U56A 3DBLB 3V55A 4ER7A 4QGGA 3ZK7A 1AXEA 3MILA 1GQ2A 3ZNOA 4J4TA 3CZMA 3GP5A 2WIFA 3B9QA 3ILYA 1NN5A 3MERA 4FDUA 4Z4HA 5L3QA 1CERA 2YVAA 3JZDA 5TT1A 5B7QA 1UC4B 2PL5A 3OOWA 4NZOA 3AGPA 3D6TB 2BONA 4F7WA 5C1DA 2DZDA 3V6MA 4EECA 1KTIA 1P6XA 2CEKA 2NQ8A 3PQFA 3CKKA 4M22A 3P5BA 2P8JA 3QTBA 1I3KA 5NLLA 3GCZA 1JS1X 2V7UA 4TKVA 5H9WA 5CVDA 3KQNA 4JBWA 3LCRA 3IIMA 2HRQA 3F7TA 1Z45A 2R6JA 3RRZA 5KVQA 4FI3C 4C4ZA 2IK8A 3SS8A 4PG5A 4CM8A 1I80A 1WDTA 2HA4A 3RC2A 3M4YA 3NHYA 2WSBA 4HB4A 4FMCF 4G65A 1IEVA 5DLDA 2IYEA 4P58A 1L4KA 3ZJYA 4OGKA 4AMZA 4ZHQF 5KMGB 3RSSA 4L3WA 2BM1A 5EPOA 5FLXA 5BSEA 3R0QA 1VCIA 1D04A 3VNUA 2FUKA 4PRYA 3G5AA 1YRWA 1FSZA 5DNUA 1A2KC 3CLUD 1UM9B 3DOEA 4GVXA 4NEGA 1TU0A 3GVCA 2NTVA 5I9LA 4B76A 1SGWA 3LY5A 4TV8A 1P9LA 3ME5A 4IRMA 3DL0A 1QPZA 1JSXA 4G56A 3RBVA 2YDXA 2A0WA 2I6GA 1EK5A 4L0DA 1UC9A 3CLKA 4ZQFA 5IVDA 2BUBA 3UGKA 4ZI2A 1MB0A 3H2JA 2ODWA 5HKOA 3KLPX 1FU8A 4HY3A 4MQFB 1NFQA 2W42A 1RQNA 1M6EX 2OSVA 2GCEA 1SB8A 3U9LA 4CLDA 3X43A 2NIPA 4FDAA 4Q4CA 1U2SA 3D0QA 3D8UA 4RZ3A 2GAIA 3HSSA 5AM2A 5B3LA 4KPEC 2NAPA 3O1JC 5IAKA 4MUAA 1V35A 1A7AA 1CFJA 2GO1A 1P17A 3RDPA 5KINB 2R7KA 4QOHA 1XD9A 2ZCVA 4TGLA 5FP0A 3EHEA 4QHYA 1ZIDA 2JIDA 1BKSB 1IHPA 1HMYA 4C20A 4WASA 1JP7A 5KC9A 1P0MA 1U1CA 3AL2A 1E63A 3BK1A 3N6RA 1J06A 1ZN2A 4D4JA 1XRPA 2FOIA 4A03A 4EZEA 3S81A 3CO0S 3PEWA 1B16A 2C4HA 4HVTA 4BZWA 3B38A 4EWLA 3DUWA 1ES9A 3CNBA 2IZZA 5CPBA 1ZUNA 3P97A 1XTUA 5CG2A 4L27A 1H94A 3UWDA 4AKGA 2ZSHA 1X9IA 5TF4A 3M89A 1JF8A 4ENUA 3JQFA 4FLMA 1NRXA 3V5NA 3QSYA 4Z4EA 4OYRA 1OX4A 3QGMA 4FFNA 1DO2A 4BQEA 4AROA 3UAGA 2OGZA 4Q66C 3RD5A 3LBAA 4OOFA 3FX2A 5CD1A 1C2TA 4G5OA 2VDRB 3QVTA 1HGXA 4FSXA 3RRNA 3TSCA 4ZYTA 3EXIA 1FDOA 2BFAA 3C6MA 2G1UA 2ID4A 1ZXLA 3FPLA 1KORA 1O8CA 2XF8A 4DV3B 2XUPA 5CH3A 3T52A 4ZICA 4Z7NB 3LV8A 1YRHA 3O8DA 1OXVA 1YU6A 5IJ9A 5CM2Z 3X2SA 5IU6A 1J5XA 2PVSA 1GUAA 3IUPA 2ZQYA 4OFXA 3UHPA 1TM1E 5HTOA 2MDTA 3TNDA 2V9CA 2DB3A 1X8KA 3FCXA 2HB6A 3EVTA 2R84A 4CI9A 1AZWA 1CUEA 4OHOA 3WGKA 1ZH6A 5LJLA 2V4ZA 3QJYA 1L7VC 4AF6A 1USIA 2OB2A 3LL4A 3PSAA 4B44A 3A3OA 3NHPA 1JE0A 5T64A 2IEBA 4H18A 1Q1QA 1CY0A 3G9ZA 1OU0A 2ORWA 3ZE8A 4UJ5A 4Q18A 4H0CA 2Y9MB 1LPOA 1SURA 2X9LA 3ESCA 4Z0NA 1XPRA 5AXAA 4HDOB 3V4PB 4CV0A 3NUQA 4F04A 4WSOA 5JNSA 3P1JA 1TD1A 3RK1A 4CFZA 2IGBA 2Q6KA 2I0FA 5C18A 1JEOA 3KZCA 1KMMA 4RCYA 1KMHA 4LYHA 2E87A 4M87A 5DWDA 1GRCA 4G01B 4L7VA 3WLEA 1E64A 5BSTA 4BIIA 1VSTA 2ENUA 3QUQA 1QYCA 2IOFK 3TL2A 3UQYS 5KSOA 5EE9A 1NXPA 1SU6A 2XGGA 1JAIA 1JPUA 1I7DA 3TQQA 3CRMA 4IWNA 1O95C 4BP8A 1NMZA 4DJAA 2QQEA 5FPKA 4C0AC 2P5SA 2XNDA 4MS4B 4MUEA 4V0OA 1A9XA 2LUOA 3ZKWB 2PIAA 3GU3A 4DGQA 5ADHA 1IVNA 1RZVA 5MN6A 1E2MA 1H0KA 4O4IF 2NAFA 3ZFOA 5K0EA 3GEGA 1UPBA 5JYCA 1HG0A 5DI3B 3RK0A 3VDXA 1FBNA 3Q41A 2VYVA 1QHEA 4Q9DA 3H7IA 2AG8A 1AKEA 2V74B 4H9JA 5BYKA 1RLMA 3PCXA 3EZ6A 3OE1A 1U31A 5JAUA 2AN5A 4TT3D 4LCJA 4D3ZA 1NBOA 1T1IA 3UJ7A 2OL4A 5I9SA 3M33A 3KQKA 1GUFA 3MXTA 4LDRA 1WBDA 2LBPA 1ZH0A 3U81A 1YR2A 1USUA 1Q3TA 3EQ9A 4B9EA 3ZU3A 2I9PA 3WDSA 1IOWA 5AJZA 4B84A 4PX2A 3BXGA 2QUZA 3EXHB 1GDHA 3HE3A 3I9V1 4BFXA 4C6HA 4DYVA 2DSNA 4ND6A 5KDOA 2XZLA 1Y7IA 1A77A 1V4VA 2D5IA 5COAA 2IW1A 5DTJA 5JALA 4IX1A 5IDQA 2YDYA 3JPYA 3N8HA 2G9QA 121PA 3H18A 4F98A 2Q4DA 1EDOA 2XTJA 3WGNA 5HQJA 1KH1A 2CXXA 2WYHA 4ZVQA 3KELA 1SCBA 3TVYA 4KR2A 1EBUA 3AYZB 1SCAA 3W8EA 3IV6A 1EM8B 4RENA 3U61B 4HFNA 1JA1A 1NSYA 3EZLA 2YQZA 4A0QA 1UBUS 3R75A 1JAZA 2QYTA 3E27A 3P45A 3TIXB 3I2FA 1RZUA 2IIPA 5B1HA 4ZGWA 5HA5A 4BNHA 3BD7A 3QG1A 2M6LA 2IQIA 3HKBB 3LDGA 2XCSB 4D92A 1TGVA 2VJCA 2IWHA 4RH3A 3ZIAD 2J8ZA 2XLCA 3NIDB 4YJ3B 5HIKA 3EBOA 3TLMA 2E82A 5FI1B 4C4SA 4NJEB 2UZ4A 2VG8A 5CLFA 3FMFA 3EULA 1MVLA 3DAYA 2FPWA 2XCRB 5DF1A 5ICMA 5FOUA 1ZNYA 2NXJA 3NAMA 2IZ1A 3A6ZA 5J23A 4TTIA 4OIMA 3CU5A 4L3VA 3N3AC 5REQA 1E3EA 3C85A 3EASA 4MVJI 1FFDA 1Z5UA 2RHBA 3D3KA 2P5YA 3L8GA 3GCWA 4D2IA 4V2UA 1Y6FA 1QHSA 2I3GA 1T9DA 1T9CA 4IPTA 4B3MB 4PQRA 3UCFA 2DFKB 3KQSA 3W6OA 5DCWA 1V1RA 4PN3A 3SQMA 4X85A 2QZJA 3M49A 4TSFA 4YX9A 5A04A 6CHYA 4YXFA 2ISQA 5TEWA 4P98A 4JYZA 4ENPA 1LEHA 1FSGA 1MORA 1O4WA 2H2AA 4DZZA 3QKIA 3RT1A 4JLBA 1H4SA 3EGEA 4IILA 2WD7A 3PHHA 1DMRA 1NR7A 1C9KA 4J0GA 5JD5A 3DLHA 1T8TA 3MWEB 2J3KA 1CP2A 1WXGA 1C5KA 4UVDA 4WKBA 1EG2A 1MTOA 2DBRA 2WINI 3B12A 3OLWA 3OT1A 4JSTA 3SHFA 5JH7F 4M1KA 3RFXA 4EKNB 4ED9A 2WWFA 5HIJA 4FGUA 2MOKA 2ZJZA 5KQMA 3NYRA 3N0VA 1TT5A 1SFRA 3GGPA 5TVGA 3TIIA 3HXQA 1U4OA 1TDJA 2XGOA 5EMKA 4ALKA 2YIJA 3P9ZA 4J1NA 4MP3A 3RAGA 1ESZA 3EXFA 3KG2A 4UMVA 1FQJA 4C0XA 4I1VA 2ZWVA 1J22A 1E18A 5E3IA 1H9CA 3AG5A 4TKZA 2VJMB 3K31A 4HBGA 4RCZA 2GAFA 4ZVVA 3V2GA 1GA4A 1GPKA 4DPMA 5I3CA 4HYEA 3MM4A 3GGDA 3PGXA 5FWAA 5G41A 3I2YX 1KBQA 2B1QA 4QTUB 4HL6A 5FOSA 4LFAB 1Y6QA 5AOVA 3AB8A 5H68A 1G98A 1ZR4A 2WWWA 5C7YA 3RI3A 3TGLA 4UEKA 1HT3A 4NG5A 1BJTA 1P5FA 4DDWA 1M7HA 3SKXA 5JXHA 2H85A 2Z98A 3KHSA 2OV8A 4PRLA 1LPNA 4MWZA 2IYOA 1F2VA 1E20A 1L7XA 3TZ6A 4C30A 4ER0A 2SKCA 4I55F 3EGXB 1QGUA 3OFVA 4OI2A 1WETA 1HDRA 4QG7A 1DXQA 4OHFA 2OYCA 3DMNA 3EWAA 2FSVA 1EGQA 1HZJA 4L16A 3TQHA 3VPBA 3WYBA 1ORHA 1Y33E 2H1SA 5JO9A 4GOOD 1NN1A 1BEEA 4I4CA 1SUBA 1KS2A 2CF6A 2X58A 1WXDA 2RJNA 3C74A 1OLOA 2WWIA 3K9QO 3O47A 3S27A 5K6AA 3ZS8A 4INPA 4NH4A 2Y71A 3DKRA 2Z5FA 2G9NA 1Z4JA 3Q87B 4MMZB 5KIAA 1PLKA 4FHDA 1RU3A 2VLIA 2B37A 1I4DD 3KKZA 2O5CA 4LHSA 1QLJA 3IFSA 4PE5B 3ZDYB 3CZAA 4FI3F 2AHRA 3VZCA 3P5SA 1G20B 1XKQA 1C81A 2WTBA 3GCDA 3U4CA 1BHJA 4B7XA 4BEVA 4E46A 1TO2E 2HLNA 2C31A 2QN1A 3F3KA 3EJWA 2JGAA 2VZEA 1NR5A 2OR3A 4JKYA 3HV2A 4M60A 4FB5A 1Y8CA 3K32A 3ZHTA 1TJPB 2J5QA 4E5PA 4RK7A 1KEEB 2JBWA 3A4TA 5FTMA 4OUKX 4CQMB 1SKYB 4P4SB 4ZGBA 5KTPA 4KLAA 2ZQZA 1VE9A 2ZRNA 5A3SA 4YJ3F 1A9XB 4MS4A 3M6FA 1DDOA 3MGKA 4I50B 2RGYA 3UMRA 4D02A 4OV6B 3BTSA 2FFAA 5BWNA 1ZCZA 1EMDA 1X13A 2OBMA 3NHJA 1PJ2A 2E6UX 3BD6A 4BECA 1K06A 1D1PA 2Z58A 3GMSA 3IHTA 3ZX4A 2HWXA 1MXFA 1I1NA 4DHWA 3FSGD 4R83A 5HNKA 4RL6A 1NQUA 4M9XA 4ZHQB 1LBIA 5TNXA 2CLSA 4F92B 1P9WA 2FR8A 3NU1A 3LX8A 4GPEA 1IEWA 2JI7A 3WGLA 1QIIA 4AG5A 3KQWA 1CZRA 1LLDA 5AKYA 5F21A 1WD5A 3GEHA 5BQOA 4R69A 1X7HA 1AS3A 3FBGA 2Z83A 1EPUA 3GZTB 4LXUA 4LV5B 5IVPA