1INLA

Crystal structure of spermidine synthase from thermotoga maritima
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
295
structure length
285
Chain Sequence
b'RTLKELERELQPRQHLWYFEYYTGNNVGLFMKMNRVIYSGQSDIQRIDIFENPDLGVVFALDGITMTTEKDEFMYHEMLAHVPMFLHPNPKKVLIIGGGDGGTLREVLKHDSVEKAILCEVDGLVIEAARKYLKQTSCGFDDPRAEIVIANGAEYVRKFKNEFDVIIIDSLFTEEFYQACYDALKEDGVFSAETEDPFYDIGWFKLAYRRISKVFPITRVYLGFMTTYPSGMWSYTFASKGIDPIKDFDPEKVRKFNKELKYYNEEVHVASFALPNFVKKELGLM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase
publication title The crystal structure of spermidine synthase with a multisubstrate adduct inhibitor.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 91
structure length 285
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 1inlA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1inlA01
2F8LA 3Q87B 3P8ZA 3UJ7A 5M5BA 3ELUA 5DM4A 3HCDA 4YUWA 1I1NA 4IV8A 2VP3A 2BR5A 3M6VA 1YUBA 2LD4A 1N7IA 3B3JA 3GDHA 2PBFA 3P2KA 3EPPA 4WVLA 5GM1A 1R18A 1L3CA 5EMLA 1VPTA 4U7TB 4LG1A 3KQMA 2B78A 3AY0A 3ME5A 1Q0SA 4X1OA 3FRIA 3SGLA 4BLUA 3LBFA 4B17A 3G8AA 2NP7A 1R00A 4HTFA 4E70A 5IH3A 3E8SA 1JTEA 3MTEA 3DOUA 2YR0A 3TQSA 3LDFA 5GOZA 1FJXA 1IY9A 3FRHA 1INLA 2ZIGA 4C04A 4EVIA 3R6TA 1BC5A 2ZZNA 3LGAA 2AN5A 2FPOA 3UJBA 5GIPE 3P71T 1G8AA 2GA9A 1Y8CA 2QM3A 4PYQA 4POOA 4V0RA 5K0NA 3KR0A 4AUKA 4RTQA 5BXYA 2UZ4A 2OYRA 3TRKA 3ELDA 3LDUA 4HSGA 3KKZA 5K0BA 1YF3A 3LCCA 3FPFA 3GRZA 3SSOA 3G2QA 2PV0A 3X0DA 5G02A 5K0CA 3DULA 5EMMA 3A7DA 1X19A 5GIOE 5B1SA 1U2ZA 1G60A 1KP9A 4FGZA 2ZBQA 4BLVA 2CMHA 2A14A 5LQJA 4P58A 4V0QA 2AOTB 3BGDA 4HRAA 2ZBPA 4AZTA 3I64A 3KU1A 5KS2A 3GRRA 5LSAA 2H1RA 3HA3A 1KIAA 3DXYA 4JXJA 2XBMA 3FPGA 5F2KA 4QVKA 2PXAA 1DL5A 5DTQA 2P41A 2OXTA 5JUWA 3T7TA 5HOQA 3U81A 2HTEA 1NW8A 3R24A 2PKWA 3EMDA 5DTMA 4DZRA 1RJEA 4F84A 4X63A 5P8WA 3I58A 4KVZA 4PYJA 4R8SA 3EVGA 5K0FA 5EG5A 4E33A 4PINA 5EQJB 1ZGJA 3T7SA 2PT6A 1XCLA 3B3FA 1BOOA 2AS0A 5DXJA 3TMAA 3PLAE 1WXXA 4F85A 1UFKA 5K0EA 2IDKA 4ISCA 1I4WA 2OB2A 2O57A 3C6KA 2PX8A 3C3YA 3SR4A 2AN3A 2BR4A 2H00A 4MIKA 2QRVA 3G5TA 1ZHFA 3TFWA 3HM2A 2EFJA 2PGXA 4QTUB 4YV2A 9MHTA 1D2CA 5GWXA 2EG5A 4PYLA 4RV9A 3RODA 5F2NA 1JSXA 3FUXA 1O9GA 2G72A 2AOWA 2PX4A 4YV0A 3UJAA 5CCBA 2V7EA 3LDGA 3E05A 4LWOA 4C05A 5K0JA 2PLWA 2AVNA 1NV9A 3EMBA 4GOOD 5GP1A 3G2MA 2EJUA 2JG3A 1TPYA 2O06A 1XTPA 3RW9A 1KPGA 1F38A 2JHCA 1R6AA 2P7HA 1X1CA 4UOEA 3D2LA 3MTIA 5CM2Z 2PY6A 2HMYB 5LQCA 5KQSA 1XJ5A 3LPMA 4LWPA 3TM5A 1YFLA 3MB5A 2ZZKA 1VP3A 1XDSA 2UYOA 3O31A 4RVGA 4DA4A 2FRXA 2BH2A 4H0NA 1QAMA 2E5WA 4HH4A 3DXXA 3MHTA 3UZUA 4YUZA 1XCJA 5DM1A 5EIFA 2YXEA 3E23A 2ZIEA 1ZG3A 5DRTA 4DCMA 2P8JA 5ERGB 3CBGA 2I9KA 3BXOA 3NDJA 4C03A 2Q41A 3OFKA 3BWCA 3QOXA 2PWPA 4Y2HA 1SVUA 2GH1A 2BM9A 2N47A 3LHDA 3GIWA 1KYZA 4GC5A 5EKUA 2ZSUA 1RI4A 5FQNA 4QPNA 3FTFA 7MHTA 2ADMA 1X1DA 4IV0A 1AQJA 1X1AA 5DX8A 5JR3A 2P40A 2UYHA 1EJ6A 3TM4A 1RJGA 5FUBA 3HEMA 5FA8A 5DM0A 4BP3A 3JWHA 3A4TA 4HGYA 3UJDA 2QRVB 3NWEA 1PRYA 1N7JA 2YQZA 3ID6C 4FZVA 2IH2A 3RIEA 2GB4A 3PX3A 3CJTA 5HIIA 3ERCA 3EVBA 4BY9E 4A6DA 4ZTBA 5CVDA 3DLCA 1XXLA 2AOTA 3OCJA 5EMKA 2ZLBA 1YZHA 4KRGA 3UJ9A 4RTRA 2ZIFA 1AF7A 4P7FA 4X41A 1SQFA 2NNWB 2IBTA 3G8BA 2PJDA 1HMYA 5EZQA 5EHIA 3BWYA 3FYCA 3P9IA 5EMJA 3HVKA 3VC2A 1EG2A 5E1BA 5K8VA 4L7VA 2GPYA 3P2IA 5E9WA 1P91A 1BKYA 1ZGAA 2EJTA 2VDUE 4WXHA 3OZTA 1RI3A 3KQVA 4CKCA 3HP7A 3OU7A 3EGEA 1NBHA 4RX1A 2ZBRA 5DSXA 1R74A 2PSSA 3EGIA 1JQ3A 1WXWA 2YTZA 3G89A 1KYWA 3GRVA 3O7WA 5LQRA 3FTEA 4ER3A 2AR0A 2XYQA 2ZWAA 2JH9A 4PYIA 3T0IA 1NW7A 4MTLA 4P7JA 4RTPA 5BW4A 1KPHA 2ZWVA 1AQIA 3QV2A 2P3QA 1FPQA 5KQRA 3NDIA 2PT9A 4GOMD 4ER7A 3LL7A 2I62A 3FPHA 2B9EA 3HA5A 2NXEA 3KPWA 5K09A 5LQAA 2FYTA 2ZW9A 3KPJA 1WZNA 4DKJA 5FADA 1JR4A 1G6Q1 2UYCA 3IV6A 1RJDA 2HV9A 4RYLA 3ER9A 4MHTA 3UWPA 2JHAA 4PCAA 4KWCA 3B7PA 3V8VA 3EVZA 4FP9A 2QYOA 1ORIA 3DR5A 5CVJA 2B25A 3OZRA 5EKXA 3OE4A 3CJRA 1AV6A 2C7QA 4CKEA 4R8RA 1JG2A 2PX2A 3SMQA 2CL5A 3UBTA 1TW3A 3GO4A 2G8NA 3BWMA 1QANA 1QZZA 5E9QA 3MQ2A 1IXKA 2GLUA 3PB3A 2YVLA 3HVHA 5EC8A 1D2GA 3THSA 5ICGA 5HFJA 3B5IA 1R8YA 3MCZA 3HVIA 5DX1A 4DQ0A 3PVCA 2HNKA 2OY0A 5C1IA 1L9KA 2G1PA 5DX0A 2BZGA 1WG8A 5BP7A 4KIGA 5K01A 2B2CA 1RJFA 2AOXA 4C06A 3KQWA 4QQKA 3C6MA 1P39A 3HNRA 4Z2YA 5C9ZA 5E9JA 4G56A 4U7PB 5FULA 3NMUF 5CCXA 3ER8A 3NVMB 3AJDA 2ZULA 2BM8A 3C0KA 4BP1A 4KIFA 3CCFA 5CVEA 5T67A 3TLJA 2IFTA 3TKYA 5CVVA 4QTTB 1DUSA 3NWBA 2IH5A 3G7UA 3GGDA 4PIPA 2WA2A 1WS6A 2ZFUA 5EGSA 2OPBA 4NECA 1Z3CA 3PFHA 3UA4A 4ATNA 3BKXA 4CKBA 3AWIA 3B3GA 1NBIA 1NW6A 4PCLA 4PYNA 2C7RA 3SM3A 1FBNA 3KQPA 1VP9A 3LECA 3EEOA 5DSTA 4BLWA 3KQTA 3MCTA 5GINE 3GWZA 3LKDA 3SVZA 8MHTA 1B42A 1RI1A 1YB2A 4YUYA 3FZGA 3G5LA 4CTJA 5ICCA 2C7OA 1FP1D 3UA3A 3OFJA 4HG2A 4RVFA 3THRA 3WSTA 1VE3A 1RI2A 1OR8A 2P3OA 1D2HA 2OO3A 2PWYA 4XCXA 4AZSA 5ICFA 5T6BA 1IM8A 4PGHA 5HILA 1G55A 4PYMA 1PJZA 2G71A 2Y1XA 5DXAA 3A7EA 2IIPA 2WA1A 4K6MA 3SX0A 3SXJA 4ER6A 5ICEA 5HZMA 4M36A 1V39A 4M38A 4YUVA 2OBFA 3O4FA 3M6WA 4PNEA 5EZSA 3R9XB 3HTXA 1SUIA 2XYRA 5BW5A 1R8XA 3P2EA 5EPEA 2G70A 1G38A 2KW5A 3MAGA 1VIDA 1FP2A 3HCFA 4FT2A 2VDVE 3KPVA 5EVJA 4DF3A 3M33A 1M0EA 2Z6AA 4X60A 2YX1A 1X1BA 1P1CA 3M4XA 4AZWA 5LQKA 1JQEA 5CD1A 3DMFA 3K0BA 5HIJA 4PYKA 2FK8A 4Y30A 1M6YA 2DPMA 1QAQA 5T64A 1NKVA 2NP6A 5FTWA 2GS9A 3OPNA 5CUQA 3TR6A 2NXNA 3BT7A 4R6XA 2V74B 5U4XA 2Y1WA 4RTOA 1NE2A 3G2PA 4QQNA 3REOA 3TPZA 3A25A 4KW7A 4M37A 3IEIA 3G2OA 5CIYA 3HA7A 2ONYA 4E2YA 1EJ0A 2OZVA 3G88A 1P1BA 3NJRA 3P9KA 4IWNA 4E2WA 2QE6A 4OA8A 4GEKA 4XUEA 5DTRA 1L3BA 4C4AA 4EKIA 1M6EX 3MERA 3DLIA 4YV1A 4QPPA 3S68A 3CJQA 4E31A 1NV8A 2PVCA 3LCVB 3FUTA 3AXSA 1EIZA 2IGTA 3L8DA 3FUUA 1JQDA 4RVDA 1XDUA 3BUSA 3GJYA 4FR0A 4PWYA 3NTVA 3ELWA 3M6XA 4FT4A 2CMGA 3JWIA 1NT2A 4YUXA 2JJQA 5FQOA 2P7IA 2YXDA 3GXOA 2ZZMA 2O07A 1QAOA 4RTLA 5E2BA 5LR6A 1UIRA 4KDCA 2OKCA 4OQDA 1BHJA 1WY7A 1NW3A 3DMHA 5DPMA 2WK1A 5LQUA 3A26A 1QYRA 3EEYA 2BR3A 2CKDA 5CVUA 5E1DA 5HEKA 3SSNA 1EAMA 2HWKA 3KQQA 1O9HA 3VSEA 3BKWA 5D1HA 3EVCA 2VS1A 3DMGA 2JHPA 1UWVA 2FHPA 1G8SA 3PS9A 5MHTA 2ESRA 4DM3A 1SG9A 4RTMA 3TOSA 4RVHA 1XDZA 3OZSA 4R6WA 3HCBA 3EVAA 1JG3A 5HIKA 3ANXA 2DULA 3A27A 3DP7A 4ER0A 1VLMA 3HCEA 4RTSA 3H2BA 3KR1A 3HCCA 2HR1A 3NVKI 2IP2A 1SQGA 2AOUB 2R6ZA 1MJFA 1XVAA 3DXZA 4P7KA 2XVMA 3P97A 1O54A 1TW2A 2ZVJA 4QDJA 3UJ6A 3V97A 5K0GA 1ZQ9A 2O05A 1VL5A 2NXJA 2ONZA 3HVJA 3P9CA 4GOLD 4M7RA 3GU3A 3GRUA 4R05A 5LQNA 3BGIA 3IYLW 3Q7EA 2AZTA 5DM2A 5K0LA 2IPXA 4RTJA 4A6EA 4CWAA 1Q0TA 2IH4A 3FTCA 5E8RA 5EEGA 4GOND 4E30A 4XUCA 4AX8A 4IKPA 3CVOA 4FSDA 4OBXA 4RTNA 4OBWA 1SUSA 4YMHA 3I5UA 2OB1A 5FCDA 5FHQA 3PTAA 2IBSA 1T43A 1JTFA 5FHRA 2AOVA 4CTKA 5H02A 4EQZA 2PX5A 3ORHA 4E2ZA 2B3TA 1HNNA 3K6RA 4AZVA 4LECA 3CKKA 4PYOA 4C08A 3P9NA 5FWAA 3LKZA 3UJCA 2P1DA 2PXCA 3EVEA 3F4KA 2AVDA 3NW9A 5F2OA 1KXZA 2Z6QA 2QY6A 3FUWA 4YMGA 4OX9Y 1JSZA 2ZTHA 2AN4A 4ER5A 2I7CA 3EVFA 4HTFB 5DWQA 2Z6UA 3PX2A 4XUDA 3B89A 3SSMA 4GC9A 5D1NA 4MQ4A 5EOVA 3MGGA 4EK9A 2FCAA 2GAFA 3M6UA 2IDJA 4QVGA 1L3IA 4KDRA 3FPEA 4O29A 4CXMA 4EKGA 2VDWA 4DCGA 2NYUA 3PFGA 3FPJA 5IKMA 3C3PA 1F3LA 4RSRA 2I6GA 3UFBA 2FK7A 3T7RA 4GUAA 2CWWA 1KPIA 3EGVA 3KQSA 4PGGA 4P7GA 5HIMA 1YZ3A 5FWDA 2XVAA 5E8JA 5KVAA 5KYGA 5EHGA 2ZCJA 2XYVA 3KR2A 4EMSA 5EEHA 3KR9A 2C7PA 1RI5A 1H1DA 4PONA 4F86A 4C07A 1JG1A 3R0QA 4HGZA 1SKMA 3LBYA 5C0OE 5E1MA 1ORHA 3BWBA 4HC4A 3BZBA 5GM2A 3KHKA 3OU2A 1VQ1A 4RWZA 1YFJA 3GRYA 3LCUA 3GNLA 3DTNA 3DUWA 3CC8A 4OQEA 2H11A 1NW5A 1ZKDA 1L1EA 1KR5A 2UYQA 2YUIA 3ELYA 2P3LA 3FYDA 3JWJA 4PIMA 5E1OA 1N2XA 4RTKA 2O0LA 2K4MA 5K03A 3M70A 3PT9A 5DLYA 1JG4A 3VYWA 2ERCA 2AOUA 2ORED 3FUVA 4GQBA 5EIWA 4E2XA 2R3SA 5K05A 3IHTA 4FS8A 5DT2A 1MHTA 3LX6A 5E2AA 3GCZA 4GF5A 1DCTA 3EVDA 5FA5A 2YXLA 3LSTA 3OU6A 3CGGA 2VZ9A 3R3HA 2JH8A 3FTDA 2PXXA 3AXTA 2NXCA 3HCAA 3KQOA 3KPUA 4X61A 3KPYA 4E32A 3KQYA 3I9FA 3UJ8A 1I9GA 3I53A 3DH0A 2EX4A 4DMGA 2P35A 5DRYA 4FSXA 10MHA 1EQAA 4OA5A 3TKAA 4MWZA 3OE5A 4GBED 3E7PA 3BGVA 3QOWA 3JWGA 1KHHA 4QDKA 1VBFA 3VC1A
chains in the Genus database with same CATH superfamily
4CM1A 1L5RA 1A82A 4YT5A 4W8OA 4IV8A 3JU3A 3T9DA 4AIRA 3IUYA 4BP9A 2CE7A 1JIIA 2NYRA 3AEXA 1VG1A 3OIYA 1CUDA 1KBQA 3R20A 2IHTA 1C0IA 1X3LA 1AUXA 4O63O 4RKRA 2B78A 4BQRA 2ZRHA 3FRIA 4UDNA 1GILA 3KB6A 4ZAXA 3SXUB 1E7RA 1Q74A 1WCIA 3EQ6A 3V34A 4BWVA 3HDHA 3LL4A 4FJ0A 4HTFA 2VDJA 3KEGA 4O1HA 4PWZA 3IAAA 4YACA 2NACA 1QU3A 5IT4A 3C7AA 2X5KO 5AK5A 5JXHA 1TZMA 1TCCA 4PO8A 4MP3A 5EZYA 3RSZA 5J2UB 3NYWA 1Y8CA 4G1FA 4JLOA 5D5HA 4V0RA 2UZ4A 2BI7A 3UCXA 4RTQA 2YIJA 4FQ5A 1F9AA 1DTWA 3I6ZA 9LDTA 1YF3A 2BMAA 3LCCA 3T7KA 1JZSA 2UVDA 1Y4SA 2Q7OE 3VTFA 1UZAA 1PZNA 3MJEA 1VHTA 1G60A 1HE3A 1YZKA 4CCSA 1SY7A 4E5KA 5A9RA 2WJVA 3KUDA 3R5FA 4CCYB 3LA8A 1LK5A 2PFKA 1C8VB 1VIVA 2GBIA 4H1HA 4H4CA 5K6AA 1A04A 4N7RA 2IYQA 1NXSA 3JQ8B 3THXA 1UODA 1H85A 2HRQA 3GMTA 4EI9A 4O2BF 1NUSA 4G1MB 3DXYA 4XLZA 1WUKS 4DZTA 5K5EA 5D3KA 1NRIA 2PUFA 2YHUA 4DJDC 6LDHA 5HJ5A 1T4DA 3TPCA 4AU1A 4NOKA 1U2TA 5ALPA 3RGGA 4DE5A 4Q4CA 1ZO8A 5GQSA 2LZ0A 4F5DA 1CQIB 5EQJB 4JI6B 1Z5WA 2YV2A 1Y8AA 3F78A 3NM4A 3MSXA 5DXJA 5JXGA 5LYJB 4BNUA 4TQ9A 3U7EB 1A9XB 1P1FA 4QU0A 3LWBA 3MS4A 4X6YA 5I9IA 1S9HA 3UNXA 3QX7A 4N6GA 4WK0B 2I6SA 2PD6A 3QV1A 2JIMA 2BC9A 2MTBA 3CG4A 2QMUA 2XWQA 1T3TA 2CKMA 3CX3A 2AFHB 3C8ZA 5IT9A 2G40A 3M6IA 5T4BA 3WYDA 3U09A 1X39A 3KZVA 4D8UA 4UARA 2NU6B 2OGTA 3C3WA 4OGLA 5I47A 4QOEA 3GLRA 2VQ3A 3MWDB 1VL0A 4FDTA 3CUEF 3U0BA 4D8TA 1GPBA 1TJPB 5JMTA 1GQOA 1YXMA 4RSGA 4BKOA 3DHYA 5DSZA 4ZCTA 2JI7A 4EZIA 2Y0CA 5A62A 3DV2A 2HA6A 5LJIA 4YCJA 1L7RA 1LDGA 1LKZA 1E2UA 1NVTA 2BFDA 2E4UA 4DR5B 1Y7PA 3LPMA 3N7TA 2QX6A 4PTLA 1HEUA 2B82A 3KNZA 3N8NA 1AUQA 5KNDD 2PH1A 1VP3A 1SD5A 1Y7IA 2J41A 2QTAA 4RESA 4XOUA 5G41A 5M3BA 5CDTA 3CPEA 1JZQA 3MJVA 1N2BA 3OEYA 1HZZA 4W6QA 3GROA 4ND8B 5F78A 5EIFA 4U0KA 2RB5A 4BMPB 4P0QB 1Q95A 2PMWB 3HUNA 4JCCA 1OXBB 5DGDA 5HF8A 1V16B 3REGA 4AY4A 3MELA 1XB2A 1PWHA 1BXRA 1TYEB 2QX9A 3OZDA 4YB8A 2O8CB 3B6KA 2PWPA 3IQZA 2ZRPA 5HJ2A 3INRA 1N2ZA 2ZIWB 2AMVA 1UPTA 4LRUA 2YWCA 3RS2A 4C30A 3DHNA 3UWSA 1AZLA 2VF8A 2ZYUX 4JBHA 5IW8A 1NTOA 1IE3A 3BWDD 3GLHB 4B3DA 2OXRA 4TTJA 3H18A 3TOCA 4D7AA 2BKAA 3JWHA 3PDJA 5TQVA 2C5AA 4IIJF 4BE9A 3K9BA 2RHGB 4FFMA 1T4MA 2PMFA 3SQWA 2G8LA 5AJXA 3I72A 3AERA 5HIIA 4CKBB 1JDUA 4A5SA 3UICA 3EVBA 4PNHA 5DDIP 2XY4A 4NTZA 5JIBA 2BHTA 4ZTBA 1PEAA 3QVLA 3SIPA 1BH2A 2VT7A 5LB2A 3ZTWA 4DLWA 1I4DD 2RHLA 1ZVKA 3PQ5A 3RE1A 3GDWA 5IULC 1SQFA 1G41A 3QU4A 3IDZA 4MJLA 5JPIA 2QTHA 4TMTA 4BMXA 4LJ5A 1YDFA 2VCEA 1CUAA 2BHNA 3HVKA 3R5KA 4OD0A 4L7VA 4KYVA 2HD4A 1DI0A 3FMPB 3P2IA 4BZXA 4PG8A 1P91A 4FM9A 2BGTA 1EUDA 3BIFA 2EL9A 5I9SA 2QJOA 1KARA 2B7CA 1Z6GA 2HCFA 2HK7A 4RLQA 4XSGA 5LVAA 2JJMA 1YR8A 4HH3C 2VEDA 5L6MB 1RXVA 2AR0A 1MO3A 2I5PO 1M2FA 3FTEA 1M1YA 1VL8A 4ZOLA 4PYIA 4C6TA 2X7HA 4LOAA 2FWRA 2GK4A 2ZWVA 4G23A 2OBLA 4Q34A 4IFBA 5DNCA 5CTAA 1QVVA 3OKPA 4YXFA 3ONEA 3STTA 1RC8A 2Q1WA 4AUNA 2I62A 1QR6A 2E4ZA 1CBUA 2XKBA 4OVKA 1W76A 2DE0X 2BZSA 2IVZA 2ZW9A 3N8GA 3FHLA 2MSLA 2HV9A 4K9NA 4X44A 5C3MA 1RXIA 2YFQA 3C3JA 2DT8A 1VC2A 2Z04A 5IAOA 4FP9A 4TLDA 4WOJA 3CO0S 4UD2A 5AM3A 3PI6A 3PK0A 3S6JA 3L6CA 1J4AA 1E7YA 2V45A 4EB6A 2HLDD 3OJ0A 4J3NA 1A98A 1DX9A 3UBTA 1MIOB 3DOHA 3MRTA 3GO4A 3ZGNA 3HSSA 3RU9A 2FEXA 1ZX1A 3I8SA 3RRXA 3A9VA 3MQ2A 1C41A 3IBYA 4KXQA 3FF4A 2QZSA 1LBQA 2NYVA 3M0EA 1LTKA 4K9SA 3D43A 1XXHA 5J5CA 3SJAA 4BTLA 4WVFA 2IS6A 2WVHA 3A1TA 5C1IA 3IC5A 3SQOA 5HNKA 2C4NA 3O1IC 1J97A 2EHDA 3OPMA 4YRKA 3URMA 4FIZA 1WMAA 3BXPA 3CH5A 3UT6A 2PJUA 2FSPA 2BDUA 4GI7A 3ESXA 1IHPA 1BD4A 3SEFA 1D03A 2AUNA 5E9JA 1JWBB 4W7IA 1I2CA 1PK9A 1T15A 4JS0A 4ZARA 3CLKA 3AJDA 2F9FA 1OHHD 3TLJA 4TKZA 4DAEA 2FSFA 4YMUA 1GADO 2PBZA 4AC9A 1E5XA 3NO4A 3ZWMA 5ALXA 1ISFA 3ZJTA 1X7WB 3WMWA 3JR7A 4IXMA 2OBBA 4V0LA 4F04A 2P2ZA 2VG8A 2CGEA 4YJ3B 4FDUA 1C81A 1EFKA 2X2EA 3SKVA 3DF9A 1J8YF 1WVGA 5HRCA 3RC1A 3DAOA 4OYHA 4F92B 1D2RA 4LKRA 1NKTA 3CZ5A 3QW4B 5I7FA 3DEZA 2FEWB 2ZUVA 2JH3A 4HMOA 4RVFA 3ZI0A 1L7DA 5A7GA 1LLQA 4O0MA 3S3TA 1RHQA 3WKAA 3WSTA 1EXVA 4LF7B 2IP1A 1Z4KA 2Q6LA 2ZS8A 4OJKA 4Q3LA 3GI1A 5ALDA 3S1LA 5BWBA 5L4SA 3AR2A 2OHOA 4BTVA 4MYUA 1GARA 2OCDA 4HXFB 3U7JA 4BRWA 4PCVA 3H75A 4D4MA 2Y1XA 3OEWA 4I5FA 2K5UA 2V65A 3NAZA 2PUEA 2ECPA 1UDCA 2Q3MA 2YC2C 4U2GA 1EA5A 1UFRA 2PRZA 5FORA 1N5KA 4OK5A 1AHPA 2FZVA 5GZ3A 1U2PA 5U4QA 3JD0A 3MJHA 4NNPA 5TPWA 5CH5A 5BW5A 3Q7RA 4OQPA 3C98A 4HX5A 2X58A 5EPEA 4WY5A 4UQLA 3MAGA 1M2NA 1US8A 1FP2A 3I23A 1Z34A 4Y3UA 2VF5X 5EE3A 3TG8A 1CVRA 3N86A 5EVJA 1V8ZA 5T3UA 3D0OA 3WZLA 3RJTA 3ED1A 3ZUGA 4WZAB 3AC0A 2RGGA 1N0IA 1W19A 4OG2A 1ZAYA 4W5OA 2ZYDA 3ROKA 2PPLA 2GETA 1SUCA 2XD9A 3JQGA 2WHPA 4HQFA 5DJ5A 4M9QA 3NHRA 2W11A 4IGAA 1EM8B 4Q3DA 1GZ4A 3BMCB 2NXNA 1W35A 2FJPA 2PSEA 3ONDA 1FRZA 3DVAB 3TRDA 1LW6E 1OOEA 2Y1WA 3GX1A 1IDN1 1P0FA 4QU8A 4RACA 5AI4A 5F7ZA 4BPRA 4ECEA 1R5NA 4P3NA 2UZ0A 3MBOA 4MS1B 3FDXA 4XTRA 4A26A 2OZVA 4CL2A 5HKAA 1DO2A 1NVVQ 1RHKA 4YRTA 5ES3A 3NJRA 4YLEA 1C1DB 2JEOA 2XNDA 3N2YA 2ANCA 4GEKA 2YUTA 5IBCA 1Y6QA 5F12A 4CLRB 3O95A 4EW3A 3P0RA 4DR7B 2A59A 2GD0A 4YWHA 3MEQA 1UDWA 3WLIA 4HGRA 2C5SA 2GARA 1Q50A 4EHKA 5L3QB 3ZWKA 4JD5A 4D46A 4HAVA 2PLNA 5JZ9A 3RHSA 3O7MA 2ZWOA 1ODIA 2HKIA 3BRQA 3DA8A 3DBHA 4K81B 3FUUA 4ODIA 4TPKA 3GN1A 1XDUA 3IE2A 1BE1A 4PWYA 5DCUA 1V7CA 2Q4BA 4QBHA 3HMQA 5BR7A 1HQDA 4IW3B 5LYYA 1SOUA 3GXOA 3SYNA 2ZZMA 4AJ1A 2V58A 3TSAA 4WKOA 3EZLA 3ICVA 1KI8A 1QIIA 3B78A 4QNMA 4RF3A 5FI1B 4DDTA 4LPKA 1HQKA 2PQ2A 3X1WA 2JVJA 3HKEA 1FLDA 1UBJS 3AEUA 3MRXA 4NE9A 5BQFA 2JLRA 3SOPA 1VPDA 1W44A 4TMXA 3A1EA 1XNQB 1QYRA 4MLPA 1U0JA 3A6HA 2ZBDA 3ICOA 4XYEA 1LPSA 1WR8A 5FOSA 3TE7A 1XTJA 3MTAA 3UK6A 3E53A 5NLLA 3OKAA 2W71A 3C24A 4PS0A 3TK1A 1L4UA 2AJLI 3DMGA 2JHPA 2GJ8A 4LQLA 3PS9A 4ALIA 3WLAA 3BS4A 1Q3TA 3USCS 1TXGA 3DDZX 5JJ5A 4J94A 4F72A 1GL6A 2W42A 2XECA 1T2AA 4KQJA 3BWEA 3ZKWA 3JAMA 1RFGE 1CJVC 3CIOA 4Z49A 1UDXA 3AVOA 4MQUA 3HI4A 4RTSA 4DPLA 4O33A 2ASVA 1QGED 2EBFX 4DWJA 5CVTA 3H4TA 4OLFA 2QQ5A 2C8KA 3CVXA 1TZJA 2ZRFA 2IW1A 1NJ1A 2ZUWA 1FW8A 1ZQ9A 1L6IA 3JQDA 2AEEA 1YJXA 4EMTA 1F1JA 3IAEA 4G86A 3H2ZA 4FLFA 1X14A 4TLMB 4AZ3A 4Z54A 4CG1A 1XVVA 3Q10A 4C76A 2OFOA 2XQIA 4RY8A 3WYGA 1EK2A 3AUKA 4N76A 3QVMA 2OESA 3GAAA 2BI4A 2WUFA 1KAOA 4WY8A 4MKFA 3FPSA 2P30A 4HDRA 2A8YA 1TX4B 4IVNA 4RSHA 1NM5A 4X1IB 3UPTA 2G9VA 2YRFA 3V8RA 3HKBB 4CHTA 4PLZA 3I8OA 1G0NA 1Z25A 5FWAA 3UJCA 3BWVA 3QF4B 4XH9B 3QM1A 2O9JA 1H23A 3KYCA 4QYWA 4ITRC 1GQSA 1G5PA 3K1AB 2QD1A 1V9SA 2YZGA 2FP4B 1W49A 2J08A 4LDAA 3WI7A 4HRVA 1W9HA 4LHWA 1TEXA 4V24A 1GQQA 5BOVA 1CE8B 3COSA 1JKFA 5IC5A 3OZAA 4PBRA 2R751 2XX3A 4K3UA 4EQ6A 2Q0SA 1DLJA 3GGPA 3MGGA 1SXIA 2FZGA 4WX2B 1XV5A 4L5YA 3CG0A 4XQ0A 1YVRA 3FPEA 3C6YA 5CM8B 2PG3A 5KWIA 1S02A 1OTHA 1ZD4A 1AB5A 2HU8A 1SHZA 1X7ZA 4ZO6A 1HYBA 3GZNB 2B37A 2CWWA 3SD7A 2J4DA 4CF3A 3RS4A 3SJZA 3FOWA 3M5DA 1E6WA 4PZLA 4QPDA 4Y6RA 4W9MC 5A4DA 5KNBA 1XKXA 2IXBA 4UM7A 2ZJBA 5JH7F 2NZVG 2RK4A 1MW8X 5HMMA 3TUIC 2FFBA 2G04A 4OHRA 4MVJF 2YRXA 1I3KA 1KJZA 4MI1A 3KOZA 1KY3A 4X71A 5AOCA 1N33B 4ZPJA 4UCQA 3DO6A 4X3OA 1ECBA 4JL5A 2HADA 2HX1A 3D6FA 3M83A 5JMWA 3GLGA 4UMEA 3G2IA 2J6HA 3JZMA 4NBNA 3OFSA 2WWTA 1PFKA 1VE7A 5AJUA 2GM4A 4OLBA 4N48A 2WWRA 1ZESA 4JVSB 2K2WA 5ELXA 1QP4A 2HAEA 3ILSA 4YQYA 2ATXA 5JWHA 1EXWA 1X2EA 5CJJA 4GQBA 3FUVA 1IXRC 2MCFA 1Z6AA 4H15A 1R0ZA 3WSVA 3L0BA 4MW9A 2OCLA 4PXSA 4LMPA 2QDXA 4H17A 1FJ2A 1MC5A 4BFYA 1HOXA 2HWYA 5IABA 1NIPA 2QW8A 2YXLA 2EKPA 2H9YA 3EW9A 2NXCA 4XPIA 2AI1A 5P21A 3U9SA 2NSJA 1IHDA 2V7BA 3DZCA 3DOEA 1OPXA 3KQYA 3C2QA 3OPVA 3TXXA 2CBZA 3LS2A 4RGQA 4HNVA 1QQ6A 2ILTA 3IMFA 1LI7A 1U7PA 3AJ9A 4L57A 1EQAA 2AK2A 3RVKA 1E1LA 2ZPUA 3GDOA 1MQ9A 2VYQA 4QBTA 4M1MA 2BLLA 5AW0A 2Y9MB 1F8GA 3BERA 1XJCA 3Q87B 3C3KA 3ENVA 5M5BA 1KQGA 4I4IA 3KT0A 3PQDA 3JQAB 1Z2NX 3G9TA 1FQKA 4GGPA 4CLHA 3N2KB 1H4SA 1N32B 1V8BA 5DBEX 3B2EA 5FOTA 3RYTC 4H77A 2NUAB 3H5IA 1GQRA 2FEOA 2ZKLA 3CX7A 5F4BA 1L3CA 2GTIA 5NULA 1FUYB 3TOVA 2BSQA 4U7TB 4RZQA 3T5BA 3FOCA 4J0IA 2W4IA 2PKRA 4JJIA 1KI9A 3LBFA 3GUVA 3CONA 1Z56C 4ZI7A 4RV4A 4U7JA 3ROQA 2F1JA 2ZE7A 3ACDA 4Z8XA 2D5IA 3DOUA 3NUZA 4MV7A 3QFTA 2G82A 3DE4X 4WWHA 5LWQA 4TMKA 3L7NA 2NU9A 4WTOA 5T6MA 3TS1A 5HM6A 2SKEA 3VPAA 4WCFA 5ADUS 2X9QA 1SA0A 4N3AA 3TUZC 1QFZA 4QYIA 4X3CA 2G4VA 3GJ3A 5I51A 4JGBA 4J1QA 1S1CA 4UEOA 2J87A 2QW1A 3TXAA 3VQTA 4UZFA 1P7CA 1E7MA 1RLMA 4XIYA 4NC9A 5G02A 3NDRA 4WECA 4JLNA 1Y9JA 4MRPA 1X19A 2OCIA 4QGGA 1C50A 5GTDA 5DN9A 3V8NA 2W43A 2FRDC 4BN0A 5LJLA 1D7AA 1AN0A 4JLKA 4RGVA 3GJ7A 2C4WA 3OEHA 2E1PA 3LQ2A 4XYMA 4FB5A 3TIGA 4KZKA 1S7GA 3QRWA 4PGFA 3PGVA 4RPLA 3K20A 2VZEA 3QUSA 1GRQA 3KAQA 3VOSA 2I76A 4EITA 2WF7A 1NNLA 4GO1A 5JUWA 1QG6A 1BRMA 1QIDA 1U0EA 2YV4A 1RR6A 5KWJA 3FCSB 3EF1A 5EYPA 4L5IA 3MTJA 1NBME 3HADA 4Z3OA 2P6RA 1HYHA 2G3YA 2JD1A 4U8GA 2WT8A 2O5CA 4O8CA 4TUYF 1PV1A 3HV0A 4PQYA 4KAJA 5DASA 2PT6A 4JXZA 3N87A 4HDNA 2Q1UA 1XCOA 1UKEA 4M8NE 3SJCA 3N0TA 1UAGA 3SQXA 2DEUA 3G2NA 1X1EA 4CL8A 1RZVA 3TFWA 3KHSA 3KZOA 1VL2A 2AZXA 3EAQA 1WP4A 1J9GA 2PGXA 2XMSA 2AIRA 3MUFA 1GQYA 4D3XA 1ZICA 2GKOA 2A0UA 4P0PB 2GI4A 4JOQA 3OCWA 5DHPA 2VCYA 3DDOA 1F5SA 4HNQA 4DIDA 1YDMA 2K7FA 1ADBA 4FK8A 4JNCA 4Q7JB 2V7EA 3NTRA 5DEOA 6AT1A 1KSGA 3ROPA 4Y0AA 5BV0A 5I7EA 5GP1A 1G3QA 2LTAA 1PT7A 1H69A 3GPBA 3GV0A 5DGCA 5IYZF 1OIVA 5CB6A 4URYR 1R6AA 1C0KA 3FTNA 5ALGA 2HSJA 3SICE 1GT6A 2BFMA 2DX7A 5C3UA 1YFLA 2IX9A 3TR5A 2A1UB 4IG4A 3BJIC 1F2VA 1O6ZA 4HUTA 3DYIA 1TKAA 4UU7A 1Q92A 1CW2B 2GA8A 1QKIA 2HJSA 3VTAA 1DXYA 3PQ2A 3UZUA 1E7QA 1M8FA 5MGNA 1VPWA 2VK8A 3AR5A 2ACKA 2F7SA 4KTVE 4F6CA 1GYPA 5J1TB 3TZBA 5IC4A 1PQWA 5KCMA 1X74A 5BSGA 1F2TB 5EHZA 2ZJ0A 4URZR 3M4YA 1XN1A 1C8KA 3LHIA 3Q72A 2WTUA 4JOBA 2ZAOA 2Y76A 3E82A 5EPUA 1PD0A 4HNGA 2J9GA 4HFRA 3W2HA 5FQNA 4P80A 3V1YA 4YUAA 1A3CA 2FR8C 2ADMA 2C20A 1DG3A 1AQJA 1EDEA 1X1AA 1U9JA 1IG3A 4FDVA 4G0XA 2RAFA 4WK6A 4TYNA 4D0NA 5EIEA 5KSPA 4KO1S 5SY6A 3FWKA 4BP3A 1B26A 1NJ6A 1MU0A 1OE0A 1PSDA 4YBZA 2MT9A 3R7AA 2VH2A 2X41A 2PMCA 4PHTA 5A06A 5KWVA 3UFXA 2JFUA 4S1VA 3OZGA 3PX3A 4W82A 4B2IA 4JR2A 2FDRA 1L4YA 4BY9E 1RS0A 2Q07A 2VLIA 1VZ2A 4RW0A 4A6DA 1S2GA 4KX3A 4BKQA 4BX9A 3BG5A 3QWHA 1P72A 2Y3IA 3IUNA 1E3IA 4X41A 1G2OA 4TZTA 1CQZA 4LJKA 2R0QC 4EAQA 3M5CA 1JDNA 1OSNA 2PKEA 2ZBEA 3MWFA 1PGJA 4CMHA 4DT1B 5A3JA 2P2DA 2W6IA 5TQJA 2DHQA 3NGMA 1CWUA 1BKYA 2AG0A 2J3KA 3IBCA 2P6UA 4JJ6A 4BX2A 2PSSA 1AV7A 3WX0A 3D7KA 4PY2A 2PL5A 1JS1X 2R5NA 1BZYA 2EGGA 4ER3A 4PW0A 4H59A 3UWKA 1XELA 1N0VC 1ADCA 5EIBC 2QX4A 1FFGA 2Y27A 2QP3A 4K88A 4RPKA 2C78A 4CM8B 1ZMRA 2GJ4A 1RP7A 1I4OA 1AMNA 2QNBA 1DBIA 4BWYA 4DSTA 3KJIA 3WQQA 2JRLA 4PAOA 1QG0A 4IEFB 1EGHA 4RFSB 4Z86A 1T6BY 4CR7A 1QX3A 3AW8A 1QIFA 3MZ0A 4QICA 2JATA 4EL0A 2VJDA 2VHTA 2PL1A 2RGXA 3EDRA 3DBLB 3EVZA 2CHUA 4U3JA 3OQ1A 1NQTA 2EBHX 1OLXA 2YHSA 1JALA 2FUEA 3ZG6A 3OE4A 3QPDA 3R0ZA 3QEMA 4AJHA 2RHCA 3HRIA 3M3HA 4CKEA 1GAWA 2IHKA 1A8UA 1O58A 1UXJA 4OO3A 1ABEA 5FLYA 2CVZA 5KX5B 1HE5A 3O26A 3WICA 3BHMA 3ZPXA 3HM9A 3ICWA 4C1BA 3BWMA 4I0WB 4IUDS 1XOIA 2H3EA 4RA9B 1XWIA 1EDZA 4KAXA 2EATA 4A10A 3AVWA 4X6XA 1ZUWA 2V97A 1DRKA 3X1KA 4JVMA 4YRJA 5M7EA 2GSDA 2REBA 4KWEA 1U8CB 5FLXA 1L9KA 3D2CA 2H31A 1W4CA 2PUVA 3SI7A 4BNGA 2A9QA 3E9YA 4B8ZA 2OCKA 4ETWA 4EX7A 1JFSA 3THWA 4MUHA 1IEVA 4KPUA 5JHGB 1TM5E 2XXJA 2EXXA 2EKLA 1Y42X 4O4IA 2G1AA 4ALKA 5HTOA 3NP7A 5HKLA 1H6AA 3A3NA 1OA1A 2V6IA 1BDIA 3G2KA 4RELA 3TINA 1QGYA 4ID9A 5D6NA 5HDBB 3ZDBA 1JAXA 3NONA 2ZFUA 5IBRA 1KOFA 2RH9B 4LSMA 1Q83A 2TMYA 1N9GA 2D00A 2XNDD 4PYNA 4DV6B 3EGWA 5KDOA 4CEHA 1SUDA 4KVAA 3MFDA 4W8HA 4N49A 4TM8A 4NY1A 2BHRA 4UM5A 3QYAA 2QRHA 4HLQB 1EGAA 3D4LA 1QSGA 2EP8A 1YBFA 5DI9A 2CXQA 2A9RA 3AFHA 1L4GA 1TECE 3GWZA 3MOIA 3MTDA 3HCNA 4GBGA 2COUA 4PO3X 2C98A 5LP6F 3LWDA 1RRKA 2FMIA 1J07A 1QGZA 1AXGA 3NOVA 1IN1A 1DC8A 2ZYTX 1Z06A 3BZUA 1V41E 4GMHA 4E1VA 2K7ZA 2ZVPX 3AU8A 3R23A 3CB2A 2WJHA 3K2BA 5J23A 1WWKA 4OXIA 3KELA 4RDIA 2NPFA 1TO6A 4XXHA 4MUNA 4F4IA 3BICA 1DFGA 2X3FA 1XAIA 4PX2A 1ZH8A 4GT1A 3UMBA 1KO7A 1GUDA 3BHJA 5KYUA 4BEWA 1G66A 2QZJA 2QL9A 4UU1A 2UDPA 3A2MA 4FYKA 3A04A 2NO9A 5I9LA 4AKEA 2Y05A 2O7VA 1UBHS 3L6EA 2XUZA 2F9LA 2XXAA 2FWMX 3EXHB 4FOPA 2H1HA 5AVOA 1C9KA 3R7SA 2OBXA 1GZ3A 4X60A 4C4SA 4DLXA 2H4WA 4EVRA 1P1CA 3RYCA 1G5TA 2Y6UA 3M4XA 3ND9A 4OXXA 2PGAA 3HWRA 5CNMA 1FZQA 3VUFA 3U80A 4M1ZA 1NUTA 2COKA 2M1ZA 3E03A 3EQZA 3B70A 3S7TA 5IDYA 3IAM6 4JJ7A 2NP6A 4AY5A 2V3WA 5CUQA 3K9QO 1ONOA 1XYGA 4IINA 1K3TA 4DR3B 1NDQA 4DV1B 1D5WA 3JARA 3L8MA 5ULLA 3VNQA 1SCKA 1DDIA 2OILA 5BMOA 5JOQA 1U3CA 5EXSA 4JQSA 4MV1A 3P2JA 2FSUA 3LXRA 5B6IA 1PR0A 3VHLB 1R6BX 1MH9A 5TMDA 3PXAA 4P32A 2GEJA 4LX8A 3LUJA 3BK7A 2FQYA 3DJYA 2J3DA 4N9QA 3DYBA 2P0AA 2NVOA 3I37X 4FMDF 3TZQA 3CJQA 1ECCA 5JJCA 4A6PA 3FUTA 3KE9A 2W2TA 1GD1O 3IVGA 3FHTA 2VTBB 1H9CA 2N1MA 3O9MA 1JQDA 1MF7A 2Q2WA 2XIJA 3EXG1 1WKVA 4IEEA 4CM9A 2QV0A 5B1YA 5DULA 1ZD5A 4CRWB 4V02A 2P91A 2YYYA 3HBLA 5ESDA 2FWBA 4JI7B 1UMCB 4FYJA 3OQVA 2GD2A 3KTFA 5FYQA 5EMHA 4RTLA 3KJXA 2VRCD 3AETB 4LXXA 4FGUA 1K5DA 1FVFA 4AX4A 1NW3A 4EGQA 4CEIB 4FU0A 2VAXA 2FWIA 4BJ5A 1QKJA 2ZZNA 1XRJA 3CLHA 3TNLA 2AUMA 4EF5A 1XF9A 1EAMA 1YJBA 3AB3A 4MQLA 3C3EA 5CLGA 1MTOA 1U0TA 1BHSA 3D5EA 3ZZUA 3FPAA 3SS8A 3AJRA 5K0TA 1LZKA 2BY4A 1GLGA 4MQMA 1NR5A 1E5QA 1LBTA 4OHXA 3VPXA 2XA9A 5LLTA 3OZSA 2EGHA 2YWFA 2C2BA 4L51A 3R6LA 2A0XA 3S5UA 3T3DA 5A7FA 3GMIA 3HCEA 2RC5A 4OHVA 3EGXB 1AOXA 1O9BA 2BDTA 1C1XA 1OX4B 1WTAA 1JU3A 1OGIA 2ZTLA 5KNBD 2DBVO 4IYJA 4OQXA 2GLXA 2J4FA 2O7RA 5IWAB 1VL5A 3UAOA 3P9CA 4JLDA 4K1LA 2IIVA 2Y1CA 1B3RA 4M7RA 3RRJA 1YR9A 4CMCA 1ZJWA 3FSRA 2VAVA 3EXHC 3IYLW 4WSOA 4FE7A 4RSMA 3MJFA 4CWAA 3FY4A 2BUCA 3QELB 2XVYA 1XFDA 4KN8A 3RTGA 4ED9A 1G20B 5MFZA 1AGPA 1E20A 1JKJA 4FSDA 4TTPA 1B0AA 4RU1A 3G3EA 5AUNB 4RTNA 2PMKA 5SICE 3D5TA 4YMHA 3A37A 1GVHA 3MT7A 1GKIA 1U3FA 3I4CA 1ZQ1A 3N0VA 5KYWB 1CZHA 1OW3B 3PHJA 2IU4A 3D31A 3HDTA 4LYAA 5AJTA 4CR8A 1YVEI 4F5YA 4JP1A 1DC7A 4NATA 2JVIA 1AKYA 2O2CA 4IICA 1RWVA 3BD8A 3P9NA 1GG9A 3PV0A 4EGJA 1E6MA 3EF0A 2GMWA 2D06A 2JD2A 3OMXA 4RBNA 4AO8A 2Z6QA 1GNLA 2G9ZA 4YT8A 4Q12A 1MABB 2QTRA 2M6SA 3FVVA 2ZBUA 5CURA 2D2XA 2C9MA 3TDKA 3SIXA 4B4KA 4EKEA 2WF9A 5B3KA 2WHRA 2ZTVA 1CD5A 1E2GA 1QGDA 3HUFA 3SZOA 3RB8A 3GFRA 3U5TA 3HDVA 1U1IA 2XR1A 3R5SA 4W63A 5AKGA 1U2SA 4Q3CA 4OJTA 3NGXA 1PX0A 2JKYA 4XD7A 3V1LA 4DB4A 1UC4B 3FMOB 1J8DA 1ND6A 5CX4A 2IP4A 2JJ1D 2YWBA 2IY7A 5J1SB 3N8DA 3RKSA 2ID4A 1ZDMA 4U1RA 3DPUA 4HNAA 2R1VB 2R68A 3EOBI 5T41A 4E3ZA 3GJ6A 4WBSA 2A86A 5G53C 3OG9A 4AS2A 1UFOA 4L9AA 2BH9A 1MAUA 3CUSA 4GRDA 3RHZA 3BX1A 5FUXA 1X1RA 3EHDA 5DHFA 5B37A 4ZOQI 1PZHA 5KYTA 3PQFA 3CW8X 2CHVA 4LNUA 1LWNA 4R16A 3T4UA 3WDSA 2VP6A 4LJ8A 1J8MF 4PSKA 3W8FA 4W5TA 2X0RA 2VSQA 3R3SA 2FAXA 4YBRA 1S2OA 4W7SA 2OQRA 1GUZA 3RK0A 1Q2UA 2EERA 1CUWA 3Q1KA 1SGWA 3ZFNA 3RVJA 3A1FA 1U1EA 1VYUA 1NMEA 2CFTA 2PV7A 3IKVA 4PVDA 2ID9A 3KZNA 2HF8A 3OU2A 4H9JA 2ZSJA 5BSKA 2Q50A 1JH8A 1P2VA 1NQAO 1P44A 3EFOA 4EABA 1CY4A 2O0MA 2NN3C 3AF0A 1ZKDA 1ZOSA 4GZ6A 1IWOA 2HSEA 4R1QA 5AW4A 1P73A 1IBCA 3DDHA 4PFSA 1E2EA 1J6UA 3LDHA 4BBPA 3ZJ4A 4TN1A 2NZXA 1TLTA 2UXDB 4D26A 3NPMA 3IHTA 1EP9A 5HBRA 4GF5A 2AHOA 2G63A 4M6WB 2LCQA 3OEHD 3UW1A 4YS6A 5FA5A 3RJZA 2Q5FA 2H2WA 5CK4A 4DG9A 3ZE0B 5CITA 1JSCA 1GGNA 3CRW1 1EA7A 1WBJB 2OBYA 2RARA 3ZQJA 1XTIA 3KOOA 4A2QA 4OOFA 1W34A 1OXMA 3DQPA 4EJMA 4OA5A 5G0SA 3VZQA 3CCCA 4Y2QA 5FI3A 1OH8A 4YRRA 3PHBE 5JJKA 1CETA 1TZ2A 5K3OA 1PT9A 4J07A 1KHHA 4LGVA 5BO5A 1D5CA 3RUHA 1TFRA 3UJ7A 4F9TA 1I2AA 2JI9A 3H11A 4W7HA 5EJ4A 4HBGA 2PLRA 3ENKA 4O6VA 5JC8A 1GGMA 3HWWA 5D7NA 1NNSA 4COOA 2Z5VA 1E9FA 4UEJA 1PHPA 2NADA 5I5EA 2AW5A 5TPZA 3SOZA 1GTSA 1R6XA 4D4HA 4Y1RA 2MMGA 2QU7A 5DCLA 1P9NA 1ZM9A 3COYA 3VR4A 1BAPA 4JY7A 1L7MA 1YACA 4PX5A 1E66A 4ND3A 4AP6A 4R3NA 3L4SO 2WY2D 4B3GA 3FRHA 2E6KA 2YY5A 1CUZA 1L1QA 3IUPA 2I03A 3AF5A 4MW0A 4TGLA 4TT8A 4ZZ1A 1WBDA 5BQXA 2F6RA 1TM1E 4PYQA 2VA9A 3PVZA 3TG2A 3HGQA 3B20A 3JCZA 3KUXA 3NBFA 3Q7QA 1M2VB 2NU6A 2ZRMA 3HN2A 1XP8A 4ZO7A 1N2EA 2H4XA 3DPSA 4YRPA 1DQNA 2FG6C 3AFGA 3T99A 3X0DA 1DAEA 4DC1A 2WAMA 4HI0E 1X3SA 1JXQA 1QCZA 2BJVA 5CXXA 1QC5B 4DABA 1V9LA 1IY2A 1SUPA 1S1MA 2JGEA 3B6MA 3L7MA 2ZBQA 4G0YA 4V0QA 2UUAB 4AF6A 5ARBA 2BFCB 4HRAA 2FPXA 2JGRA 1E69A 1SG0A 2PTHA 2QF7A 4IG9A 2I2AA 4EEZA 2WFLA 3MWJA 3U26A 4BUCA 5JECA 1ZW1A 1DUVG 2GNAA 1P4RA 1PJBA 3OQBA 4MTCA 3WKEA 4MLCA 2XZOA 2WD8A 4BO3A 2G1UA 1KEVA 2VDOB 2BBTA 3SX4A 3TIXB 3LQFA 2VHCA 4LE0A 3KVNA 1FFAA 2JCGA 4ZO9A 3UJ3X 4QNNA 2HTEA 1M34E 5J2TF 1Q14A 3ILXA 1GUBA 5JI2E 5AVTA 1NF3A 2DTEA 4X63A 3WDKA 3R0IA 4AN4A 4BO9A 1D9XA 3EASA 3ZBUA 1MJGM 2PGDA 2QS9A 1DAHA 2QJTA 5EJFA 1W4AA 1NN5A 1Y8RB 4DBLC 1FSGA 3NS7A 3EPJA 2JIBA 1VMKA 3GLHA 3LX5A 5WRFA 2H1LA 3T5CA 1KMCA 5BUZA 1E1RD 1UDBA 1RZUA 4FVTA 4RCVA 4Q9AA 2RE8A 1XHFA 5LQCA 2VPWA 3RS8A 3X2SA 5FR1A 3AI2A 4AP5A 4ZCMA 4MIYA 1J0AA 5EJ9A 1IZ0A 2W6ID 5IDXA 1YDEA 3NKLA 5KHLB 4NBSA 5AXAA 2ZXUA 4C05A 3AOEA 3LRPA 1Z74A 3FH0A 4BQIA 4G2TA 1BS1A 3LPAA 3F73A 4AI6A 1MRNA 2EJUA 4G5YA 1NZJA 2O06A 4RY9A 4HHEA 4LTDA 3RW9A 3L7DA 4TXHA 2CFOA 4IHJB 1PGNA 2Q5LA 3E9RA 4C7MA 1X1CA 2YZ7A 3IUBA 4UTRA 1Q0PA 1ZUD1 3ZDRA 2PQ0A 4P08A 2Q7DA 2W48A 4OPMA 1XDSA 4EPWA 2SCUB 3RC8A 2PFGA 3DEIA 2BH2A 2GBFA 3R3JA 3CN7A 3EIQA 1AO3A 3HCRA 1KE2A 4H1WA 3CXUA 1UJMA 2BP7B 1XCJA 3KOUA 4G1UC 3RTCA 2MSNA 1JEDA 2ZIEA 3DZHA 5DRTA 2HCRA 1GUFA 3MINA 4FMCB 3NDJA 3HGMA 1GPYA 2QN8A 3X1DA 3BWCA 4EG7A 2NIPA 1IBKB 2QX8A 3VTZA 3K1JA 5G1PA 3UYLA 4QPNA 3H1BA 1RBQA 4EYSA 1C80A 4OIFA 1OUMA 3E22B 1LBEA 5JR3A 1WF3A 4QXPA 3BJEA 2WR8A 3T3MB 3GY0A 4HEHA 2VJPA 2BZ0A 2OWDA 3F96A 1CY8A 1K6EA 2WJ4A 2J7PA 2YQZA 4QXQA 3W8NA 2FF7A 2FP3A 2WTAA 3CX6A 3FPCA 3ITNA 4Q4DA 4DLTA 4G8CA 5GVSA 1KGDA 2WVAA 3I52A 1SVLA 4XAQA 3CJTA 1SVSA 4MV8A 3PDIA 4XLLA 4DUGD 5IXYA 4NYJR 4L27A 1L7EA 4XEUA 5IAAA 3TKLA 3WYAA 4B34A 1WVMA 1MIOA 1Y1KE 3MBKA 4YALA 4GPTA 3VSAA 3GRKA 2KE5A 3QJGA 3O4RA 1OZGA 2ZAYA 3L0OA 1CDEA 5KAMA 1RQLA 3FYCA 1SC4A 4N01A 5FKJA 3FBGA 3C4JA 1HE1C 2WT4A 4DEYA 1B8UA 1V4VA 4GS5A 1GUYA 4YPVA 3THOA 1SU7A 2NMVA 2Y71A 5BQPA 3LM8A 1TT5A 2W70A 1KJJA 5K3DA 1JQ3A 2FPRA 1IJEA 1N3BA 3GRVA 1GTRA 3ZE2B 5BURA 1PS0A 3LC7O 1KY4A 1ZL0A 4V0NA 1MKYA 4YRFA 1RMYA 2C8VA 4RTPA 3ZGOA 1OYOA 2B61A 4GR5A 1UINA 5B2EA 2WF5A 3ZVMA 1FYEA 4A0FA 4GGOA 2QRKA 4KOAA 4XASA 2I8AA 5AJYA 1AHIA 4LDQA 3V8MA 3PGLA 4H27A 3QPCA 2C04A 3C3XA 1S3SA 4YJ2B 3K2IA 4X7PA 3IMKA 3O84A 4ICIA 2WF8A 3DDCA 3TQQA 1EVYA 1UXIA 3A4NA 2Y1KA 2DKOA 5AVVA 2YKGA 2QYOA 2GCPA 5CVJA 3WYCA 5CB4F 4KXWA 3OZRA 2DQZA 2GYWA 4KFUA 4OFBA 4US1R 4Z8YA 2PL3A 4NU6A 2CNNA 4MW7A 2HREA 3BMNB 3PXBA 5F3RA 3OX1A 1O97C 5ECWA 4NP6A 4URVR 2BRUA 4K0KB 2GPTA 3D1LA 4JX8A 1ZM7A 2A0KA 3GFQA 4IOKA 3SX2A 1XT6A 1VLZA 4O4LB 2XUQA 2RG7A 3Q7TA 5CLHA 1H2BA 4C20A 3A1NA 5AW7A 2PN1A 1IBMB 1FFHA 4FS3A 3WXBA 1B3BA 2ZUSA 4WESB 1SHUX 4QTYA 3SYKA 3UKJA 1V3UA 5C1OA 2Q6VA 1UXGA 3R44A 4H7KA 2AOXA 1FEZA 1R16A 1KWGA 1HTWA 2PJRA 3DEFA 3ZE9A 1RKXA 3N39C 2FW0A 5JZBA 5COBA 3CLSC 1IIRA 4P81A 1QHNA 3NVMB 2ZULA 4UTNA 2EOAA 4BP1A 1YZGA 1ZEMA 2XUGA 1E1NA 1Z22A 3C0KA 4LJ9A 3WLSA 1NVGA 4C0XA 3ZY4A 4C3ZA 1WCYA 1LS1A 1UEIA 5BVHB 1DVRA 2H16A 2C4VA 3G7UA 5CFZA 3NM6B 1MQ8B 3HXMA 1YZQA 4OXRA 4EJ2A 5A4JA 3LIPA 1NG1A 1U5BA 4R5MA 4RV5A 1LF0A 1NFQA 3SM3A 4IBOA 2C54A 2L18A 3LECA 4Q3EA 4B43A 3KYDB 4X97A 3PCRB 3QQPA 5B53A 3UAXA 4B6OA 3DKIA 5GINE 3URKA 1IZ9A 3CLTC 4LGMA 3DEHA 4QSHA 3NASA 3SLRA 1FDWA 2FX3A 4XRRA 1QPGA 4CG3A 2VYNA 4UBKA 3DCJA 3OSZA 4RD0A 1GPNA 4EG0A 3IIJA 1ZHHA 2SHKA 3MB8A 3RU2A 5FYDA 8GPBA 1Q22A 1TCVA 2ZI9A 5EFOA 4CLRA 4IVPA 2VNAA 4PRLA 2R96A 4C01A 4ZO8A 5L3QA 4K6KA 2WJPA 3Q88A 2AJDA 3WIUA 2BCEA 2P6PA 3F90A 3Q7IA 4BLRA 4ZI2A 3WGUA 2ZBVA 3SF0A 1XRPA 2CLEB 3JAWB 4HWPA 3OLYA 4F4JA 5DXAA 3A7EA 3FFXA 5ALRA 4HPWA 1AD2A 5J58A 1QWOA 1FTWA 1OLSB 3I2IA 4JBGA 3ZU4A 2HDHA 2D5AA 1S7CA 2H07A 3AB8A 3GK3A 1EKXA 4BDSA 4CIXA 4C29A 1M2WA 2MSWA 2LPMA 3P2EA 2C84A 2WWXA 4BYMA 4DF3A 4UNIA 2W2MA 4LCEA 4WE3A 2X2PA 1XEAA 4HVAA 5L6LB 1JQEA 2IK8A 4X3PA 1KYVA 3DHWC 1OIWA 3U7QA 3QLJA 4Y30A 4IDGA 2HRRA 3BC1A 3AG5A 3DDNA 1NKVA 1N1EA 1P8AA 1T8YA 2ZI6A 5FH9A 3KD2A 1UQUA 5LUBA 2FU5C 1L7AA 1YR2A 5TDHA 4IJUA 4JIMA 4QU9A 4CYMA 1E1DA 2HT6A 1Y5MA 1IN8A 3QBEA 5I45A 2XE6A 4N0DA 4D3YA 4NARA 3ABIA 4RD6A 2F2TA 1B6RA 3EZGA 5L3ZA 4EG4A 2F17A 1WLYA 1G3MA 1ZCJA 3PKJA 1L4HA 1P1BA 1OYWA 2AG1A 3PWKA 2DFPA 1I4TD 1CF2O 4LIPD 4MV0A 2HDOA 5J4YA 1O4VA 4YV1A 1T1GA 3A2LA 3KAKA 1CQPA 1U8ZA 2IY9A 2OV4A 3G9ZA 3S68A 1KS9A 3ZN2A 4G26A 4NENA 1WCXA 1F8UA 3TOZA 1C9NA 1H8HA 1S3FA 1SC6A 4HZIA 5DGTA 5TLSA 4GEGA 1LDBA 3O8QB 4UQPA 1WMDA 4CF5A 1PJTA 2XE7A 4BVAA 1K7XB 1ADGA 5BNTA 1U63A 1KI1A 1ORRA 1UFQA 5FQOA 3BCUA 3RJ5A 1M10A 1Z5GA 3PHIA 3N2EA 2FZWA 1N3LA 3VC7A 3K1YA 3S8EA 3UMFA 1FDTA 1RWOA 2WKWA 3CO5A 4H6PA 2J5RA 3HSYA 3HKBA 3K9NA 2EJWA 4CI9A 1LI4A 2ZYWX 1MJNA 1IVYA 1RM3A 2EP5A 4H7PA 4J7UA 3QF4A 2HWKA 3F5SA 3AKCA 5LC1A 3BRSA 3BKWA 4JUIA 4WXPA 4QG3A 2XZTA 2DLNA 3C15C 4A36A 3X1MA 2FW9A 2QN1A 4U2DA 3JQFC 4BNJA 5I9TA 4CW7A 3PYXA 2VCHA 4D99A 2V5VA 4PV7A 1BVRA 4WINA 1ORTA 1A7UA 3DW1X 2KHZA 3ABZA 3U7GA 4EMUA 1CQXA 4GYJA 1JHAA 1I1QB 1KJWA 5HS6A 3H8SA 4WNAB 3WNZA 3T5GA 5HIKA 4X8OA 1QF7A 4KUHA 4H1UA 1JHXA 4RULA 3IX7A 3N07A 2YZ2A 1DARA 1SQGA 3QVUA 4TRRA 1Z4IA 4DN6A 1F0YA 1KI7A 4LZZA 5ALHA 3GJ8A 3WV4A 3DXZA 1YMVA 4H9KA 1OZFA 3EEQA 3ZI7A 1XD8A 1KKLA 2QTLA 3GZNA 4RJIA 3V8BA 1MAHA 1SR8A 3SZUA 2MWMA 1C8BA 1FXSA 5K0LA 1MFZA 1YU9A 4WLVA 5C2JB 4KLZA 2A9OA 1EYZA 2XW6A 3RS7A 1FVHA 2GVZC 1RKBA 2WAAA 3MFQA 5IZ4A 2CJFA 1PJ2A 4TV8A 4P4GA 4AJEA 2ZI7A 1ESEA 1Z6TA 3FWZA 3ZU3A 4DQLA 1N6NA 2IEAA 3SJBA 5HKKD 1FTNA 1T43A 1JTFA 2I91A 1IG0A 3PE3A 1HT0A 3E7DA 1FJGB 5KTOA 4N8EA 1C9JA 1EMDA 1TQ4A 1GNSA 3NTXA 4PFKA 4C08A 1I7DA 4D42A 1JZTA 5AVWA 1ZD8A 2P1DA 1XPOA 2VAPA 3CRNA 4X93A 5F2OA 2V3VA 5KKNB 5FOXA 1QUFA 4AO6A 3T06B 4JITA 2VNKA 3H5NA 3LPLA 4ML3A 1EFVB 2B30A 2BJHA 1XZEA 3OQIB 4MRRA 3DKRA 4LE2A 4Q82A 4Y1FA 5EP1A 2WUDA 3UAYA 1QRRA 2Q5IA 4W9NC 5CBPA 5DEIA 4UOQA 1SC3A 2DR2A 3LFUA 4J9UE 3E3AA 2Z6VA 3JQ6A 5FBQB 4AS1A 3OLWA 4QLOA 2HZ7A 4KKVA 1NN1A 2OORC 4O4HB 5F33A 1OWOA 1ZFNA 5FL7D 4A8PA 3ZWQA 1CR4A 1T2CA 1UBFA 4GKAA 1ZN7A 3E2PA 2C4TA 3AHGA 1H42A 2KLBA 2LRHA 3I01A 5B58C 4BMVA 1CR0A 4HDKB 4TKLA 4E15A 3FNEA 4GUAA 3B9QA 3WWCA 4WL0A 3BMXA 1RLTA 3QX8A 5AJVB 3CQ9A 4LISA 1XALA 3RD5A 3DBRA 4I1SA 4H18A 5EHGA 4EKNB 2AG5A 3VR4D 4L4ZA 2RK3A 4F6RB 2PH7A 1NMZA 2ZTUA 3KR9A 3WISA 4J7CA 3WZ2A 1JU4A 1BN6A 4CUKA 4RZIA 1GNQA 4YJFB 1TEVA 3EUEA 1ZXBA 4HYTA 1UP7A 5F21A 3SBDA 4U6SA 3G0IA 4OM7A 4YFVA 1RYBA 5L3SA 1UOOA 2WFAA 3BZBA 4PYRA 1DDGA 1ZU5A 1TLFA 3DBIA 1R0SA 2DBRA 1Y3AA 2PH3A 4I14A 1PQPA 4N6OA 3OUUA 1BN7A 2C8JA 3QXCA 2PZ8A 2O2GA 1GM5A 4CM3A 1C9EA 1L1EA 1TADA 2B4AA 3AKZA 1I13A 2C0QA 2O0LA 1DBQA 2YFYA 3GFBA 3VR6H 1Q7TA 5JRDS 3ZD9A 5DCYA 3O9ZA 2HWXA 4N47A 3UB4A 1XU9A 3RSHA 1VXOA 5TQ2B 3DTYA 3HXTA 3WSWA 2JRCA 3ADOA 5CAEB 3KSZO 1WP9A 4H31A 5COAA 4KQ1A 5KB3A 1KK1A 2VZ9A 1HRKA 2PXXA 4TKMA 4LI3X 1XZLA 4LXIA 2G28A 3FLAA 4UEQA 4Y7DA 4DLPA 2BEUB 1J90A 3C7TA 3EC7A 4UNNA 1UMBB 3T5AA 1NP3A 3C7CB 2B8NA 1A72A 3LQ1A 3X3HA 1PVVA 4N39A 3GAMA 4DCCA 3D81A 3MD0A 2I8CA 3U3DA 4E1AA 5E6RA 5H4GA 4O2RA 3RUFA 1GOTA 2DPGA 1RD4A 1R3DA 2XMRA 3IS3A 3LMKA 1VJDA 4FN5A 3BDVA 4IIXA 4IQ0A 5TRTA 4BV8A 2HMWA 3OIWA 1EFUA 3V5NA 2INGX 3L0CA 5DTIA 2NAPA 4XX1A 2BR5A 4Z6KA 2AH5A 2YXNA 3NG1A 4L4SA 4S3MA 1N6OA 1UMDB 1SIBE 1YGPA 4B6FA 3GN2A 4F5WA 4DYHA 2A5YB 4O2AB 4D3ZA 4S1OA 4ZGGA 2PKQP 3SHWA 4B1FA 2AFHE 2VQ6A 3PC3A 3D8BA 3PGKA 3TGWA 5KMGA 3IT0A 4YT2A 4HGOA 3H1PA 2PZBA 5JVDA 3DV0B 1N2JA 3BSFA 3MTEA 5DLQC 1X1TA 5GOZA 2ZWPA 2OOKA 5EA2A 1Z6QA 4S04A 1FJXA 2VPTA 2ZSKA 3LI2A 4HP8A 4WPGA 3VR0A 1L5KA 2ZP1A 1IZ8A 1DRVA 1V3TA 1QH1B 1VKHA 1OBFO 4HXGA 3NHYA 3VYUB 3DE1X 4G9BA 4RANA 4DIBA 5JNVA 3TEJA 4O59O 2HOQA 3HBNA 1Q11A 3MRVA 3TFQA 2DPXA 2YINC 3O92A 4JEHA 2MINB 5DW0A 1KFEB 1KMMA 4MGEA 3C7DB 4J43A 4ZVUA 2XF8A 3DMNA 2AYZA 2Q5EA 3VKGA 3BPSA 3I1JA 3N74A 3F67A 3DT8A 2GPBA 4YROA 4BUJA 3DTVB 3ZHQA 1PWXA 2B8TA 1EX9A 4KQ2A 2D8MA 2ZRNA 2D5CA 3IBGA 4LRWA 1Y1LA 2QD4A 3M9WA 4KQKA 1SXPA 1RAFA 1RU3A 4BEVA 5HCIA 3WS7A 2ZBPA 3FWHA 3U3RA 1OFHA 2ZJ2A 1YI8A 4BVEA 1G6KA 1VGQA 2V0CA 5E9AA 2PGLA 1Y34E 2MSDB 2XZDA 3H19A 2DVMA 3KL4A 5IMBA 2AR7A 1MBZA 1NF2A 3IQHX 4XVCA 3SDSA 5K4GA 2XQFA 3T7TA 2E2WA 3DT9A 2H52A 4HUQB 2VP0A 4HH1A 4DKXA 1UKYA 1SBZA 1WZIA 2GZ2A 2J7PD 3I58A 3LRTA 3QIAA 4RVCA 4F8EA 1U94A 1DG9A 2I4OA 4GQAA 1TJ3A 3CZ4A 4BKRA 5JRZA 3B3FA 4NJMA 4TM7A 4MQFA 3TIFA 5FUMA 5BQ3A 2JFPA 2VDPB 3OETA 3DWIA 3VNVA 1ZHFA 1YJ8A 2GM3A 4YV2A 5FV7A 1SZJG 1L5QA 3NHUA 1ACJA 5I8WA 2V4UA 3M6AA 2FPSA 3MUNA 1KIFA 3CV3A 3NBYC 3U16A 2OQIA 2UUCB 5F2EA 1O9GA 4HWOA 1B0ZA 3ET5A 4HOYA 5KJEA 5JS8A 2MR5A 1W1IA 3I92A 4JBIA 4WNYA 5EWLA 2YXPX 3MTBA 4GOJA 4U2FA 2EW2A 3OTHA 4PS1A 2H4HA 3T0GA 1T5OA 4FX5A 3ZFOA 4WKPA 3VPSA 3D2LA 2NZWA 1N3IA 2YFKA 4UUQA 3OLVA 4FTWA 4ZVRA 5AI0A 2A0YA 4LWZA 4DCSA 4JNKA 1KAEA 3MPUA 1NXWA 2O7NA 2WLTA 1CVLA 3V8PA 1KFCB 1A2OA 3HU5A 4FWBA 2HJHA 1QPBA 2X6RA 3C1AA 4DLSA 3L6BA 1P75A 4HADA 4BNXA 4UTVA 2I6FA 3K73O 1ZA1A 2E4AA 2OXFA 3LV8A 3PBKA 3CBGA 4MPDA 4DCMA 3W1EA 3BXOA 1JFFA 1VBMA 3C6XA 3MTGA 4L75A 1OCEA 2O59A 2CB0A 1H1TA 3MF4A 3I2YX 1II8A 1WW2A 4Q3KA 2GH1A 2RGUA 2NAFA 3B60A 2EZ8A 3GIWA 3IT2A 3O91A 4GC5A 4JLSA 4YV7A 1QHGA 1RQGA 3WC4A 4RFSA 2P9FA 2OHFA 5DYIA 5KSYA 4NULA 5AP9A 5IT5A 3A9SA 4QPCA 1B4DA 3GELA 4PQFA 3WGHA 4H6XA 3YASA 4WH0A 3V4RA 1QS0A 2CJXA 3M1IA 2VF4X 1CJTC 4YJGB 1DAPA 1F06A 1VCOA 1KAMA 3DBLA 4OOEA 3RVLA 4NPCA 4U0JA 5H5JA 4EY3A 4QEZA 1U28C 1J8VA 1YOVA 2R00C 3O2NA 2EL7A 2O5RA 2PCLA 3IILA 3P32A 4AJKA 2I7VA 2IOFK 3ZK8A 5KX5A 4H6VA 2WIBA 3EX7C 3I34X 2AOTA 1YS7A 5LMUB 1YZHA 3EIHA 1K08A 1XMPA 1EM6A 3B48A 3DE7X 2DWUA 3H0KA 4RA9A 4TTAA 3LXXA 1I01A 1UF9A 3H04A 5KSWB 3IKLA 4BJ3A 3BWYA 3TL2A 3ZDYB 1Z7YA 1FRNA 3KAPA 5HFNA 4ZVLA 3DCNA 4ARVA 3TW6A 1AK1A 1WAMA 2I33A 4QLAA 1IN5A 3WBFA 1A8SA 1GEGA 4BMDA 4CKCA 1BJKA 1G18A 3ZLJA 1SU6A 3O2QB 2TECE 4WKCA 4WY2A 1C7RA 1GG8A 3WYFA 2JARA 3RV3A 4Y98A 5LQRA 1SKQA 2XYQA 5DYGA 2PUDA 4L74A 4OSOA 3TBKA 4XM1A 1JEYA 1E5TA 1NW7A 2QVBA 4DM4A 4GWKA 1IEQA 4RKQA 1J0DA 3T1VA 2HK9A 3NC4A 2VPQA 1A4IA 4JCOA 1DCKA 1A97A 5CA0F 2RBKA 4IDCA 2NXEA 4OLAA 1QLHA 3A0RB 1QP7A 3KEOA 3P20A 3QYFA 4MHTA 2TYSB 5ITWA 4D9FA 4LBZA 1VI5A 3U19A 1R4MA 1N5DA 2CL7X 2C7BA 1IN6A 2F48A 2NV6A 4ZHQF 3U3MA 3UK7A 3ODPA 4IDDA 3EWNA 1ORIA 1EFCA 1JHDA 1H0HA 1KGSA 1XA3A 3DR5A 4BMOB 5HXAA 1C5KA 2W2OA 2F3TA 1CX9B 2XCUA 2GAIA 5CGZA 5DYWA 2RI1A 1L4FA 4JODA 3GL9A 4RIEA 4YECA 2QPLA 3FKQA 4DCTA 3B52X 1K1EA 2ZUEA 2RJNA 3LUCA 3N9IA 3NEAA 2A67A 4FHFA 4RMHA 5EC8A 4WD3A 3ZXIA 4WIAA 3W5DA 4EELA 2HMAA 1FNDA 1I3MA 2A2ZA 4WZAE 4ZEMA 1G9XA 4UNQA 3PVCA 4X1YB 3TRFA 2R6DA 2R1TB 1V8PA 1DQSA 4GLFA 9LDBA 2BZGA 4Q93A 4RF4A 3SLGA 4C06A 3M5PA 1O96A 4BMCA 3LQKA 3V32A 5KVVA 2NUPA 2H54A 4DQUA 1XKTA 2PK3A 3TQCA 1FFXB 3HNRA 1JV2B 3KB1A 1L4NA 2O3JA 2A4MA 1RLJA 2VBCA 3CPHA 3VYRB 2DWQA 3R3XA 3IA2A 5ITZA 1QZTA 3L1KA 4Q9LA 3W4IA 2IFTA 2QE7A 4WDRA 1QXSA 1XL0A 2WIFA 3FTQA 4U9UA 2QTTA 5IJ9B 1GZVA 4FW8A 3OOHA 4K8OA 4KL8S 5EPOA 1SJ9A 1QQBA 2FFHA 1P80A 4OQQA 1H4TA 4LY6A 3QI7A 1H8EA 3B1XA 3BKXA 4J1SA 2H0AA 3B3GA 1BFDA 3QLVC 4UD6A 5CW1A 1GZ7A 4EMBA 2YBEA 3U61B 2ONKA 2VTKA 4F4DA 1UJ6A 2W6PA 2H8GA 2BFOA 2GM5A 5CYGA 3TLGB 2CLFB 1CYDA 1G8FA 2WAXA 3GC6A 4I5IA 1H8HD 3QP9A 5IBQA 5CG1A 1XNGA 3TW0A 4WZBB 3M9XA 5ER6A 3WBKA 2I6TA 4A82A 2WUGA 1M74A 4B2YA 4UEKA 3AFNA 2B98A 5JDIC 4ALNA 1D2HA 1OX5A 4V3BA 2J45A 3V1KA 2DU8A 4QE3A 1U81A 1W2WB 3V7NA 3CPJB 2VTBA 1B2RA 1P45A 4IZHA 2CLIB 3SX0A 4D3DA 1WUYA 1UJNA 1UL1X 4CIBA 3IUMA 4RHXA 3AO0B 2AYXA 1BWPA 3HXPA 1PYOA 4YFYA 1R0CA 5A3QA 1UMCA 1R8XA 2IUYA 5I9NA 5L3VA 3ZCTA 1DQPA 4R68A 3AUAA 4YASA 4FT2A 5K2MA 1ZW6A 4UFNA 3KZCA 4XWTA 5C1BA 2X3YA 3K53A 1MA3A 1BJTA 4F38A 4CEIA 1TUBA 1SKAA 3H3JA 4WUTA 2EQBA 3DDSA 1XRLA 3HUEA 4AN1A 5CLJA 2R8EA 4PYKA 2D0IA 5EFZA 3HYSA 2UZAA 1QAQA 2C88A 4LVNA 2WMYA 1JLMA 5TVGA 2IV2X 4DGQA 3JPYA 2WE7A 4YN3A 4DARA 2XTAA 3KVVA 1NLMA 2JFNA 2FV8A 1L6RA 1XN4A 2PO7A 1MJ5A 3QBTA 4MVJP 2Z57A 3RQSA 2G0AA 4Q02A 3KJQA 5LXTB 1QYWA 1XX6A 2ORIA 2P5UA 2CJWA 3O8NA 5EZ6B 2J3QA 5JWOA 1X8KA 2YWJA 1F12A 3L5OA 4J0CA 4XB6B 3HA7A 2ZT5A 4O02B 1MO6A 2CUTA 3N8KA 3MMNA 3E7WA 2Q0XA 4M2LA 4XOIA 2JGDB 5PGMA 3WL4A 1F8YA 1OX4A 4IWNA 3V80A 2WJZB 3RVMA 2GXSA 5KYXA 5COQA 3SJUA 3SIRA 4PTZA 3VKHA 4EUSA 4ASUA 1RM0A 4MV3A 3WTCA 4RKEA 3EWSA 1W52X 3U3ZA 5BY2A 3P2OA 4W9RA 2W6JA 3CR8A 1H1LA 2IUSA 4TS3A 4EFKA 4EHFA 3MGBA 4RVDA 3UH0A 1ZGZA 3QA9A 1DWOA 4ZTUB 3HL0A 5FUWA 2C82A 1Y0BA 3UVEA 3W6UA 5CJ2A 2WIJA 1TTTA 4UKDA 4MA4A 4WN9A 3FCOA 4AJNA 4Z7QB 3I6QA 5KYWA 1TJ4A 1PJSA 2PEYA 2JA2A 2JFWA 1EK1A 2WTBA 5E4TA 2FR0A 1BCSB 2QL5A 5FOQA 2BFFA 1EZ4A 4CMKA 1U4SA 5TGTA 3ZW8A 3OZCA 4YCNA 2CCKA 1ATZA 1WSAA 1P3DA 2GDZA 3AP3A 3OLQA 5DPMA 4LMBA 5JISA 2YIMA 4M3NA 3GEIA 5HEKA 1PIWA 5IJ0B 2WWWA 1JT2A 1U8EA 1XZFA 1TA9A 4QL3A 1A8PA 2XCLA 4HPXB 3P9QA 1QV9A 3SQNA 1YRYE 2FCRA 2QPTA 1NOIA 1MABA 1VJ1A 4G6ZA 4HS9A 1VB5A 3PXDA 1NJ5A 2VS1A 3RO7A 3T7EA 1GA1A 1LSSA 1VA4A 1G8SA 1YE3A 1Z8FA 2UVQA 3QVSA 4JU9A 4W1RA 4EECA 1VMEA 3BQ9A 1XDZA 2F3UA 4JHLA 3UAGA 4JT8A 3ANNA 1DEKA 2A5JA 2I1VB 1YZFA 3ANXA 2N42A 4KAFA 4NEGA 3BXZA 3LT5A 3NVKI 2FGKA 1NX6A 1X1QA 3WKCA 4DVGA 3DBOB 5H59A 3BHIA 3D64A 1WHSA 4LSGA 4XGNA 4XGIA 4AG5A 1WETA 3IBSA 4ZO4A 1AKVA 4QDJA 1E2HA 2HF9A 2O2ZA 2ONZA 4KOEC 1YKFA 4MW2A 1P5RA 4KH0A 5ED0A 5BNIA 3AI3A 4PG6A 3TW4A 1HQYE 1E1CA 4K28A 1RKUA 3DNFA 3N2IA 1P33A 5DI3B 3FTCA 3G1UA 3OZXA 2GN2A 2GRUA 3NYRA 2NTYC 3CVOA 3D7NA 5CXUA 1XZIA 4RKYA 2XCQA 1J21A 2CHFA 2FDXA 3MIZA 4RQAA 1DO0A 5CX1A 4PRYA 1G5QA 3F49S 3K0AB 2R6AA 5BW6B 2Q4DA 2B3TA 3SDBA 4AM8A 1RE1A 3SHFA 3V33A 4YRNA 3KIPA 3NEJA 1J06A 1WBBA 1QIGA 1XLUA 4N0EA 1JFVA 3GQBB 4HAUA 3PCTA 4DOMA 4K2HA 4OMDA 3OC6A 2OCGA 2QQEA 1YQQA 5B6JA 4LBWA 4ENWA 2EWMA 4WERA 3VOAA 5LM3A 2D1QA 2Q62A 5F3DA 2MJLA 1YK1A 3JTEA 1I24A 2XMBA 4KIUA 2J48A 5DWQA 3HXOA 2FPLA 3ACBA 4G97A 4Q1BA 4KXXA 4XDGA 1L4MA 1OXUA 3PA8A 2BGUA 2P68A 1EHYA 3COJA 4Q39A 5ES4B 2HYIC 1WULS 3T3OA 1ISMA 1E63A 3CSSA 2X42A 1XKQA 2C5EA 4JQYA 3RTBA 4EYKA 1X92A 2D2FA 4G37A 2VSXA 4DCGA 5LMNB 1CUYA 1SHKA 2OLEA 4OGWA 2XBLA 4PPYA 3MCWA 1XVUA 3O0DA 4MJ3A 3UB2A 1LTHR 4ND7A 4LF6B 1Y6JA 3G0CA 5EIBD 3QKTA 2ONJA 1H5QA 3IQWA 3E4DA 5L3RA 1YR1A 1F0KA 3KBOA 3ZDCA 4BNKA 4B5KA 1U11A 4Q7EA 4RK5A 2HIMA 3TBHA 2JANA 2R9VA 1FK8A 2GEDA 1I33A 4TXJA 1GKLA 1SKMA 2DBZA 4QOHA 1K6IA 5FNVF 1ORHA 2NSYA 4OB6A 1DLIA 3KHTA 2GVNA 4DLKA 1Q17A 4PN7A 2HU7A 2GCOB 1AZTA 5LZ5A 1N75A 2AFIA 2H85A 2YUIA 5CDFE 4HUJA 1YZUA 5D6OA 4OIMA 3ZTTA 1T2FA 1LLCA 1ODCA 2Z09A 4IXDA 4YQEA 1YAHA 3VYWA 2AOUA 4L8WB 5EIWA 5SYAA 1DZIA 5LZ2A 2V6MA 5K05A 4X95A 1W4RA 1XD2B 5K51A 1MHTA 2JAWA 5FB3A 4C4TA 1VRVA 2FPIA 1GTVA 1X80A 3RIGA 2KWIA 4B84A 1ZNWA 2W8BB 4ZU6X 3TZLA 3GCDA 1Q1ZA 1ULBA 1QC5A 1XHLA 4MMZB 3T9CA 4DMUB 5DVZA 1DQZA 4QGSA 4R40A 2FPPB 3NVAA 1H0KA 3LF1A 3ZXSA 4CR6A 1KH1A 2XOKA 2V1XA 4I9NA 4IOMA 3PYLA 2BFCA 4Y2YA 4YR7A 1DBVO 1SOAA 2NO5A 3L7AA 1KK3A 3OE5A 2HTFA 3RQIA 3C16C 3W5HA 5DLDA 2BLNA 2VDMB 2D4HA 4IXNA 1KDVA 5CG2A 2G9RA 6REQB 2AQHA 5ESXA 1M0SA 3SFZA 5A6SA 1QK5A 1YUBA 1I7NA 2FZCA 3FOBA 4IS3A 4MR7A 1RYHA 3ML1A 3HJBA 1AS2A 3IO3A 4UNPA 1O5TA 4BB5A 3GRCA 5JDCA 4NBTA 2Q1XA 1FF9A 2Y92A 2C9OA 3U13A 2ZVQX 3W5SA 3FI9A 5JQWA 1P31A 1X13A 1JTEA 3TQSA 3LK6A 2RHRA 2DR0A 1H22A 2R5FA 4GR9A 4OQ4A 4Z9FA 4DJAA 2C9BA 5K3FB 1BC5A 1CJMA 1Y1QA 2C7GA 2BKEA 3LGAA 4C1NA 1HM5A 2AT1A 5CGQB 2XITA 4FFWA 4K9MA 5JEDA 2O8EB 4BUZA 5CHEA 2PA3A 4XIIA 4JI5B 1Z4JA 1O5OA 4OJQA 1BA2A 1JLSA 2L69A 4TYMA 1OI7A 3OPQA 2OYRA 4BQEA 3ADDA 1N2SA 2YW9A 4JL8A 1Y6ZA 1QVAA 4EI2A 4ZOAA 1Q20A 1IQUA 1U8AA 2FSIA 3JWEA 4ZOLF 3HDGA 3ZCQA 3NT5A 3CKYA 3LFTA 421PA 4CIVA 1EDDA 2IU0A 1LQ2A 1WDTA 2CMHA 4BX3A 1A50B 1ISPA 1GZ6A 5JYBA 1RWMA 4K1XA 3I76A 2AXNA 4YCLA 4NAVA 1UQRA 1PCXA 2I6XA 1T13A 3S5JA 4PFQA 5CU7A 1Y9AA 1W93A 2QSYA 4QGHA 4GL2A 4RIIA 4MVJH 2IHUA 1SN7A 2R62A 2BMEA 3K9WA 3EMDA 4HZUA 4YIKA 1RJEA 4HQLA 4O25A 4N3NA 5HGJA 2F62A 4QJIA 4DQXA 5A6VA 5BN3A 4MV4A 3LYUA 1P0PA 5KYYB 4F9GA 3AY7A 1GLVA 3S1AB 1IY0A 3F6SA 5K6TA 1U7HA 2A5DA 2A6PA 3E22A 3IURA 4F85A 5IANA 4DMMA 2NG1A 2BL4A 3ZS8A 5JSYA 3IVXA 3C3YA 5AIAA 4FBMA 3X1XA 2ZUFA 1IPFA 1CIJA 1AU9A 4DSUA 3FZEA 4XX0B 3RI3A 4ND1A 4PYLA 3EXAA 1FU4A 3DE5X 2QLLA 2ZQ5A 1F6DA 2OUKA 4FYWA 4MKXA 1NONA 1OWLA 2QLMA 1TMKA 1LF5A 3E05A 2X5NA 3LDGA 1RJ9A 4RK4A 4WKNA 4M8KA 5IAGA 1NMQA 1Q3HA 3B53X 3F71A 4IM7A 4K46A 2I65A 2TMKA 4MUGA 3A6PC 2JAXA 3NT2A 5BMVA 5JNRA 4KIJA 4HRXA 2VKQA 2NT4A 2Z3ZA 2BCJQ 1Q2XA 3LOQA 1V5FA 3O3NB 4RNCA 1Z88A 3MB5A 2QMYA 3HJCA 3OC0A 2Q4TA 2ZZKA 3KJZA 4I2VA 4JZKA 4L6AA 5E7IA 3U40A 1KEUA 1E3QA 5BSHA 2FRXA 4LY0A 2QI9F 5JSUA 5IDWA 4B80A 1WCWA 1QAMA 2QTBA 1W73A 4TMYA 2B2XA 3E1KA 1JJBA 3ETCA 1IPEA 4W5HA 2IX3A 4BIMA 3HWX1 1PZEA 3GLTA 3ZUPA 4L6CA 1BA3A 3EQ7A 2C99A 4EHJA 4WBNF 3PPWA 3KOWA 5IMSA 1XTZA 2WG2A 1GAXA 1KYZA 3FNRA 1CEEA 1R4NB 1NOKA 2D54A 2IYXA 4NWIA 1D0IA 5IARA 5FIUA 5K8JB 2AX4A 3OT5A 1XTQA 2H63A 3PUVA 4IX9A 1JKXA 1O57A 2CXUA 2HI0A 4DYDA 3HEMA 3H2KA 5AI9A 3A4TA 3E9EA 4WZAA 2PMEA 3GLIB 3RFUA 3REOA 2IHYA 4J0QA 4RE6A 4X8HA 4EW2A 2D3WA 1SD2A 1P19A 3KJFA 1M2HA 1Y1SA