1INLA

Crystal structure of spermidine synthase from thermotoga maritima
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
295
structure length
285
Chain Sequence
RTLKELERELQPRQHLWYFEYYTGNNVGLFMKMNRVIYSGQSDIQRIDIFENPDLGVVFALDGITMTTEKDEFMYHEMLAHVPMFLHPNPKKVLIIGGGDGGTLREVLKHDSVEKAILCEVDGLVIEAARKYLKQTSCGFDDPRAEIVIANGAEYVRKFKNEFDVIIIDSLFTEEFYQACYDALKEDGVFSAETEDPFYDIGWFKLAYRRISKVFPITRVYLGFMTTYPSGMWSYTFASKGIDPIKDFDPEKVRKFNKELKYYNEEVHVASFALPNFVKKELGLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of spermidine synthase with a multisubstrate adduct inhibitor.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Spermidine synthase
total genus 91
structure length 285
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 1inlA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1inlA01
4OQDA 3GNLA 3PTAA 2ORED 3QOXA 1PRYA 3M4XA 3O7WA 4PYOA 2YQZA 5CVEA 5DT2A 3OPNA 3OZSA 2CMHA 3G89A 3P2IA 3TKYA 3BZBA 7MHTA 5DLYA 2PXCA 3R3HA 2NXEA 3HTXA 1XCLA 4P58A 3ELDA 2CL5A 2EJTA 5EEHA 4X63A 2FK7A 1Z3CA 3G2OA 2GS9A 5C0OE 4HTFB 3EGVA 4EKIA 4DF3A 3REOA 3FPEA 3PLAE 4FZVA 3FUWA 2AOXA 3UA3A 2XBMA 5HIIA 1B42A 3M33A 3U81A 3OFKA 1YF3A 3P2EA 4M38A 5LQCA 3GU3A 1WS6A 5CVJA 3HM2A 2BH2A 5E9WA 4G56A 3SMQA 3WSTA 2OZVA 2JH9A 4QTUB 1AQIA 3CJRA 2JG3A 2AOUA 1D2HA 4PYNA 4EVIA 1TPYA 4AUKA 3LCCA 5HFJA 2O0LA 1NW7A 3EVGA 3OFJA 5EHIA 2HTEA 1KHHA 3PX2A 5HOQA 3HCDA 4XUDA 5CCXA 5CVDA 4PIPA 5CVVA 3TFWA 1Q0TA 2Z6AA 4KIFA 4M36A 1VE3A 1VP9A 3R24A 4F85A 4RTNA 2Z6QA 1M0EA 2PX4A 1N7IA 2QRVB 2B3TA 3EVEA 5E2BA 4Z2YA 1SKMA 3FPGA 3FTCA 3PT9A 1DCTA 2PXAA 4R05A 2YXEA 4FSXA 2PXXA 5ICEA 3CJQA 1TW3A 4DQ0A 2EFJA 3B3GA 4PYMA 2WK1A 4GEKA 3MTIA 3RIEA 2PJDA 5ICGA 1P91A 1ZHFA 2B25A 3C3YA 5GM1A 1NV9A 5T6BA 9MHTA 3LL7A 3NDIA 1YUBA 5KYGA 2UYQA 5K09A 2HWKA 3UJAA 4YMGA 2PX8A 1EJ6A 2AN3A 5E1BA 2OO3A 2PV0A 3EMDA 3LPMA 1HMYA 3SVZA 1FBNA 3EVBA 3FUVA 5FTWA 3LBFA 3OU7A 5JUWA 3SX0A 3X0DA 4E2WA 4LWOA 5E1OA 4Y30A 2I62A 4KRGA 5H02A 4YMHA 4RWZA 4RVFA 2UYHA 3AWIA 2OB1A 3GJYA 4RVGA 1VLMA 1RJEA 1KPIA 4HC4A 5DRTA 3BXOA 3VC1A 2PGXA 3E8SA 4HRAA 4R8SA 3DXYA 3IEIA 4C03A 1BKYA 1N7JA 3CKKA 3SM3A 3FRHA 4PWYA 1HNNA 2BR3A 5DXJA 2IH2A 2PWYA 1KPGA 3FPJA 5E9JA 1XJ5A 1YFLA 1I1NA 2GA9A 2HNKA 5EOVA 4FGZA 1ZGAA 3I58A 5EMMA 5EIFA 2GH1A 3EGIA 1JQ3A 1SUIA 1NBIA 3TPZA 2P3OA 1H1DA 2ZW9A 2FYTA 3C3PA 2QE6A 1BC5A 1SQGA 1O54A 3OE5A 3OZRA 4R6WA 1JR4A 5EKXA 1JTEA 2IH4A 3UJ8A 4WXHA 2P3QA 1N2XA 3AXTA 3FRIA 2JHPA 2JH8A 4MHTA 1YZ3A 3KQSA 3GIWA 5LQKA 4GQBA 3LX6A 3G5TA 3AY0A 2A14A 1QZZA 3KR9A 2GPYA 1AF7A 5EC8A 1SVUA 5LQNA 3PVCA 1KIAA 2NYUA 3NJRA 3HCAA 4GUAA 3T0IA 3UJCA 3SGLA 3JWHA 1WG8A 4DM3A 3S68A 4KDCA 5FHQA 4RTLA 2PWPA 5FUBA 4E2XA 5GM2A 4PYKA 5GIPE 3O31A 5CVUA 2YXDA 3KPUA 4E33A 1IM8A 5EG5A 2ZBRA 3RW9A 3G2MA 1KPHA 1WXWA 5KS2A 3NVMB 3UZUA 4YUYA 5K0EA 3LBYA 1UFKA 2N47A 4QVKA 3GDHA 4YV1A 1R6AA 2WA2A 1U2ZA 3DULA 3GRRA 3HA3A 4P7GA 5E9QA 4DKJA 3ELYA 1KR5A 4RTQA 4GC9A 3SXJA 5B1SA 3DR5A 1JG4A 1RI3A 4AZSA 4V0RA 4H0NA 4E32A 3UJ9A 2PT9A 2O57A 5EVJA 2FCAA 2OB2A 1DL5A 1SG9A 3VSEA 1IY9A 5GP1A 4CKCA 1ORIA 5CCBA 5FADA 3PX3A 2OY0A 2ZWVA 2ZLBA 5DM2A 4AZVA 5K0JA 3A27A 2Z6UA 5E8JA 1JG1A 3IHTA 2E5WA 3LECA 2QRVA 3LDUA 3NW9A 4MWZA 4P7KA 5DSTA 4ATNA 3UJDA 5CM2Z 2ZZMA 3MAGA 1WXXA 4DA4A 4YUWA 3C6MA 3ELWA 3EVDA 3GXOA 3LDFA 3QV2A 3T7SA 3LKDA 2G8NA 4ER6A 3MCTA 2IP2A 4C08A 2IBSA 1G55A 3P8ZA 4ER5A 2IIPA 2B2CA 2AS0A 4MQ4A 1XVAA 1P1BA 2GB4A 5E2AA 3DMFA 2JHCA 1JG3A 2H1RA 1G8SA 3PS9A 5DM4A 3CCFA 5IKMA 4CXMA 2P41A 2P35A 1XTPA 2H00A 2BM9A 4BLVA 2I6GA 4U7PB 2GLUA 2O05A 2HMYB 1X1AA 3FYDA 4HGYA 4LWPA 5EEGA 5FHRA 3UJ6A 4DMGA 2QM3A 3SSMA 3SR4A 4EKGA 4CWAA 2UYCA 3G8AA 2ZIEA 2EX4A 1L1EA 1O9GA 4QVGA 5EMJA 5GWXA 3B7PA 3LCVB 3FUXA 4M7RA 2Y1WA 3UJBA 2AZTA 4IKPA 1NT2A 1AV6A 1JSXA 3BGVA 1X1DA 4RSRA 1D2GA 2AOUB 4QTTB 5ICFA 4EMSA 4RTSA 5G02A 3M6WA 1R18A 3EVZA 4RTJA 5LQUA 4RTKA 1MHTA 3TMAA 3HVJA 1T43A 2C7OA 4BLWA 4PYQA 1ORHA 4KIGA 1L9KA 2PX5A 4XUEA 5FWDA 1Q0SA 4GC5A 4YUVA 5FCDA 1NBHA 4OX9Y 3LKZA 4KWCA 3TM5A 5LR6A 5D1NA 1YFJA 2BR4A 3M6VA 2ONYA 2UYOA 4PCLA 5D1HA 2NP6A 3FUTA 4XCXA 5HZMA 3KQTA 3GO4A 4MIKA 1RJFA 3KPVA 1KYZA 3EVAA 3LDGA 4PGHA 3PB3A 5K0BA 2P7IA 4F84A 4ISCA 5EZSA 1WY7A 2OBFA 3MQ2A 3GRZA 3QOWA 2K4MA 2ZZKA 3TKAA 3ERCA 1I9GA 5GIOE 4PGGA 1EJ0A 3E7PA 5DM1A 1XDUA 4ZTBA 3BWYA 4RYLA 3OU2A 3DLIA 3SSOA 3KPJA 3P9NA 5FQOA 1EQAA 2AVNA 4A6DA 3B3FA 3LSTA 2C7QA 5BW4A 2O06A 2WA1A 2ZBQA 3T7RA 1AQJA 2FHPA 4KW7A 1JQDA 3R6TA 3P9KA 2EG5A 1VPTA 2QYOA 5DRYA 4AX8A 4RVHA 4PYLA 3ORHA 1NV8A 3A26A 4FT2A 5FA5A 4IV8A 5FULA 4C04A 3R0QA 5DM0A 2OXTA 2VDVE 3KQYA 1X19A 1ZGJA 3NDJA 4HTFA 2OYRA 4E2ZA 2YVLA 3VYWA 4EK9A 5K01A 4RTOA 3DXXA 5FA8A 4X41A 2XVMA 3BKWA 5HIMA 2HR1A 2PX2A 3B89A 2R3SA 2P1DA 1UIRA 3EEYA 2XVAA 2BM8A 3Q87B 5DX1A 3UJ7A 5KQSA 4R6XA 2VDUE 3HVHA 3DTNA 4QDJA 2P3LA 3FYCA 1FP1D 3PFHA 3G2PA 1NW3A 1R74A 4GBED 3TM4A 5K0FA 4R8RA 2IDJA 2G70A 3HP7A 5EGSA 3UFBA 1VP3A 4RTMA 5HEKA 2V7EA 1BHJA 1QAMA 3G8BA 1ZKDA 3K6RA 4YV0A 2PY6A 3NVKI 1M6EX 1FPQA 1FP2A 2OPBA 1QAOA 3FPFA 3E05A 4LG1A 5DPMA 4YV2A 3LGAA 4U7TB 1KP9A 4BP1A 3KQQA 3IV6A 3V8VA 2ZFUA 2AVDA 2ONZA 5EKUA 2PKWA 3DMHA 3HCCA 5DTMA 4LECA 1F3LA 5K0CA 3ELUA 3KKZA 2LD4A 2IH5A 3AJDA 3DH0A 3FTEA 2P40A 4DCMA 1VIDA 3DXZA 2PVCA 2NP7A 3KPWA 1VQ1A 3FTFA 2ZTHA 4NECA 5DTRA 1XDZA 5EMLA 1MJFA 4QPNA 1NKVA 2IFTA 4PYIA 10MHA 2ZZNA 4YUXA 1OR8A 3GWZA 2ERCA 2NNWB 4FR0A 4CKEA 2P8JA 1EG2A 3ME5A 2YTZA 3CVOA 3GCZA 5C9ZA 2AOVA 2ZVJA 2ZIFA 4KDRA 3MB5A 3KR0A 3OZTA 1XCJA 2PLWA 3EVFA 3AXSA 4HSGA 5GOZA 1SQFA 3OE4A 3RODA 5EIWA 2NXJA 3B3JA 1VL5A 3C6KA 4UOEA 5K0GA 2JJQA 3ER8A 4CTJA 2KW5A 3P9IA 2ZIGA 2O07A 3FPHA 5BP7A 2NXCA 5E1DA 5C1IA 5DTQA 5EHGA 3EGEA 5BW5A 3THSA 3VC2A 1G38A 1JSZA 2PT6A 2ESRA 2Y1XA 1RI1A 5LQAA 3DLCA 2YUIA 1YB2A 3TOSA 4K6MA 5E8RA 3LCUA 5U4XA 3MTEA 4EQZA 5LSAA 2G71A 1DUSA 3DUWA 3IYLW 3I53A 4RV9A 4V0QA 3BUSA 1RJDA 3EPPA 3HA5A 3P97A 2VDWA 2R6ZA 3UA4A 1P39A 5IH3A 2XYQA 4GOMD 4QPPA 5DX8A 3TRKA 1QYRA 1KYWA 4PYJA 1FJXA 3HCEA 4O29A 2YX1A 4FP9A 1ZQ9A 3CC8A 4P7FA 3HEMA 2ZWAA 2YR0A 3GRVA 3Q7EA 4CTKA 1RI5A 1R00A 3D2LA 1ZG3A 3KR2A 5E1MA 5DXAA 4JXJA 2AOTA 3ANXA 1QAQA 2BZGA 3GGDA 3CBGA 1INLA 4F86A 3G2QA 2I7CA 3EMBA 3P71T 3ER9A 2CWWA 2DULA 3BT7A 3BWCA 4PONA 3O4FA 3DMGA 1P1CA 3BWMA 2FPOA 3P9CA 2DPMA 1QANA 3HVIA 4QQNA 3EVCA 3G88A 3KPYA 3TLJA 3DP7A 5KVAA 3E23A 5DSXA 3C0KA 4PIMA 2XYVA 1WZNA 2B78A 2B9EA 2IBTA 2G1PA 1PJZA 5JR3A 3MHTA 2ZBPA 3PFGA 1L3BA 2G72A 2PSSA 2AN5A 2AN4A 3HA7A 4OA8A 4C06A 1KXZA 5EPEA 4POOA 3R9XB 1F38A 4RVDA 5CD1A 3BWBA 2GAFA 3OU6A 1TW2A 2VS1A 3HCBA 3OCJA 3EEOA 1SUSA 3NTVA 4ER0A 5HIKA 2FK8A 4GOLD 4IV0A 1X1CA 2VP3A 4BY9E 5T67A 1NW6A 3T7TA 4E30A 4E2YA 1RJGA 4L7VA 1NE2A 2P7HA 3SSNA 4AZWA 3P2KA 4X61A 4X60A 5CUQA 1YZHA 3KQPA 3G5LA 2AOWA 2BR5A 3THRA 3FZGA 5EZQA 3A25A 2AR0A 4HH4A 4HG2A 1D2CA 4C4AA 4WVLA 3FTDA 5K0NA 2IGTA 5ICCA 1M6YA 4PNEA 3CGGA 4FT4A 3ID6C 4RX1A 3A7DA 1BOOA 5LQRA 2XYRA 4FS8A 5K05A 2UZ4A 5M5BA 2QY6A 3NWEA 4A6EA 1R8XA 3HNRA 3CJTA 5FWAA 1UWVA 2NXNA 3I9FA 3KQOA 4OBWA 3I5UA 4BLUA 3NWBA 4M37A 3KHKA 4XUCA 1JQEA 1G6Q1 3UWPA 4DCGA 5GINE 4RTPA 3BKXA 2IPXA 5K0LA 1XXLA 5KQRA 4QDKA 2YXLA 3HVKA 3BGDA 3GRYA 8MHTA 2ZULA 2JHAA 3MERA 5MHTA 1G60A 3GRUA 3NMUF 5F2OA 5BXYA 4OQEA 4ER3A 2Q41A 3BGIA 5CIYA 4IWNA 1VBFA 1X1BA 4FSDA 5LQJA 4BP3A 3F4KA 3TQSA 2ZCJA 5T64A 2F8LA 4QQKA 3M6UA 1JG2A 1XDSA 1EAMA 1L3IA 1Y8CA 3K0BA 2EJUA 4OBXA 2PBFA 4CKBA 2CMGA 2H11A 4E70A 3KQWA 1EIZA 1R8YA 4GOND 4PINA 5K8VA 1L3CA 1V39A 4GF5A 4PCAA 5DWQA 4GOOD 1O9HA 2V74B 3I64A 4C07A 5F2KA 4RTRA 4P7JA 4Y2HA 3V97A 1NW5A 2FRXA 5HILA 1NW8A 4MTLA 1G8AA 3KR1A 5F2NA 5P8WA 3G7UA 3KU1A 3A7EA 3L8DA 4YUZA 5EQJB 4ER7A 3DOUA 4X1OA 2ZSUA 3HCFA 4E31A 3JWIA 2ADMA 5ERGB 3M6XA 5EMKA 3H2BA 3LHDA 2I9KA 3KQMA 1IXKA 4HGZA 2C7RA 3UBTA 3KQVA 1JTFA 4DZRA 3M70A 3TR6A 2AOTB 3B5IA 5DX0A 1I4WA 3MCZA 3JWJA 2HV9A 3MGGA 4KVZA 4C05A 5K03A 5HIJA 1RI4A 4OA5A 1RI2A 2C7PA 2VZ9A 2OKCA 3A4TA 4AZTA 4B17A 2CKDA 3JWGA 3FUUA 2IDKA 5FQNA
chains in the Genus database with same CATH superfamily
4ERNA 5DEIA 5IKOA 1G16A 5ITVA 2FXIA 4KDEA 3LP8A 4GS5A 4A10A 2YQZA 3AR2A 1AKYA 3D0OA 1R4NB 2DRIA 4MVYA 1G8JA 1YB4A 1PHPA 2G7ZA 2WE8A 3PSAA 3G1UA 5SICE 3SEAA 3VSDA 5DH9A 4C22A 2EJTA 4JFAA 3BRWA 3CH7A 3HKDB 2E4WA 4QYIB 5JQGB 1N3BA 4FOTA 1G4HA 4EKIA 1M5RA 4PYRA 4OD0A 1SA0B 3HKEB 3Q6IA 3SYRA 1C9EA 1P8AA 3J80A 4DLTA 2O54A 2CLSA 3P0JA 3RC3A 3OEYA 3AMVA 4DDUA 2DJIA 4KPUA 4MP3A 3ZDEA 2JKYA 4G85A 2E89A 1YJAA 2Y1LA 1LI4A 5FEMA 6CHYA 4EW2A 1O95D 2JG3A 1VBMA 4PLZA 2BGRA 4Y9SA 3RFTA 2AOUA 3W2IA 3Q1KA 1F2TA 2P2SA 3ASZA 4FD2A 4KRXA 3ZR4B 2ALJA 2I67A 1WPGA 3NS7A 4M46A 2B7CA 4J7XA 4V3BA 1YRBA 2WG2A 3CLHA 2HK7A 1JFRA 3HCDA 1AGXA 3MT8A 3X2EA 4QM6A 3SC4A 5G1NA 4NV0A 3ZXIA 1KYYA 5C51B 1P1IA 5CK5A 2Z6QA 3RBXA 2CBGA 2QTTA 4Q4HA 3WKBA 2QRVB 5HBGA 1M0EA 1KSHA 4PFJA 2BBWA 2YZGA 3QX7A 4MX8A 4FTWA 3ZE1B 1FDVA 2B1QA 5HS4A 1T2CA 4U00A 1G17A 2XZTA 1OKKA 2R1ZA 3OAAA 5AW6A 2YYAA 4BV9A 5JZVA 2XTJA 2YOGA 4TWIA 5GM1A 1SQSA 4QBFA 3L79A 2CLKB 4PNZA 1ML3A 3TOVA 3ADBA 4F4DA 3UJAA 3RAFC 2E6UX 3DVSX 2VAMA 1JNXX 3WZMA 2YYZA 1LK7A 4L2IA 1G5TA 5HF5A 4B2YA 1N5RA 1RAEA 2JFZA 3KB6A 5DNCA 3R5FA 4KFSA 4HNRA 2P9FA 3NTLA 4FN5A 1CF9A 3OQ6A 3FUVA 4DJTA 5IVIA 5CGZA 3WBKA 1HDCA 4GO1A 4MRPA 1G0OA 3NV7A 2FZVA 2QM7A 4KDFA 5D84A 1L4BA 1KC3A 2YQ4A 4RM2A 1KDVA 1NN3A 2UAGA 4TS4A 2R4UA 4OIMA 3KKPA 2ETXA 2FN9A 1RJEA 4RVGA 5I4IA 3U19A 2GRJA 4C0SA 1AH2A 1GNLA 2D1RA 3E8SA 4R8SA 3ICCA 3DNPA 3TWOA 3ZBQA 3T7AA 1RQXA 1BKYA 2P1ZA 3H9EO 3NHFA 1XDDA 4QUJA 3SM3A 4C3ZA 1R6BX 1O5OA 2E18A 2QLTA 3DDSA 4H4DA 4NJMB 4BL5A 4WHMA 2DP4E 3NOXA 2FFHA 2GA9A 1MORA 2A8YA 1SOVA 4JJIA 3UEOA 4DEYA 1VE1A 3EASA 5CMLA 3L0PA 4DUYB 1I1OA 3NBFA 4LTDA 4LZPA 3HS3A 3U09A 4K9RA 2OHXA 4PVDA 3O0DA 3WZLA 1XKLA 2IXFA 4GLFA 1XYGA 1F0NA 1RHMA 4X97A 2GPBA 4R2KA 3E9NA 4FIZA 4IZIA 4Q4JB 2P3QA 4J94A 1M2HA 1P80A 4NH4A 3UKDA 3A0RB 2YW2A 2Q99A 5ENVA 1SNYA 1HOTA 1IXSB 2YY5A 2O6HA 3CLRC 5DHTA 1GCGA 3USES 3VR5A 3ICVA 1A9SA 3FPSA 5ADUS 1WXDA 1VLHA 1XMOB 2FHSA 3F5MA 2GPYA 2IZ5A 4BEVA 5DNUA 1COZA 2A1IA 2C31A 2KI5A 1ENOA 2OPHA 3WL7A 3GLGE 1ODLA 1ZD9A 2A0XA 3ANYB 5ESWA 5DX8A 4QLAA 2JLVA 1I80A 4KDCA 4FKZA 4V2IA 3UUGA 2YJ3A 4W1PA 3KIPA 4C0WA 3QSYA 3EWAA 1JFVA 1H23A 4E2XA 3R40A 5I7FA 3AHFA 3CUVA 1W73A 4MI6A 5EZ5A 2H3HA 2I03A 1F3OA 5FPSA 2FRDA 4IMJB 2H16A 1DHTA 3RUCA 2HSJA 3D0QA 4D9HA 4AMZA 4ZHSA 1I32A 4K9SA 3VOTA 1WHTB 3ELYA 4LOIA 5F12A 4X64B 4GC9A 4ZEVA 3I5MA 4POAA 1G5IA 1SVSA 2AK3A 3HJAA 4OM8A 3OH8A 2HLHA 2VXOA 3DSRA 5DV9A 1LJ8A 3HMKA 3BH6A 1E3WA 3L1HA 3PCXA 4F4FA 4YRKA 1CBUA 2OXRA 2W11A 1KEVA 3E8XA 4MCAA 2GSWA 1EU1A 3AT1A 5ECGC 4DABA 7YASA 5IT0A 1ODCA 3ZCXA 3U6BA 2ZROA 2P6NA 3ST7A 1XTTA 2INGX 4Q1VA 4W82A 3SP1A 2GTIA 4G37A 4EUKA 4FWTA 3HYLA 3OCVA 4UDXX 4Z7QB 4JL5A 1CK4A 4BZWA 2Z1DA 2P62A 4KU4A 3BF8A 4WFJA 1NBMD 1FLNA 3TLCA 3QG1A 2VRBA 5AW5A 1I8TA 5SYAA 3VYVA 4K6FA 5JS2A 1V3UA 2EL9A 9ATCA 3BULA 2XKKA 1KNQA 1P1BA 2GB4A 4Y9TA 2EGGA 2MMGA 4JSRA 4L5YA 4TMTA 1N2GA 4G41A 3RFFA 1A7UA 3O38A 3PK0A 2GBGA 1QRSA 4DZTA 1CJUC 3NRCA 3PHIA 3QF4B 1TT5B 4G0XA 4DSAA 2WNIA 4XDZA 2QM3A 2HLDA 2XDYA 3G8AA 4JEIA 2XBMA 2V58A 3LTNC 1E99A 3BWDD 2WFMA 2IPOA 1N9KA 3RR2A 4WBNF 5KNDA 3GLFA 4WXMA 2W6ID 4LXIA 4PW0A 5DN6A 1DRVA 3S40A 5I9TA 3WWZA 2O2CA 5BNWA 1CVRA 3B1XA 3W9SA 4CLOA 1MA3A 3GLQA 3G2IA 2R7NA 1E6KA 4QTZA 3HZZA 4ARIA 5E6SB 4P31A 4CQLB 1DMRA 3RS8A 2E21A 2ODNA 3OKCA 1U2DA 1OIVA 2Q8NA 4GC5A 4FM9A 3F9IA 1AO3A 2P9TA 5TV2A 1D6SA 2H7CA 4N0EA 5FBRB 3DBHB 1PJTA 2XIQA 2R60A 3H5LA 5FTNA 4XCXA 1MT0A 3GO4A 3LDGA 4LJ4A 3KYIB 4HXGA 4MGHA 3V3TA 1D9XA 1HG1A 3KEQA 3N8IA 2YS7A 3AEKB 4ISCA 1NVUQ 4HPWA 1Z4MA 2I7XA 2OR3A 3GLKA 3O1JC 1TEZA 1E5QA 2GBCA 2AFHE 1L8QA 5GIOE 4KR2A 1B6SA 1HMPA 5HYVA 1RRVA 1BS1A 3BB3A 2GD2A 4FMDB 4LGYA 5JFGA 2WJYA 1NZJA 3HLTA 4J7UA 4UFOA 1AURA 3LC0A 1WDKA 4QOFA 1OLXA 4J1TA 2NO9A 2XBLA 1PW7A 3M9LA 2N3ZA 3LIPA 5F9FA 2XRMA 1K7XB 4BGEA 4FEGA 4JB3A 3OSZA 1ML4A 1P5HA 3R6TA 4PE5B 1VPTA 4JX9A 2ZJ8A 3S70A 5CA1F 4ND8B 4YNBA 2VRCD 4HDMA 3JARB 3MJHA 2MSDB 3ORHA 4XQGA 4QJBA 1U9IA 5GV8A 1IFXA 2A86A 5DM0A 1LFAA 1C0KA 4TTPA 3DCYA 5IHXA 3UGQA 2D2XA 4RK4A 4MPJA 4ON9A 5IFKA 3F4LA 3K0CC 1L7AA 3QU5A 3F46A 3JQBA 3WNQA 4V02A 1N1EA 5A5DA 1Y37A 2CNOA 3BF7A 1OGJA 2H0AA 5FUWA 2WYUA 3MYYA 5K0FA 2OCYC 1BWSA 1SQ5A 5I3CA 3P2OA 3A4VA 1N75A 3RROA 1RJ9B 1N2HA 4YO7A 4YCJA 5C1DA 3RKRA 4KLNA 2LUOA 3G0CA 2BFBA 3BHJA 3PEEA 1ZKDA 1U0BB 5IKEA 1GXSA 3AUUA 3OLXA 4MYHA 4MW6A 2P8SA 4X24A 2I4NA 3KQQA 3H1PA 2HDNB 4LHVA 1J1IA 4GMKA 1J5EB 4D4GA 2WF6A 3JQAB 2OQ2A 3Q3EA 2BD0A 2FFRA 3AJDA 1OD6A 1ZCBA 3B70A 3HZOA 1R0WA 1HQYE 5J47A 1LQ2A 1USGA 2Z3ZA 3NBQA 4XLTA 3FTFA 4B84A 3L5KA 5EMLA 4B6OA 2XDQB 4Q01A 3CLRD 4MV3A 3S2ZA 2PX0A 1I2MA 4QPNA 1VECA 1JAIA 2OAEA 3GA0A 3ZHQA 2O50A 4RK1A 3OZEA 1GGMA 4UTXA 3W3AH 4OXNA 3E7WA 4D9KA 1PLKA 1ILWA 1KJWA 1Z08A 1THTA 4INAA 3FVRA 2P8JA 2B4TO 2YH2A 3NIGB 2YTZA 4B3BA 5IF3A 3PCTA 2HZBA 2RKOA 4KDRA 1JRLA 4BMVA 3HXKA 3OEHA 3E9QA 1QG0A 1WEKA 3DM9B 3RODA 4Q7QA 1TD9A 2DAPA 4DILA 4WA8A 3AIMA 2NSJA 2ZUFA 1ABFA 3M4ZA 4BXOB 1NQOA 1RBYA 2KW5A 4M1YA 3D9QX 4TYWA 3JATA 4GPBA 1SHJA 2G5PA 2YJZA 4WZ6A 4QU9A 1SXGA 3P94A 3MMSA 1GY8A 5DZSA 2YXNA 3EQZA 3F73A 4PHHA 1CE8B 5AM2A 1OZAA 1LDGA 3ZGZA 3GZNA 3PA6A 1REQB 4B0OA 2QYTA 4MUGA 3TL6A 4HL6A 3GGSA 4PS1A 3IDZA 4LAFA 4P93A 4K0RA 2B30A 1MC4A 4H27A 1YS9A 2FEKA 2QENA 2W6ZA 5GZ6A 3BGSA 3ILSA 4ZXFA 4AUMA 2Z58A 2MWMA 5IJ0A 4B3SB 3MTJA 5AVUA 4MUJA 2IK8A 3O1IC 3UQYS 2VJMA 2ZSIA 2ADFA 1LLCA 3W2TA 3H9GA 2VA9A 3D1JA 3SVLA 1H5QA 1H22A 3KR2A 1FYWA 4H9KA 1T4CB 1GNSA 1R5BA 2BWJA 3E9ZA 1GOTA 3G8CA 2DPXA 4I1IA 5E38A 2YXBA 1AKVA 1NVTA 2C4NA 4R1TA 3PC3A 1KBQA 4PONA 3NUQA 1JDJA 1O97C 1I6MA 2FI1A 2ZYUX 1QANA 3P9CA 5CXSA 5KI6A 4E0BA 5AYVA 2A9VA 2GZ3A 3H84A 3R3WA 4QUAA 4EJMA 1RXWA 2EBWA 3BFPA 4KIJA 1U7PA 3COZA 3ZYCA 3G49A 3N70A 3BG5A 5LYJA 1R6XA 2RK3A 1E4YA 1GCAA 2DG2A 3CUUA 4NBSA 4A26A 1CUIA 4ZREA 1YU9A 3G5AA 1N92A 1U94A 2WOJA 2OSBA 4Q7JB 2PD6A 2JFYA 4J4TA 3GZ4A 3PFGA 4UCQA 5EI5A 1FYDA 4G0PA 3JVVA 4IJWA 3ZIAA 2WVJA 3P9RA 5EPEA 3F3KA 4LDZA 3UHPA 2VDJA 3QU7A 4ASUA 3A10A 1JVNA 4UD2A 3DHVA 3FWNA 1NMEA 4I5FA 3NTVA 2WG1A 5JMWA 1MQSA 1NF8A 2X3UA 4YO8A 1T8TA 1X1CA 2V1UA 1XDBA 2C1EA 1AUQA 3UAWA 1WW8A 3TRFA 3MPOA 4E30A 1ZDMA 2B9VA 4HGRA 4GI3A 2BSXA 1GTMA 5E3JA 3TBKA 1VXRA 1XXHB 4AMBA 5KSYA 3NOOA 5JDIC 1YQEA 2XE8A 2CFSA 3R76A 3R7FA 3WGHA 4MVJH 4CIDA 5KTKA 2QD3A 2BR5A 4LN1A 3PGXA 1ZY2A 3VNUA 1YKSA 4RDIA 3A25A 2X5KO 2ZQZA 4RNDB 2WWWA 3CVWA 1CVLA 2AR7A 1P0QA 1UBMS 3M6MD 1II9A 3N0VA 3M5CA 2A94A 3C70A 2IC5A 1W88B 4B6QA 4A15A 2YQ5A 2FZCA 3K30A 2F1JA 4QSMA 3ZFRA 4Y1FA 4P0PB 3I01M 1JDPA 4GSLA 2HU5A 2DZDA 4GX0A 4HQFA 3WNCA 4F4JA 1WIWA 2D62A 2WNHA 2Z09A 1IOZA 3N8NA 3SC2A 1O96A 2RH9B 5ALRA 3HXOA 1ZBDA 1Z45A 1TCBA 1ZS9A 2AQ8A 4DCGA 4GRDA 3DNMA 1SM4A 1DELA 2H4JA 2BGTA 1WBBA 4M4SA 4D8YA 3QLEA 1H4QA 4DYVA 1NBOA 2QD4A 4IDCA 4BO3A 4ZYVA 3AL2A 3GJ0A 3HVKA 3NFRA 2DUUA 3FB4A 4U2CA 2F90A 3PDHA 1Y3HA 3DE7X 1YGPA 3PXXA 1ZIXA 2OQRA 2V0GA 3CZ9A 1N36B 2Q41A 5I6DA 1O03A 2V7WA 2FPPA 2IE0A 2JA2A 3B20A 2PMWB 1RC8A 4JOCA 3M6UA 3UK6A 2UU9B 1ANKA 4A23A 1DIRA 1LDBA 1H0HA 4QOEA 5JH7B 1TMKA 3HCRA 1P2BA 4J90A 1U8XX 4LOKA 4LXYA 4B2PA 5K8JB 3O21A 2AEMA 4CKBA 4X20B 2H11A 4XQCA 2D74A 2ODQA 4LDQA 5CTJA 3ZE8A 2Q7XA 2Q5LA 3EH1A 3KUUA 4IOMA 2XNCA 4RMNA 5ALYA 5IJ9B 4ZCRA 2CUTA 1RXEA 4OVKA 2X9GA 5GJCA 1FMCA 5JALA 2VPZA 4EMBA 5AUPB 2YUTA 4HAUA 1FEZA 1GG9A 1OAOA 4LUCA 1NI4A 1IG0A 5B2FA 2RHBA 2VDWB 2RH5A 1GNQA 1AJEA 1U1GA 1C81A 2ZSUA 4JU8A 3DV9A 2GNOA 4JJFA 3JXEA 4LMBA 1OI2A 3AF0A 3BRQA 4UAGA 5JH7F 1C9KA 4HQ6A 2CVHA 4G0ZA 2I2WA 1XTKA 3BDIA 4G4JA 3UBTA 1JAYA 2VHQA 4DZRA 1X1EA 4NCIA 5IKPA 1TUBB 1YVEI 3K53A 2XVXA 1CB7A 1D0VA 2HV9A 2M1ZA 5L4SA 5F3WB 1J0EA 1Y7LA 3DHYA 4UKDA 5HIJA 1RI4A 4DR1B 2BHSA 1A5AB 4II2A 1KI3A 3DVAB 3QW4B 1U5BB 3QFCA 2XGOA 5JAZA 2F67A 3DE5X 3K70C 1XPJA 1KK0A 3N6VA 5I7WA 4XQ0A 2DTDA 4WNAA 4QXQA 4URXR 3VC7A 3L6OO 4HQRA 4F45A 2EEZA 4HAIA 1XZEA 3NVDA 1P2TA 3BRCA 4JDUA 3N5CA 2QWXA 3OETA 4YB8A 1MO5A 4LISA 3REOA 5KNDD 2Z1MA 1A4UA 2W8ZA 3ND7A 4FZVA 4KR0A 3PLAE 3SEQA 4LSZA 2O8VA 4TYNA 3OOWA 1VHJA 3HR7A 4BCDA 4NXMB 2EKPA 5IC4A 1YV9A 3IAS1 3P0FA 2OZEA 2QX4A 4NCJA 1DB3A 4RXUA 5SYNA 3B5EA 3U7EB 2LE0A 1TCCA 4G5SA 4IMRA 2H1SA 1DXYA 4ZEXA 3SVTA 2JLUA 2KBFA 3RS4A 2JH9A 4AY3A 4GL4A 5CFOA 1MTOA 1I4OA 1TPYA 3M49A 3DFFA 3TVTA 3H86A 1QTRA 3EQ7A 4Q18A 1JXAA 2QF7A 3WTCA 4CV3A 5EHIA 5IJAA 3CVXA 4BC1A 2PU5A 4WJKB 1Q0TA 4XPIB 4PIPA 3TFWA 4DIBA 4F04A 5CDUA 1IN4A 5AJVB 1VE3A 1E2QA 1X74A 3QQ5A 1JFLA 3EX7C 3C1TA 1PR4A 5KAPA 2CXSA 2MCFA 2IYEA 4KQ2A 4J75A 1N33B 3CJQA 3EH2A 2DYKA 3KQUA 2J0SA 4Z4FA 5EE5B 2H08A 2GRUA 2WJPA 1AKNA 1YULA 3R0IA 1FNSA 2ZTLA 3AIOA 4AZ0B 2I54A 9MHTA 2QEQA 1J9GA 3AHDA 2RI0A 3UCFA 3QWHA 1QOQB 4KHPB 3QOYA 3RWBA 2G25A 1T3GA 1ZOOA 2AN3A 2JZOA 3AFOA 3BL8A 3PQ5A 3EMDA 3IEPA 1P75A 1S3FA 3KUCA 3MINA 4FFSA 5I7HA 2OBNA 3WV4A 5AKXA 5BYAA 3C5VA 4XSHA 4UOQA 3JTEA 3SX0A 4NE9A 3PFIA 4RPKA 1QCYA 2I62A 2OM2A 3JVUA 4Y30A 5ECYA 1V5EA 1Q91A 1SR8A 2ETVA 2HGSA 1SKUA 2J85A 2ZJ2A 3AWIA 1MEJA 2GJ8A 1SPXA 3IPRA 3K6KA 4XLZA 4PWZA 3S2FA 5BSHA 3GP3A 2QRQA 4CEIA 4IJQA 1T5SA 3QE4A 4C3OB 4FHCA 1XCGB 2KBEA 2XAAA 1JA1A 2HF7A 1UQTA 4Q9LA 5G4KB 5TNXA 2ODPA 5KREA 1XD2A 1EX9A 5CM9C 1BA3A 3G9ZA 3HJNA 3U40A 1XAJA 5BSGA 4CFZA 3FMPB 4XFKA 1RM5A 2JI8A 5HKBA 4TLEA 4AS2A 4QRDA 1YUMA 2RCYA 5DULA 2FAXA 5HQTA 3JQPA 4K88A 2L19A 4PC1A 2A1UB 5CW2A 5I5EA 3RRXA 1O54A 3UJNA 2EIHA 2JA1A 3C3BA 2XGJA 2C82A 1EAYA 1KZ6A 2QZSA 4M7WA 1Z6TA 4Y0AA 2GEJA 1OLUB 3SBEA 3ETEA 4BNLA 3C41J 3JYLA 4JQYA 3W5DA 1YZ3A 3SXUA 5TF4A 5LQKA 2RGCA 1GUZA 3A2MA 5F1YA 1P7WA 1T0BA 1Z4KA 3PL5A 4G0MA 2ILVA 4WIAA 3WTBA 3KJNA 3UMJA 1YC5A 3N6RA 1XCPA 1OASA 3CTPA 4AROA 3CF6R 3K92A 4HNUA 5JLJA 1KEEA 5J63A 1ZGBA 5FFFA 4XWYA 3AEUA 4ZOLF 5IARA 1OZ0A 2VUSA 3BL5A 3AEXA 3TL2A 4DC0A 3VV2A 2PZ8A 1CRWG 1KP2A 1KQGA 3UTDA 3F8SA 3A04A 2NUBA 3EEFA 2YXDA 4ENRA 1NQTA 2GBPA 3VAYA 4XWOA 1E1DA 4HAZA 4GAEA 4BJ3A 4JLMA 5ALGA 3V8QA 1GL9B 2FZLA 5K0EA 1V8OA 3DP9A 3E3AA 2QG4A 3O4GA 4QVKA 5A5VA 3I23A 1E77A 1KI6B 3IAHA 4UREA 2QS9A 4ES6A 4L8GA 4HFNA 4NOLA 5DBEX 3GB9A 1UDRA 4ZDKA 2DLDA 1AHHA 3GRPA 2J5RA 1PZXA 1KZGB 2ENWA 4ZVPA 1KBZA 1T1SA 2DPGA 5TQ0B 1DXOA 3STUA 2R2AA 4ECAA 1FLDA 5GP1A 2VQSA 4HVCA 4Z9BA 2WWVD 3WYCA 1HDEA 3KOYA 5CX1A 2XUQA 3FNGA 3LC1O 1R0XA 2D2FA 4LHXA 4MP6A 4B87A 4GM1A 5JWOA 5K0JA 4FWIB 1Y4AE 4JZYA 3K71B 2XQJA 1BAPA 1ZYUA 2RAPA 3NOVA 2G88A 5JZOA 1A4IA 2ZE5A 1EP1B 3FTNA 3H2ZA 1NSTA 4E08A 4DA4A 3BCHA 2HQSA 4Y1RA 1ZJYA 4AN0A 3ELWA 3SU8A 3T7SA 3GL9A 3ZFNA 1F0KA 1VGRA 2WKSA 1DWQA 3DE4X 3QELB 5NULA 2I71A 4C76A 1LEHA 1ODFA 5EQFA 2UXBB 2WD8A 2AS0A 2RAFA 4RHUA 1TO6A 5BQXA 2O8CA 2NNLD 3IDOA 3OMXA 3CCFA 2Z3WA 3HJBA 4Z0HO 3RK0A 1JSRA 3HUEA 1P18A 2A0YA 3RHFA 2I2DA 5C53B 3FYDA 2PUEA 1E79A 3BXXA 2X4LA 2QUBA 3DTVB 3I3SR 4LSWA 5FHRA 2DMRA 4IJ6A 1E59A 5EA2A 4ZYLA 1FFWA 1TZBA 2JBAA 1TE2A 2JD1A 1OW3B 3IEXA 4NYJQ 2PJUA 5EMJA 3LCVB 5EWJA 2BMWA 3ZS9A 5B36A 3DE6X 1H05A 1ATZA 2GNAA 1Y1TA 3G9TA 3H2HA 3P26A 4D6YA 5A9RA 1FTSA 4C43A 1QE5A 3LT4A 1SBNE 4H2DA 5IPFA 5A62A 2A9JA 2C04A 4BB9A 1GTL1 1BN6A 3LLVA 3MMPA 5B1DA 4A03A 1IN8A 1HL7A 4DG5A 4U63A 1KIFA 1VKNA 3GLHE 2XGMA 4NICA 5THXA 3QITA 2J7KA 4TOIA 2ZRIA 3CNEA 5NLLA 5EYPA 4BNKA 5A5EA 3AC0A 1Z0SA 1DV1A 1UBKS 4AZ3B 1SB8A 4I2VA 4RCVA 3IA7A 3BHNA 2HXSA 3HBFA 2J48A 4EA6A 5JSFA 1L4MA 1UZMA 4PCLA 5IX8A 4CEIB 1DRWA 3IT0A 4PGHA 5K0BA 3BMOB 1B3RA 3PB3A 2AFHB 4F84A 2XITA 1AZWA 1JJAA 5EJ2A 4OLBA 3VNAA 3R74A 1U2PA 3MQ2A 3H97A 4HAVA 1ORWA 2HK6A 1YONA 5JQGF 4KO3S 1MJNA 4OGLA 3AP1A 4B4OA 4K9KA 2B5WA 3RAPR 5B3LA 2BUAA 4XM1A 4N3GA 4O4IB 5REQA 4DJJA 2I9PA 4KRFA 4RHFA 4AJHA 4P92A 2G82A 3GBVA 4WBXC 4R8LA 4RF2A 4MITA 2PS0A 4KQCA 5A6SA 3JVEA 2LDXA 1EP9A 2Z8YA 1Q1NA 2DQZA 3AI3A 3C4JA 4U2FA 5EXXA 5SYMA 5LJIA 4U7WA 3WK5A 5FNZA 5K01A 1JHRA 3L8EA 2C3PA 1Z5WA 1E7YA 4J0QA 4DCNA 2P9BA 5UKDA 1IBKB 2C4MA 3EG9B 4XM2A 3CZMA 1L5VA 3HDGA 4G5FA 3SN6A 3V7UA 3HVHA 1P5RA 2FJPA 2BY4A 4IINA 2E48A 1YO6A 2HWWA 4WZBB 3W05A 4JC4A 5ABPA 3PFHA 3SFVA 3MT0A 1YSCA 5DBGA 3RC2A 2NUPB 3QWIA 1W4AA 1EDBA 1L5MA 1XQWA 3CS3A 4AF7A 3I42A 4IF6A 5TGDA 3VFDA 1QQAA 1E2UA 4CQMA 1SXIA 4U8HA 3TIGA 4BLRA 4J0CA 5JS7A 5HF9A 3OQ1A 3VR4H 3U56A 1P9NA 2WTXA 2ZYDA 3MS4A 3AFMA 2JLBA 5DBFA 1UJBA 4J0JA 2FMFA 2QPTA 3SHOA 1U5AA 3KB8A 2QTAA 3ZVNA 1AV6A 4GI2A 3WR5A 3HRHA 3R2JA 1G63A 3KFXA 3TOZA 3LGAA 4AYXA 1KP9A 4B74A 4BLWA 4U7FA 3AU8A 3TK1A 3TTXA 1G9XA 2CXUA 3CIFA 4WDRA 1LPBB 4DMHA 3B6ZA 1Z5OA 4GZ3A 3ROGA 1Z56C 1ZA1A 3VZCA 3LI2A 2RK6A 1KJYA 3A9RA 3EGXB 1QYXA 5I9MA 5JATA 1QH8A 3EEQA 4F11A 2GXAA 2IUFA 2QZJA 5CFQA 1TU3A 3TXXA 1NPYA 1TIKA 3ZFUA 2OFXA 1M6NA 2WAAA 3QKSA 3VPXA 2J5XA 2AKYA 2XMGA 2FJ0A 3GWZA 3VKGA 2GO7A 2SKDA 4M9QA 5DLQC 3R23A 4FZJA 4DIOA 5C8YB 3KFVA 3OQBA 3ME5A 4ZI5A 2XXBA 3U4MA 2IS4A 4PG7A 1PIWA 3FGPA 3GUCA 4QYMA 1X7HA 4R9UC 2GCOA 2J5QA 5AIAA 3INRA 1BMFA 5CNMA 4P3OA 3EC1A 3I6BA 4HAWA 4O6VA 3CONA 4YP7A 3QF4A 3FPHA 4NVRA 2QTHA 2TS1A 5BW5A 2R44A 1FS4A 2ECQA 1X2EA 3T06B 5F7JA 4CKWA 5LM3A 1YB2A 4JH0A 2A92A 1JHMA 1WSDA 3K0AB 3MTEA 4HWTA 1Z2EA 5BQ3A 1R0RE 3WICA 2IYRA 4M0DA 5FWNA 2BRUC 2YV3A 3MWFA 4CMEA 4Y0VA 1EA5A 2B1GA 1MX3A 3AY3A 3FBTA 4I81A 5E7JA 2FZ4A 2EJCA 1NPDA 1J9ZA 2GAJA 3EIUA 3LNTA 2FPUA 5E4TA 2JFFA 5HZHA 5MN5A 2JAXA 2IKQA 1WEHA 3LUAA 5I9BA 1PWEA 4N5LA 1T25A 4DNOA 4O29A 1ZESA 1A95A 3JAKA 4UASA 4BNUA 5JJKA 1Y1KE 1KY2A 1ZK4A 1DX6A 2XUDA 3IRVA 3V8BA 1MG5A 3AUYA 4H08A 2OILA 2CL6X 2OCBA 1YMUA 2VLBA 1CXZA 3U4AA 3ZBTA 2WG0A 2VA8A 1XRRA 1ZJJA 3M6AA 1JILA 3RSHA 1TADA 3VH4A 1NXTA 3I2HA 2JLXA 4RIGA 3CNHA 1ESNA 5DHAA 1QTIA 3BWCA 3MJRA 4PAGA 3BWMA 1IAVA 1QGUA 4RKRA 3AOEC 3GJTA 3OE7A 3OPMA 5G1OA 7REQB 3D6NB 1CW2B 1U6KA 4ZCPA 1DT5A 2AEEA 3WLOA 4PIMA 3RREA 1RKBA 4U9IS 2ANCA 1AU9A 4S35A 4YH1A 3ROQA 4YRSA 2D6FA 3BMQB 2P9QA 1RTKA 1USVA 1JIKA 3P2YA 3Q9LA 1Y9JA 4K9OA 4ZYZA 1W8IA 1YKGA 2Q49A 2B1JA 4FMDF 3QY0A 3GJ4A 1TLFA 4AXBA 8ADHA 4ZYXA 5I7SA 1QNFA 4HK4A 2PUBA 1JKFA 1JJVA 2R7AA 1VYHA 2IHTA 3Q8WA 4OHMA 4B8YA 5KPJA 2H63A 1XQ9A 3TI9A 2PTHA 5F3RA 1EXVA 3NP9A 4TGLA 1U63A 4XX0B 3U4HA 1DEHA 2P7HA 5CLFA 1IWOA 5I01A 1Y4SA 3O8RA 2AEFA 2AOWA 1RCFA 4AG5A 2QUIA 4YRCA 5EWLA 4YRPA 1FTNA 1LTQA 5KYVA 2C7BA 1VHWA 1EDEA 2IRWA 3HC7A 4TQGA 1E5XA 1A9OA 2XODA 3HKBB 4YQYA 2YHAA 1KMMA 4HEHA 4XFJA 2IGTA 4BMDA 4KXNA 2FEPA 3IULA 4FT4A 2NZ2A 2FXVA 4MV5A 3K9GA 2WP0A 1RNLA 4PQGA 4IUCS 2Q3DA 3RHTA 4QYWA 1G8FA 3T9CA 3CB2A 1F9AA 1QR6A 1UP4A 4LK3A 5TEVA 2ACVA 2J9ZB 2V6GA 4GD3Q 1UWVA 3BE5A 4PO8A 1DLJA 1HDIA 2H2GA 1QP8A 2OM6A 4H7JA 1JJBA 3NWBA 2FWNA 2JFPA 2EFHB 3JALA 2JEZA 1C0EA 1Q16A 3L6CA 1ZSVA 4OO3A 2X42A 3C98A 1W36B 3LO8A 3K0AA 4NAVA 3O47A 1QFXA 3KYDB 1S2MA 3I9V6 3KD2A 2JHAA 4JL8A 5BV2P 2B98A 1J9EA 4S0XA 2FEXA 2TECE 3TDKA 1T5LA 5EJ4A 1OBCA 1A9XB 1VYUA 3E9RA 1VBFA 1DO8A 4GSYA 1SCUA 1GADO 1RQLA 2ZAGA 4HEQA 4X84A 5T3UA 2F3PA 4QEDA 2ZB4A 2XCIA 2A35A 3FKQA 3FUCA 4IWYA 1BG6A 3KCQA 5SV2A 4G97A 4BGIA 3BBPA 2JGDB 3K20A 3C43A 4WZAE 4I1VA 4LXXA 4WEQA 1E98A 4WOKA 3JX9A 4RANA 5CJJA 4ALKA 2E5LB 1BVHA 2RGXA 1UAGA 1HDOA 4PCVA 4G4IA 5F2KA 3L4BA 3ABOB 3V32A 1DT3A 1JU9A 4MV9A 4XM0A 1J07A 5DFAA 1MOSA 3UFXA 4CMCA 4MVJD 3KQKA 4LNUB 2QI9F 1LRLA 2XYGA 3OMWA 2NO0A 4HPJB 2FMIA 4R98A 3ED1A 5GTDA 1PP4A 1G3RA 3DBIA 1K8YB 5DGHA 5FOTA 3TCXB 5DYNA 3CW8X 1JI0A 1PT5A 1QHSA 2V0NA 1BN7A 4MKRA 1FB5A 2QTRA 4EB6B 5BOVA 4UEOA 2FEAA 2Q50A 3ZV6A 4BIIA 3O4HA 1PR0A 5SZKB 2C7RA 1DAGA 1NMYA 3FJ1A 1G9SA 2EZ8A 3B5IA 1M7HA 4BUJA 4ZFNA 1CDZA 3LUPA 3K9CA 2Y0BA 1PJRA 4BB5A 3GMDA 1XA0A 1YR1A 2CW5A 1AGRA 1CHDA 2R4TA 3N2LA 2E5FA 1TM7E 3J81k 2CKDA 2O3RA 3WDSA 2AA3A 1KDRA 3GNLA 1SEPA 2WUGA 3VGPA 1DARA 2ORED 4P4GA 3FNIA 3A3YA 3NPMA 4MVXA 4PYOA 4EJ2A 2FX5A 3ZWKA 4D99A 1U0NA 4WLNA 4LCBA 5JAQA 3VR6A 1O94C 3BZBA 1FS6A 1NOIA 1TUIA 3BA1A 3QA9A 3LT0A 4KL8S 4BO2A 5CPBA 4XVQA 2FK7A 1Z3CA 1PFWA 5LUAA 3KWJA 1KSFX 1NVFA 1VMDA 4QEZA 3UQZA 4JWTA 4L27A 4DF3A 1P1KA 5KCZA 2JCXA 2E7ZA 3VR1A 2OENG 2ECOA 3FKJA 5HIIA 4ZZ2A 1BA2A 3CPEA 3R7WA 3VPAA 3SYNA 2HCTA 2ZJ7A 3C6XA 1E3SA 2JRCA 1ZXLA 4I8XA 4QQFA 1LX6A 1YHNA 1R10A 5KC8A 4M21A 1XL1A 4A36A 3RRBA 1N0IA 4P0TA 1FNCA 4ZVMA 3L01A 1CY2A 3CNOA 4RIIA 1FU4A 1U0FA 1Z74A 3VYTB 4KE9A 5K8UA 4HS9A 3GN2A 4MROA 5KZMB 3PX2A 3TAHA 3B7WA 1M1NA 1NUAA 1YQTA 3W9YA 2C98A 4O63O 4Q16A 4TLBA 2WSMA 3K6SA 1JLHA 3BH0A 3MSCA 1A9XA 5F51A 2MYNA 1JEQB 4KQXA 2BFOA 3OG9A 4NH0A 3TQFA 5LP6A 5IXYA 1YZKA 4L6CA 1LF5A 3T15A 1MTZA 2ZG6A 2JEOA 4DQ0A 4E1BA 2GI4A 4YRQA 2QNIA 1XEFA 4MYRA 4QG7A 1IOVA 3QBJA 2NZXA 1UF9A 3FR7A 4M0UA 4QOSA 5L3SB 1I5EA 1KEEB 2XPCA 2ET6A 1WY5A 1SQ6A 2D1FA 4YWJA 4DMMA 3DKPA 4B45A 4YMGA 5CFRA 5FWXB 3RK1A 1OB2A 1OCEA 4C3VA 5IJXA 5K6TA 4RSGA 2RHWA 2IELA 1FBNA 4UMFA 2VDNB 5BN4B 3LC2O 2QJTA 4LY9A 2ZYWX 2H1CA 4M1EA 1FX0B 1C2TA 1TA0A 1V1RA 3EDCA 2YJ6A 3LCRA 3RI3A 4PLYA 4DHWA 2OCPA 4KQJA 3KZ1E 4BQNA 5ITSA 3ENVA 3AL3A 3UENA 1U7HA 4Y2RA 2PKEA 5JBQA 1V7CA 4ZQFA 1I7DA 1TB4A 3OO1A 2XUPA 3ORSA 1N7JA 3FRHA 5DXJA 2GHIA 1B0UA 2PWYA 2VF4X 3DMDA 4ZICA 1M2EA 1WU8A 4U5QA 2UZ1A 3EOZA 5CJPA 2D0PB 3FF1A 3PZRA 4TWAA 3WYEA 5DU2A 3K0KA 5JRDS 1OIXA 3ITEA 2CE7A 5EOVA 4EY7A 4CKCB 4LE2A 1DX9A 1Y8RB 3QQPA 3G02A 1U1CA 4BKUA 5CHEA 5DYGA 1TM1E 2AUNA 1P33A 4FNOA 1OJLA 2ORVA 3R7BA 3TD2A 4BCCA 3ZK9A 3OM1A 1O8CA 2OBBA 3DL4A 4CKWB 4NMWA 4P4LA 1JTEA 1QIIA 1KDYA 2YNMD 2JK0A 3CLSD 2QRHA 2PRSA 4NPCA 4QLBA 5A2GA 4GKAA 4LZAA 4ZAFA 3AJ9A 3PQDA 3A28A 2YVUA 3CYFA 2HA6A 1PJQA 3R0XA 3DWIA 3I9KA 1V5GA 4I3HA 2QUKA 4DSUA 5B58C 1IONA 1Z5UA 3ZCSA 3ZHRA 4RA9A 1V7ZA 4K1XA 2WMYA 1VIYA 5JY1A 3T5TA 3CO5A 3BFKA 3HCAA 3HR8A 3UJCA 2WVGA 2ZIVB 3ZFTA 1NRXA 1GAJA 1S0UA 4NHOA 2DSTA 4C7JA 3RC8A 4UVDA 1XF9A 5GM2A 2JDID 3R5KA 1E5DA 3W90A 3L46A 3VPGA 3UH1A 3EAFA 5A02A 2Y1DA 4GWLA 4NLLA 3BJZA 3CMMA 4IJ5A 1XALA 5F5NA 1RZVA 2HMUA 1U2ZA 4FEYA 3HA3A 3TSZA 3IESA 5A0FA 4NQZA 1A71A 1X0XA 3MAAC 3WGQA 4J9UE 5DO9A 2V4MA 1VCOA 4JY7A 4H0NA 2H2AA 3S2YA 3GFBA 2PVPA 5EVJA 4RFLA 1TZMA 4JI2B 1GEEA 4RS3A 3NYIA 1ZONA 5ICSA 16PKA 1MW9X 3HJFA 2WNSA 4DXHA 4CLEA 8OHMA 5HCUA 4U8GA 3RAGA 1N5IA 2P9EA 3SF8A 1NFRA 1Z6AA 4DA8A 3ECSA 3MS2A 1N8SA 1S7CA 5AVZA 1FY2A 4CGYA 4DQVA 4B71A 1NBAA 3EOBI 5AXDA 4JI6B 1PYOA 5JNLA 5EIBC 4IUYA 2QR3A 3U4QB 1EHIA 3QV2A 5C8VA 3VRHA 4LEIA 3MCTA 1HI9A 1YZYA 2F2TA 3WMFA 4R71A 3ETDA 4R5MA 721PA 2B2CA 3O93A 5AVWA 4LJLA 3V4SA 4E09A 1VCNA 1OWLA 4GOXA 1SBHA 2QL7A 1Q3KA 3E9YA 1V1MB 4LCJA 3AEYA 1RWBA 2BM9A 3TBFA 5KVCA 2O05A 2UUOA 2BKEA 1P6XA 3ADPA 4QDTA 3X1JA 4HI0E 4LXQA 5HTOA 3OZXA 1QGED 3CRRA 1VE6A 3OJEA 1CDEA 1G20A 1VYTA 2I2CA 3CH5A 4CM3A 1N2ZA 2Y1WA 3MYRA 1P0CA 5LKAA 1IE3A 4HNAA 1D2GA 4Q37A 4EMSA 3NIDB 1PDWA 3D4OA 2IZ1A 2NSHA 5JCOA 4ZRDA 5JI2E 1AGPA 1K9VF 1WZIA 4GPTA 1YS4A 3Q3HA 5AKJA 5FBQB 4CI9A 1Z62A 4S0ZA 2QN1A 1L9KA 4DS3A 5FOQA 4XWKA 1VDZA 3MBOA 3OCCA 2AT1A 3I3OA 4KWCA 4ANFA 4DLNA 1HEYA 4OLHA 2GN1A 2JBAB 1PEKE 3D5EA 3D4LA 4PNPA 4XFDA 4I4NA 2CFIA 3V8RA 4BO5A 1Q2XA 5BY2A 3KQTA 1X94A 2I34A 1GU0A 3COSA 3A1UA 3LWDA 1NJFA 3AINA 3ZGLA 2BL4A 1VI5A 3H6GA 5FOUA 3PYLA 1D2AA 4WMLA 3T1OA 3UYKA 2AYZA 1A82A 4BKOA 2EQBA 2QVYX 2VR1A 4DY4A 5LMZA 3FB1A 2APJA 3B9PA 3AF2A 3FDZB 4N0DA 3Q7SA 2JGFA 4S1PA 5F21A 3NXKA 2ZRNA 3TFOA 2G1KA 1A69A 1TOAA 2IYNA 5LBTA 5BN3A 1KZ7B 5F4ZA 4HB0A 2ATVA 2IEIA 4CR7A 5IRCD 3EUAA 3IMEA 4HQNA 3VA7A 1XZNA 3OOJA 3WLSA 4CIWA 2DEUA 4HRVA 1JEJA 1R4ZA 2A9FA 5IBPA 4ALIA 2X58A 2OE2A 3KKMA 4FEAA 4IBOA 3AFGA 2Z2IA 1CJKC 2FPXA 4K28A 4XDHA 1NUPA 5J2UF 3TTYA 3ETCA 4REQA 1LLUA 1U7OA 3G2PA 3OZAA 2FP4B 3E3LA 2WIGA 5F7XA 2SNIE 1ZK3A 2VC2B 2YRFA 1V26A 3IJEB 4W8HA 4M88A 4GXNA 4N7MA 2EYQA 3EBPA 2X1LA 2E2WA 4Y6PA 2Y6UA 1USWA 1J22A 3T54A 3KLMX 1IBSA 3TM4A 3WS7A 3WGNA 2IDJA 4DREA 1EZ4A 1J2JA 3CLVA 3AUFA 1H2WA 4ZOLB 1J39A 3ENWA 3NC0C 1YWGO 4OH7A 2EX1A 4RPGA 4L6AA 1JHVA 2PGAA 4E7PA 5FP0A 4B3GA 2ONZA 4ADSG 4BMYA 4QQRA 4P08A 2O1EA 2J7PD 2NUPA 4K26A 2BFCB 3DOOA 4X90A 3GR6A 4PLCA 3R8CA 4FX2A 3KL4A 1OXVA 1M2KA 1ATIA 1VIDA 1BW9B 1CUWA 1JALA 1MBZA 2QUJA 2WWTA 1GKLA 1MJFA 2ZTHA 3A4MA 3EQ2A 3GCWA 3QH4A 1WQ4A 3T35A 3N0WA 1NVWQ 4K6CA 3QFHA 3T1HB 4QRHA 1FSPA 3PQ8A 2AK2A 2NU8B 3OQMA 5TS2A 1QFYA 2FUNB 4PAMA 5EJIA 1EM6A 1E7MA 3BGOS 4NJEA 2V55B 4Z1MA 5C9ZA 4UHHA 1K1EA 3CX6A 4EHAA 3MB5A 4FHZA 2BPOA 4OQNA 4BRSA 4FHGA 4IZ6A 2EKBA 4FW9A 1KDOA 5JBIA 1VL5A 4RKWA 3EAQA 4KFTA 1JXMA 4P0QB 1XEXA 3RYHB 1T0UA 3P5BA 4K9QA 1J8FA 1GSHA 2PL5A 2ZIGA 4XVUA 5IYZA 2HIMA 1Q2UA 3ZOZA 2NXCA 3RJ5A 3AHCA 5C1IA 4INOA 4TYMA 4EEKA 1G21A 5C52B 2CB9A 2EXXA 3ZBPA 2BTOA 4K6MA 3LCUA 1ZH0A 1FDIA 1L7NA 4HYEA 3JD1A 1EQ2A 5C31A 2Y92A 3K70B 3I53A 5I7RA 1AKMA 2WJVA 3SPXA 4PHTA 1D03A 1GUDA 1XWWA 4HS4A 2PUAA 2VDWA 1I1HA 3AOGA 1KVTA 3UA4A 1BXGA 4LPKA 3HLKA 2FW9A 3IILA 4GOMD 2QW0X 3AYZB 3DHWC 3MFYA 2PT7A 2CHEA 2C92A 3GK3A 3CC8A 2E4AA 1KKMA 5DNYB 1FNMA 1K4MA 3STTA 2FSGA 1NHWA 2WHEA 3KSDO 1M2JA 4FGUA 1HNWB 3AW9A 2BHLA 4JLNA 1ADFA 4HQKA 4RGQA 1VKZA 3BJMA 4KVFA 3NATA 3NUGA 2NVWA 3D54D 4RETA 4UU7A 4C2BA 3BT7A 4B6RA 5C4GB 5JXIA 2MYPA 4P3NA 4FNAA 3O7MA 4XLLA 2ZJZA 4LJ7A 2VYQA 2IYYA 5BOSA 1E6UA 1E1YA 2VATA 1GITA 4GLLA 3R7WB 1W4CA 3GH3A 3EUFA 1NG1A 3VYUB 2DETA 4AMYA 3NLLA 1UC5B 3QKWA 1QE3A 3TL3A 4RJTA 5A06A 5KSWB 5TS3A 1SBYA 2G72A 2ZVPX 4Y2QA 3NV9A 2QGNA 3RJMA 2W2XA 1QG2A 4K03A 1BQEA 1H3FA 1IIBA 3R5JA 4DWVA 3ROPA 2XYPA 3BL6A 4O2LA 2XDQA 1SUFA 2E4YA 1KYTA 4BTVA 1QS0B 5DWVA 5EUMA 1P0PA 2V54A 6NULA 3A9CA 1XZFA 1C7FA 5JEDA 1OFHA 1P2DA 4QBHA 4I9FA 2JGEA 1EWRA 2ZRJA 4LRYA 4FFBA 1RKQA 2E4XA 3OI7A 4EG0A 4R4JA 4ARSA 4XB2A 1QHXA 2XZPA 3GF4A 5DNAA 1YBFA 4NRDA 1AVTA 1D2CA 3DNFA 4C4AA 5LOVA 2VG8A 3PNYA 3ZJVA 4S12A 2O8CB 1GD1O 2RHCA 3CNLA 1IHUA 4L22A 3EBOA 3W2EA 5KX5F 4AY2A 4RX1A 2E1RA 3PQEA 1IXZA 1JHPA 3UN1A 2FMTA 5GVSA 1OREA 1SBIA 2PJZA 4A6EA 3U4CA 1FQOA 1DAMA 1OTHA 1QPGA 1YKFA 1Z5GA 3ZE0B 4BASA 1CUFA 4BLUA 4EPXA 3OD5A 1YZUA 3PUYA 3VO9A 4BZQA 3SY8A 3A1CA 3PDIA 4JA0A 3DAOA 1NZDA 2BGIA 5DI3A 1ESCA 4R9NA 3HDYA 3RS5A 1NXXA 3W6PA 3LTEA 5GGYA 1Y4ZA 5CA1B 1BDJA 1DU4A 3A6GA 1RWNA 4KO2S 1FYVA 3SLKA 4GI5A 2AN1A 4ARBA 2YFYA 1GGKA 2R86A 3VPHA 2J9FB 2FQQA 4HSEA 1T0PA 3U0VA 2VEOA 4NBTA 4ER3A 1JV2B 2WIAA 1MRSA 3A14A 4Q3DA 4BP3A 3CUWA 5CT8A 4BXOA 2YXPX 3UUFA 3WB2A 4TV8B 3DEFA 1F0PA 4MWOA 3V8EA 1HE2A 1S8AA 4RY2A 3WNZA 1OB5A 2OVBA 4Q5IA 1G98A 1E2LA 1FDUA 2C5EA 5F1PA 1W6UA 2R751 3UWDA 4MB6A 4YRNA 3QEOA 3RRNA 1QUFA 1YVDA 3IMGA 2XECA 4RCZA 5EZYF 1F14A 2XE4A 5ALKA 1TO2E 1YXMA 2KWIA 4GPEA 3CR3C 1ZR4A 1RFLA 1KY4A 2JANA 3H9QA 1V8PA 3BILA 2VZEA 1ISHA 2X4GA 3KU1A 2QXYA 3K6SB 5HM6A 4BJ1A 4CPDA 3KV3O 3TGPA 5L95A 4IXNA 1NDUA 3HXLA 5PGMA 2G76A 3OZVA 4TKVB 4RZQA 2QP9X 4J3FA 1YHYA 4M1KA 4ZIRB 3V5NA 4RLFA 2QJFA 3ANLA 3UAOA 3TIIA 1SFRA 1T9DA 3M70A 1H5NA 3S5UA 4FKBA 1UOPA 3ZJ5A 1KRWA 4P4TA 4ZU1X 1CS0B 4HUTA 5I9IA 2G1UA 4B4DA 3FCXA 2C7PA 4L74A 3R6LA 5JCOC 1JHOA 1XMPA 1X7YB 2J9RA 2AJCA 1OROA 1DRKA 1JR3A 2WSBA 1FTWA 2OXFA 3O7WA 1J7KA 4K8OA 1UXKA 4KYIB 1ZH8A 1UINA 1XNHA 1VMIA 1Y5RA 1LWOA 3E82A 4MLCA 3L8HA 5DLYA 1JIXA 3R3HA 1NC3A 4LMAA 2A9OA 3NEJA 4W9RA 4WLUA 1EBUA 1PGOA 2LCQA 4M83A 3S1AA 4D96A 4EPYA 4YHHB 2GS9A 1HM5A 4HNQA 1TMOA 3ONVA 4JT4A 3VOSA 3FPEA 4TVBA 4NCNA 1T5HX 1OVMA 1AN9A 3IBYA 1TKBA 4BQIA 1SG0A 3C7AA 4L50A 4DLRA 1S2LA 2HJRA 3GW8A 3KLPX 3OC0A 4K2AA 2LPMA 4M0KA 1K08A 1BDBA 1JDZA 4KGVA 4O4LF 1AXRA 1XXHA 4OHKA 3Q2IA 3KZMA 5FA6A 1LC0A 1TAHA 5BN5B 3HM2A 1A7JA 4BUCA 4JNCA 2O7NA 3CJRA 2Z5FA 3TCKA 4XR4A 2WEKA 1MO3A 2BW0A 1Y5NA 2GKGA 4ZC8A 5EERA 3TTUA 1BWQA 3EUEA 4R2LA 4IRUB 2A4KA 1Z83A 3VU9B 1JEYA 4ZEMA 4YI5A 5K3OA 3I4LA 2NU6B 2ONJA 3D8UA 1ADJA 3ADDA 4WD3A 4A0HA 1X86B 5AVSA 5AW1A 4I4CA 1GQFA 5DYTA 1ZUIA 4KIFA 4DNFA 3OY7A 4KMMA 5DHPA 4DANA 5JVDA 1TIPA 1U4OA 1QH1A 2JK1A 5E2BA 4GUDA 3EFOB 1LU9A 3WX0A 4CIAA 3DZDA 4LHEA 4FSXA 1H3EA 4S1TA 2XHEA 4YJKA 2QN2A 3ZHYA 2ONCA 3T9EA 1IOLA 2JVKA 3WFIA 1LSJA 4XUGB 1JKIA 2YWFA 3EY4A 3IEVA 3BDVA 1LWNA 4L8FA 3MCVA 4MPPA 3A70A 1MGPA 2FR0A 2J31A 5K09A 4GMDA 3JD2A 5DSZA 4RORA 1M8PA 2IPNA 4AIIA 4JLDA 3G17A 3JQ8B 2OO3A 1PT7A 2JFGA 4L73A 3VHLB 4CM5A 5KYXA 3PA8A 5JSQA 4KPYA 2IL1A 2QQGA 5G0UA 4URUR 3DW1X 3CO0S 4U39A 1Z0AA 3SVZA 4UQOA 1LK5A 4B5KA 3RC1A 4A91A 1DO0A 1BDIA 4WJLA 3TI7A 1SOAA 5FI3A 5CYGA 1ST2A 1DAKA 2OZLB 2CHUA 2P77A 1KPIA 3MWDB 4ZI3A 1FYXA 1MH9A 1N6RA 2V96A 4W5HA 4R3NA 3C1OA 3VC1A 1Y8QB 4C03A 5EXDA 1TC2A 4LVUA 1G8KA 2E3JA 3LU1A 2Z4RA 2I8LA 4P5PA 1TU4A 1BGXT 1ECCA 2MR5A 2WM8A 1K8QA 1WOMA 3IAUA 2R6R1 2EERA 3LXMA 4P81A 3TZEA 2CNKA 3VVMA 2JATA 2VXCA 1J06A 3W5VA 2I1VB 5DBOA 1ZLXA 3INNA 4DJEC 3MOIA 2AMVA 2OYSA 1UP7A 1G2OA 4X95A 2PIAA 1YB6A 8AT1A 2ZW9A 1CZRA 3L9XA 4M53A 3VPBA 1SQGA 1OBOA 2R8EA 4UFNA 1ZW6A 3CF4G 3H13A 5TE9A 4WXHA 2WU8A 4ND6A 4Y0NA 3PPIA 1BD4A 3V7WA 2A84A 2RG7A 3B1WA 4MDYA 5CGQB 4YRLA 2OCGA 2O2JA 3TLYA 3V33A 3VR3A 2O8EA 4WQMA 2X15A 3KQSA 1N5LA 5AHOA 3ICQB 3G5TA 3G0HA 3EWIA 3ZQ6A 5LBIA 1KK1A 2K87A 1BXGB 1DCMA 3LNCA 2ACKA 3PHHA 2Q7OE 3ZEAA 5JASA 2H48A 4F7WA 2X5JO 3C6QA 1K7FB 3EG9A 5EJFA 5B4VA 2Y76A 3PYMA 4MPTA 2OLKA 3MJCA 1VHLA 1F12A 2DBVO 2JIRA 3I34X 1IWBB 3STHA 3P19A 3VU9A 1WJGA 2WWFA 4DCOA 1WW2A 5D5PA 2KM1A 2H2WA 2NAPA 3Q5EA 1FFEA 5LMUB 1ZCZA 2ZBRA 1EB9A 1N6PA 3OHPA 3VAZA 1UJNA 4CETA 1WUIS 2N47A 3OM0A 4R84A 3TRJA 3N2GA 1RAHA 4V0MA 1GSIA 4JYPA 3T3PB 1ILEA 3KJQA 3ODPA 5D3ZA 2VRCA 3ZHZA 5BUCA 2XY4A 2VWPA 2KLHA 2C4VA 3WLIA 2PKCA 4J16C 1G7SA 5B1HA 3NYWA 5YASA 3U3ZA 2PZLA 2IXAA 3E4CA 1BCSB 3KLNA 4KPEC 3U9SA 1PNQA 4BNNA 2O14A 4QJ3A 4ZN6A 1ZGGA 2DFPA 4NOJA 4PF1A 3ZV7A 3BGWA 1EX6A 3EIOA 4LYEA 3WYNA 1ZD3A 3ZX4A 3JQQA 1U3VA 3GGPA 2RSLA 1S9DA 3ESAA 3QVMA 1ZL2A 4U1RA 1CEEA 2FG7C 3CMCO 2IY9A 1NVVR 1PFVA 3D5QA 3KWMA 4GI1A 5CM2Z 4ZJYA 3PRKE 3GD5A 3NKFA 5JANA 3MB8A 5AW2A 3LDFA 2X86A 4J03A 2ZK7A 2BMJA 1EDOA 2A4MA 5DF1A 4LX8A 3UVEA 3K9LA 2BKXA 1EYZA 4UEWA 2P67A 1TAQA 4DLAA 4FOSA 4DGSA 3N3BC 1Q1EA 2ANBA 3E1KA 2J5KA 2CEKA 4ND8A 3AUXA 4YJ3A 2EV9A 4EO9A 2I87A 5CLGA 1NKTA 2H2IA 4XEHA 2WWIA 2GLUA 5KNCH 4WKBA 1X1AA 2XEXA 4LWPA 3E48A 4EAAA 4OL9A 4UQPA 3IELA 4IDPA 4X45A 3DZ8A 4CWAA 1WXHA 2XQVA 3DG9A 1QLHA 2FP4A 2ZIEA 4PRYA 2CBZA 4KH0A 3UOAB 4M7RA 5CB4F 3DPIA 1F7UA 1EBBA 5ALPA 1YTUA 1ZM7A 1X1DA 2L0XA 3OD1A 1O0SA 1VOTA 3U3DA 3RU3A 5G02A 4AG3A 4D4IA 5BR1A 2CSXA 2J0EA 5BQ5A 3VR4D 3V6LA 4UM9D 4M0LA 3DO8A 1U2TA 3WLRA 1ORHA 1QV9A 3RFXA 5LQMA 3DYVA 4N0QA 1VMKA 2AD5A 1AZLA 3M7IA 4N3CA 3ITDA 3QENA 1NBHA 2VNKA 2BH9A 1Y6GA 3UJPA 5L51A 3RT9A 2NTEA 3ABQB 1VRCA 3IIMA 3ZU5A 1IBLB 2PO7A 1NW9B 4E5SA 1OWPA 1CQJB 1P29A 2PUJA 4US1R 2P7IA 2XCLA 3QU4A 3MFDA 2ZR0A 4G5XA 3SOZA 3GRZA 4IH4A 1W9HA 2ATEA 4BNIA 3HV2A 4PGGA 1NBMA 4RTKA 1KDPA 1MC5A 3Q3GE 4MWGA 2BMDA 1I7PA 1TTHA 3KPJA 4ZGBA 4N6GA 3TINA 2HO4A 4RW0A 1TTPB 2DECA 3O2NA 2P11A 3LSTA 3UJHA 2C7QA 5I7OA 4N6NA 4WFKA 3HUDA 1N0WA 1KQFA 3V80A 4RO0A 2FHPA 1SU4A 1Q12A 1ISGA 4KMOA 1NI3A 4BB0A 2ZJ6A 1Z17A 3JQ9C 2HJVA 3RRFA 3V7NA 5D51S 3R0QA 3IGFA 2NM0A 3PNBA 3QTLA 3R3YA 2J46A 4IG4A 5KYUA 2WJJA 3PJRA 1I6KA 1K92A 3S44A 3U3JA 4HWGA 3OE1A 4CTNA 1ZAYA 2N0SA 3SJCA 1TYCA 5TT1A 5K0ZA 1UT5A 2QI9C 3M4JA 4DSTA 4FUTA 1C80A 4XOUA 2E37A 1BX1A 4IFTA 3ET5A 4DAOA 4Y2VA 4QDJA 1YI8A 2Q3CA 3GVPA 3R6GA 1IU9A 2BGWA 4IJMA 2D5AA 3ND9A 1EFDN 2DFDA 1U7ZA 4LBZA 1TZCA 1NIJA 4MIOA 3X1YA 4RYDA 3F74A 2MDTA 2R5NA 3FCEA 1T1RA 1H2XA 1VP3A 4FE7A 3UFBA 2V7EA 5CDGA 1NG9A 1RE1A 3OPYB 3RSQA 1F2TB 3HEBA 1RZ3A 3PNQA 3C39A 2PFGA 2YMMA 4FILA 3U44A 4LG1A 2E0IA 5P21A 4EL5A 3E61A 4U7TB 1H0RA 5H8WA 4REOA 4AB1A 2PKWA 1F3LA 2E85A 3F90A 2W98A 5HE9A 4BO8A 1TTTA 3RG2A 3HH8A 5F4BA 1YK1A 2NP7A 4KYTA 3KAJA 1ACJA 1SA0A 3HKEA 4MRMB 5AMXA 2AZXA 5DE3A 1X3SA 1HYHA 3ZWAA 1NKVA 3F2VA 1XRLA 3LQRA 4X6LA 3K09C 2NO5A 2LXNA 1JECA 2PH5A 5C5EA 2NGRA 1YCGA 5TRTA 3T9BA 3NH9A 4YRIA 1U1EA 1YMQA 1EG2A 1QKJA 3RT7A 1UMBB 3PXAA 1E6MA 4HGQA 3ZX5A 3GUZA 3I30X 4C6HA 4YMUA 5EXSA 5A9SB 5LA6B 4DLXA 2UYGA 5E6UB 3C15C 5DNWA 4ZOEA 4EJ0A 4EW1A 4RKYA 4XYLA 3FLAA 3QEMB 4IXWA 5HIAA 1SULA 4OK3A 2ZB8A 4G89A 4Q4JA 1YRQA 5DTQA 5B1IA 5M34A 3ZD6A 4EATA 4Y2JA 2PT6A 1SVKA 5B2ZA 4W6QA 1H3NA 2ACWA 5AHXA 4FDVA 1G59A 3IE1A 1NGSA 4FFBB 3E8MA 4NZNA 4BECA 1GP2A 5CDSA 4PBRA 3H2YA 4OIFA 1D4FA 4XR9A 3BUSA 2OP0A 4IL5A 4TXHA 1MB9A 2R6ZA 2ZT8A 3UMFA 3WRYC 4E5NA 2GEBA 1MUUA 2VAWA 4FEEA 5EKSA 2CC2A 2GEUA 3C8UA 4D79A 3TPFA 3Q8MA 4H17A 4UZEA 2FWBA 1EE9A 3D6FA 3H4IA 1EUDA 4MUNA 4Z86A 5CXXA 4J0IA 4E6PA 4OHWA 2AKAB 3SEZA 3L8MA 2IYFA 1AGYA 4HQOA 2EL7A 4JJGA 1KDTA 2X5OA 3KOXA 4KYUA 4QJIA 1LLDA 2QV0A 3MCWA 4Y2UA 4FGSA 1FDWA 3NU1A 4HWOA 4LV8B 3QVKA 1E9EA 3BMNA 3F8WA 1M2FA 5HRUA 2R1TA 1M0WA 3B53X 4JP5A 3EMKA 3OZBA 4FXPA 5A5GA 4WJZA 1U9JA 1YR6A 3UIEA 3R3UA 3QBVA 3R3XA 1CERA 1H4SA 2AMLA 1GVHA 4IMIB 3C6ZA 5GADl 2J9FA 2GZRA 3DE0X 3E5RA 4ZPJA 5FBVB 2XCSB 2PMDA 2JARA 3ZFOA 2COKA 2IYQA 5L4LA 4HH1A 1G18A 4EMTA 2VYND 3G0BA 1DI0A 4N5IX 4NCHA 4MVJE 2G1PA 4YGYA 1PJZA 1YL5A 2ECPA 2HJ9A 4JUFA 2QPLA 3RUAA 5KJ6A 3FLEA 4OA8A 1RMYA 3HA7A 1W35A 3RASA 1KXZA 2ZDHA 4FFLA 1VSUA 4CLOB 2PX3A 1JIQA 2EW2A 3OU6A 4DG8A 1AZTA 4ER0A 1YAHA 2H65A 4HB4A 2UKDA 3DBVO 2P5YA 2PAFA 2VP3A 3TLEA 3A8TA 2JCVA 5LXTA 4OB6A 2H4WA 3PNVA 4TN5A 2OBXA 1DIHA 1RJGA 4IY1A 5KYYB 3BAZA 3AUKA 1KI2A 2FOXA 4K6GA 1YZHA 1GV0A 1L7BA 1DJNA 4QODA 3SZMA 1T5BA 4KACA 3QFSA 2BFPA 4PS0A 2V6IA 4PZ9A 4AECA 4MV8A 2X7JA 2PH7A 4FYWA 3G6KA 4JAVC 5CNJA 4WVLA 4F91B 2WKRA 2P2NA 4ZVSA 2AJLI 4MWCA 4BFUA 3PUXA 1WMEA 1NNI1 3FCSB 4HX9A 4KQ6A 5LIPA 4X91A 4FS8A 1ZK0A 3A11A 1SCBA 1PR1A 3AG5A 4YRTA 5FWAA 3OPVA 4OQXA 3KQOA 3QWBA 1A1VA 2H0QA 3LQ2A 1R8JA 4RPCA 2HWUA 2NO1A 3TD9A 4X00A 4XUCA 4BFLA 2EWVA 5L6MB 4W1QA 3ZIUA 1DFIA 3FOEC 4RTPA 1SH7A 3UB3A 1Q6YA 1I2CA 3I92A 4QDKA 1GILA 2YXLA 4ZDIA 5FAKA 3QIAA 4LNAA 1N3IA 2NN3C 3E27A 3BGIA 2BMFA 2QT0A 3NNSA 3BMOA 3F4KA 1LQTA 4PFQA 4ZCQA 1UPUA 3T95A 3AR3A 1PFUA 1NVGA 2P69A 1XDSA 3ZZ0A 4BNTA 3K0EA 4DV7B 2WJIA 4I1SA 4DA7A 1KAHA 2EJUA 1OFUA 2PN1A 3D2AA 5U1PA 3DFZA 4B09A 2CMGA 3MHPA 2W6JA 3FIJA 5ED4A 3Q1LA 4GT1A 2C4HA 2AC7A 1L5KA 2FRDC 2EKDA 1C7RA 4G2TA 1OYYA 2NU9A 1J8VA 2RD2A 4RSMA 1FYEA 3GLHA 2R96A 5FLXA 4JYBA 2KMLA 1WBJB 4X1YA 1QLWA 1OWOA 4OL0A 1M83A 4TV8A 2VAXA 5CLQA 1BMFD 4YUZA 4J0FA 3GV0A 3ECAA 1G4AE 3IFSA 1X77A 3OT4A 1XTIA 3CRQA 3RCBA 3H1EA 4BLQA 4PG5A 4ZVNA 4IAOA 4LIPD 4U7GA 2G80A 3KZVA 4G09A 2X0FA 1BU8A 4EA8A 4DOMA 4XW2A 1UAYA 3T7DA 1UJ5A 3W3AA 5FOXA 1LNSA 3EK2A 2XOKA 5CA1A 1HRKA 3MGGA 2X2FA 1USUA 2PZEA 1E92A 3AVWA 2OHJA 4ZMRA 4OP1A 1N2CB 2XEDA 4D0NA 1Y3BE 1HDXA 2ZWOA 4OHUA 2UVQA 4L0CA 4DV6B 2QRUA 2VPYA 1ULZA 2VEDA 1UXJA 3AUAA 2AC2A 4HVTA 4X66B 4IJUA 1E3EA 1YD7A 2CMHA 3P2IA 4TKVA 3ILXA 2XJ4A 2ZDQA 2GF9A 2SKEA 1SIUA 2XJ9A 5AOAA 9LDTA 2HDOA 1G291 1F20A 2Y67A 1MRZA 4B81A 2BE7A 1M67A 1N1MA 4WNAB 1YAJA 1NYLA 1Y1PA 4KWIA 3DS8A 1TAGA 4RD3A 4RQAA 1Z8FA 2FZEA 3WMGA 3K8YA 2NPFA 1RXCA 5EN4A 4DKXA 4EENA 4MKIA 2C1ZA 2XQIA 3JPWA 4FJ1A 2I29A 1FU8A 2OCAA 1FFDA 1U2DC 1ZI9A 2HU8A 4U2BA 3LYUA 1QFSA 3UHFA 1BHO1 5A4AA 1QPZA 1M54A 3I0MA 4CEJA 1GA4A 3MAJA 3M89A 1UXHA 2RGNC 1XWFA 4YRDA 1P74A 2Z1NA 2O0LA 1NW7A 3WL4A 5M2QA 3W9BA 4P22A 5K0TA 3EA0A 4P4UA 1TLLA 2XUHA 2I2XB 4INJA 4PSAA 3TIXB 3MEQA 4HN9A 3MTQA 4F5DA 1XJWA 2EP5A 1GPH1 3EZGA 3FZQA 3H7IA 3WL6A 3AFHA 5A3SA 2R1UA 1HBJA 1N78A 4TV8F 3A3NA 3ZKAA 3A4YA 1QJCA 2FZGA 3JD4A 2NQ2C 2IZOA 1SG6A 1MABA 1PZMA 4LKRA 4BEJA 1M1UA 1W6RA 2F1IA 3EDRA 1KAGA 2HCRA 1Q95A 1T9BA 5TMDA 5ICEA 1AKTA 1HYBA 1NC1A 4R8RA 3KQHA 3EWSA 4EFNA 2W2QA 1BIFA 1NVBA 3HUUA 4Z1MD 3PNKA 3V7FA 2JJYA 3O8BA 1F4VA 1XUOA 2JFBA 1GT91 1XIVA 2LGJA 3GJRA 4EHJA 3N39C 4O2AB 1ID1A 4JBXA 4XASA 3RABA 2XA1A 5JD5A 1EGAA 1UKEA 2VIIA 5IM5A 3HUNA 2ZUBA 4RD4A 1ONNA 3I05A 1IB6A 4PFSA 4RAQA 2A5LA 5DIZA 5JPDA 1NRWA 5ALJA 4HUQA 4WKCA 1PK7A 3H9JA 2D3WA 3LUBA 2IYTA 5FUVA 4HC4A 4QGGA 2PSEA 2R4QA 3WLEA 3Q15C 4J8PA 4LFBB 1WKCA 3O3CA 1GN9A 2YHIB 1V5IA 2HA5A 4KH1A 3T7EA 1T2DA 2HV8A 4CG1A 3JZFA 1E79D 4ID9A 2W2OA 3F6YA 5J59A 4NU5A 3LFUA 1PD1A 1KI9A 4F3NA 2F9MA 1YA8A 1FDSA 4OB7A 4XYMA 5E6UA 2C61A 3THWB 1F06A 4DLSA 2WQ6A 3BJRA 2CYBA 1N7HA 1VSQA 2VKTA 2YMLA 1P5FA 3C7TA 1DDGA 2H7YA 2WB4A 3N2KB 2J09A 3C3PA 3K2QA 1E63A 5DNVA 2DBYA 3JQGB 4O2AF 1ZX1A 2ID7A 4X54A 1AQ6A 3LVRE 4B32A 4B43A 2VP6A 1UBGA 1Y42X 2IYUA 4L02A 2WMDA 3KKEA 2GD0A 2I22A 4EB3A 1QV7A 2Y0DA 1L7OA 4GQBA 1CJTC 1L7EA 5LZ8A 3T3GA 5CDFE 1O87A 1RLUA 4R68A 5IC5A 3SBOA 5EC8A 2XB8A 4UPEA 5B5SA 1CV2A 1IJFA 2Y99A 3B1KA 3PC8A 4HAYA 1V3QE 1J21A 1NPTO 2M6RA 2A1TR 3IAAA 1SAYA 5AQEA 3T5BA 3UAYA 3TQOA 4HDSB 3I6ZA 521PA 5KX5B 5ER9A 1MVLA 5AVOA 2J6CA 3DL0A 1R0ZA 3LVQE 3C4VA 3KVVA 5CLLA 5LP6B 1LV8A 3BHIA 1DXHA 1RU3A 5PNTA 2FWMX 2HBRA 1N2OA 1QH1B 4D3XA 3NVMB 4AJ1A 1DAPA 1EK0A 2Z2XA 2WP8J 4GMFA 2QMHA 2VK1A 3M4NA 4Q3LA 3GDHA 2Q6KA 1S9HA 2GJ4A 5HRCA 1X8XA 3Q8KA 4KBYA 4DKJA 5CB8A 1QVVA 2P2YA 3QFRA 4LV6A 2V5AA 3ZTWA 5AUNB 5C35A 4E32A 3FVVA 3WIDA 2ISQA 2PT9A 2BFBB 1E3LA 3D2CA 4RF3A 3UMVA 4F8YA 1IY9A 1PWYE 3QP9A 1NXPA 4AT1A 2O3TA 1F51E 4R3UC 4KNYA 1P2UA 5CCBA 4UU1A 4G0YA 2Z6UA 1UBUS 2Q6IA 4M7PA 4UBKA 5D01A 2XUAA 1BD3A 5CG1A 3BBLA 3VKUA 5HE8A 4ATNA 1Z29A 4JI4B 3SC2B 4ENUA 3A1FA 2XCTB 1I9CA 2JCGA 2VOJA 3MFQA 3KXPA 5ENDA 5H59A 3H1GA 5FL3A 5EZYA 2W6PA 1I51A 1KRHA 1ZVMA 3MLBA 3DEJA 5IT5A 3R9XA 1CNFA 1L6IA 4HDOB 3MSXA 2OZLA 4X92A 1Q21A 4DV2B 1ZD2P 2JLSA 3DOFA 3M9WA 4W5WA 3FVWA