1INVA

A sialic acid derived phosphonate analog inhibits different strains of influenza virus neuraminidase with different efficiencies
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
390
structure length
390
Chain Sequence
EPEWTYPRLSCQGSTFQKALLISPHRFGEIKGNSAPLIIREPFVACGPKECRHFALTHYAAQPGGYYNGTRKDRNKLRHLVSVKLGKIPTVENSIFHMAAWSGSACHDGREWTYIGVDGPDNDALVKIKYGEAYTDTYHSYAHNILRTQESACNCIGGDCYLMITDGSASGISKCRFLKIREGRIIKEILPTGRVEHTEECTCGFASNKTIECACRDNSYTAKRPFVKLNVETDTAEIRLMCTKTYLDTPRPDDGSIAGPCESNGDKWLGGIKGGFVHQRMASKIGRWYSRTMSKTNRMGMELYVRYDGDPWTDSDALTLSGVMVSIEEPGWYSFGFEIKDKKCDVPCIGIEMVHDGGKDTWHSAATAIYCLMGSGQLLWDTVTGVDMAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A sialic acid-derived phosphonate analog inhibits different strains of influenza virus neuraminidase with different efficiencies.
pubmed doi rcsb
source organism Influenza b virus
molecule tags Hydrolase
molecule keywords INFLUENZA VIRUS B/LEE/40 NEURAMINIDASE
total genus 94
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.18: Exo-alpha-sialidase.
pdb deposition date 1994-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00064 Neur Neuraminidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 1invA00
4FPFA 4JF7A 1MS9A 7NN9A 1NSDA 1DILA 3TIAA 2F29A 4KS3A 4GJTA 1Z4WA 2VSMA 1XOGA 4FPLA 1B9SA 4B7MA 2BATA 2HTRA 4QN3A 4KS2A 1MZ6A 2RKCA 2HT5A 2YDPA 1SO7A 4MX0A 1USRA 2C4AA 4FPEA 4GZOA 2QWKA 1L7HA 4GZXA 4NN9A 4WA4A 1SLLA 3D12A 1EUUA 2CMLA 2W5NA 1W0OA 1B9TA 4FOQA 1Z4YA 1W1XA 3INBA 4M4VA 1W8NA 2F25A 1DIMA 4YW1A 2QWBA 2HU0A 4GZQA 2HTQA 2QWEA 4HZZA 1V0FA 4XJ9A 1IVDA 4GDIA 1NCDN 4FP2A 4FVKA 4QNPA 1A4GA 1W8OA 4KS5A 1NMCA 4CPNA 3TICA 1MS1A 3TI6A 4MZAA 4FPCA 1IVEA 3TIBA 4B7NA 1N1YA 4FPYA 4I00A 3CL0A 1Z4XA 5HX0A 1INYA 4YW4A 1V3EA 1KITA 4YZ5A 1S0JA 2F13A 2YA4A 4WA3A 1INHA 1B9VA 2QWAA 2VW2A 4WEGA 3B7EA 3O9KA 2AH2A 4HZWA 4XJRA 1MS3A 2F28A 2HTUA 4FQ4A 1N1VA 2VK7A 4D8SA 1NNCA 1VCJA 2F27A 1NMAN 2VVZA 1EUTA 4X4AA 4YZ3A 4XOGA 4M4UA 4XIOA 1INFA 1F8CA 1EURA 5B2CA 2BERA 3SLIA 3SALA 1INGA 4B7RA 1USXA 4H52A 2QWJA 4XJZA 4HZYA 2HTWA 1Z4ZA 3ALWA 2ZB6A 4KS1A 4FPOB 1VCUA 4GEZA 2XZJA 4XILA 1E8VA 1F8DA 1MS8A 1NNAA 2VSKA 3A72A 3TI8A 4QN7A 4WEFA 3PJQA 4K1IA 3BEQA 4XIKA 1NMBN 4GZSA 2F26A 4MZEA 2VWDA 1NCBN 4XHBA 1NSBA 3K39A 4NCSA 3GVKA 1V0ZA 1W21A 4UF7A 3JU4A 4M3MA 2W20A 3CKZA 3OPZA 4QN5A 2F11A 2YA7A 4KS4A 4BBWA 4CPZA 1SLIA 1W0PA 4QN4A 1L7FA 1INVA 4HZVA 3SILA 1N1SA 3K38A 1IVGA 4H53A 4GZWA 4K3YA 1L7GA 2VK5A 4X47A 4QN6A 4X49A 4YZ1A 4X6KA 2HTYA 4MWUA 4FOYA 3K36A 5HUNA 2X9MA 3H73A 4FOVA 2QWDA 2HT7A 4HIZA 1S0IA 3H6JA 1NN2A 4MWQA 4MWYA 4WA5A 4FJ6A 1IVFA 2XZIA 2F24A 2YA5A 4M4NA 4K1KA 1INXA 2SILA 3H71A 1MWEA 1BJIA 3D11A 2HT8A 4MWVA 4FPJA 1F8EA 4K1HA 4XJQA 3TI4A 1MS0A 4J9TA 2A75A 4MWXA 2YA6A 4Q6KA 4XMAA 3O9JA 3A71A 3GVLA 3B69A 1MS4A 4FOWA 4CPYA 4FPGA 4XJAA 3K37A 4CPLA 1V3DA 1V0EA 1Z50A 4SLIA 4CPOA 1E8UA 1MR5A 1NCCN 2XZKA 4GB1A 1NNBA 5JYYA 2JKBA 2VK6A 5HUKA 2HTVA 1NCAN 1MS5A 2C4LA 2QWCA 5NN9A 2AEPA 1MZ5A 2F0ZA 3GVJA 5F9TA 1W20A 1Z4VA 2W38A 1WCQA 3NN9A 3ALXA 2AGSA 3NSSA 4MC7A 5B2DA 4FZHA 2HU4A 4XMIA 4FP3A 2QWFA 4FPHA 4HZXA 2SIMA 2QWIA 5HUMA 4MWJA 5HUGA 5M1ZA 3W09A 1N1TA 3SANA 4GZPA 1V2IA 1IVBA 1E8TA 1EUSA 1A4QA 4XYXA 4YZ2A 3TI5A 1A14N 2FHRA 2ZB5A 4YZ4A 1NSCA 4NC5A 3CL2A 1V3CA 2AEQA 4K1JA 2F12A 4CPMA 4YW3A 4MJUA 4B7QA 2SLIA 4GDJA 1IVCA 1V3BA 1F8BA 6NN9A 4YW5A 4XJUA 2QWGA 3H72A 2BZDA 4MWLA 3K3AA 3T1EA 2BF6A 4MWWA 4XJ8A 4B7JA 2VW0A 1WCSA 4XJWA 4XE9A 2YDTA 1SNTA 2W5OA 2YA8A 2B8HA 4DGRA 1INWA 4GZTA 4MWRA 2F10A 4MJVA 1XOEA 3TI3A 4FPKA 4XHXA 2XCYA 2VW1A 4YW2A 3CYEA 2QWHA
chains in the Genus database with same CATH superfamily
4GNBA 3DASA 4FPFA 4JF7A 1MS9A 3V1SA 7NN9A 1NSDA 1DILA 3TIAA 2OJHA 2F29A 4KS3A 5FZJA 2FP9A 4GJTA 1Z4WA 2VSMA 1XOGA 4FPLA 1B9SA 4B7MA 2BATA 2HTRA 3BYCA 4QN3A 2P4OA 4KS2A 1MZ6A 4AH4A 2RKCA 2HT5A 2YDPA 1SO7A 2ZWAA 1C9UA 4MX0A 1USRA 2C4AA 4R40A 4FPEA 5F72C 4GZOA 4ZLRA 2QWKA 1L7HA 4GZXA 2IAUA 4NN9A 4WA4A 4CH9A 1SLLA 2GVWA 5FNRA 3D12A 2DG0A 1EUUA 2CMLA 2W5NA 1W0OA 4GN7A 1B9TA 3Q6KA 5D9CA 3SREA 4FOQA 5FNQA 2IAPA 1Z4YA 4YY8A 1W1XA 3INBA 5EX7A 2FP8A 4M4VA 2QE8A 5D9BA 1W8NA 5FNTA 2F25A 4N1BA 1DIMA 4YW1A 3AMSA 3WWAA 2QWBA 2HU0A 4GZQA 2HTQA 2QWEA 4HZZA 4XMBA 2ZW9A 1V0FA 1U6DX 4XJ9A 4GNAA 1IVDA 4GDIA 1NCDN 4FP2A 4GN8A 3E5ZA 4FVKA 4D52A 1A4GA 4QNPA 1W8OA 4KS5A 1NMCA 4CPNA 3TICA 1MS1A 3TI6A 4L7BA 4MZAA 4FPCA 1IVEA 3TIBA 3II7A 4B7NA 1N1YA 4FPYA 4I00A 3CL0A 1Z4XA 5EO8A 5HX0A 1INYA 4YW4A 2FPCA 1IJQA 1V3EA 1POOA 1KITA 4YZ5A 3A9HA 1S0JA 2F13A 2YA4A 4WA3A 1INHA 1OFZA 1B9VA 2QWAA 2VW2A 1S18A 4O5TA 4WEGA 5H47A 3B7EA 3O9KA 2AH2A 3LI5A 3WW9A 4C1YB 4AGTA 4CHBA 4HZWA 4XJRA 1MS3A 2F28A 2HTUA 4FQ4A 3Q6TA 1N1VA 2VK7A 4D8SA 1NNCA 1VCJA 2F27A 4HHOA 1NMAN 2GVXA 4IN4A 2ISMA 2VVZA 1EUTA 4X4AA 3S8VA 4IMBA 4YZ3A 3ZGDA 4XOGA 4M4UA 4XIOA 4IFJA 4L7DA 5GX1A 5FZNA 1INFA 1F8CA 3WN7A 1EURA 5B2CA 4UOUA 2BERA 3SLIA 1WP5A 1INGA 3SALA 4B7RA 1ZI0A 1USXA 3WDZA 4H52A 4IFNX 2QWJA 4XJZA 4HZYA 1N6FA 2HTWA 4PWZA 4IYGA 1Z4ZA 2FLUX 3ALWA 2ZB6A 4KS1A 4FPOB 1VCUA 4G3NA 4GEZA 2XZJA 4IFLX 4XILA 1E8VA 1F8DA 2DSOA 1MS8A 1NNAA 3KGGA 2VSKA 3A72A 2GVUA 5GX2A 3TI8A 4QN7A 4WEFA 3S8ZA 2H2UA 1H6LA 2IVZA 3PJQA 4K1IA 3BEQA 2FPBA 5GX5A 4XIKA 4D4UA 1NMBN 2WOZA 3VNGA 1IUCA 5FWWA 4GZSA 2F26A 4MZEA 2VWDA 1NCBN 1NPEA 3KYAA 4GN9A 4XHBA 1NSBA 3HLHA 3K39A 4NCSA 3GVKA 1V0ZA 1W21A 4UF7A 3JU4A 4M3MA 3NO0A 2W20A 3CKZA 3FVZA 3OPZA 4QN5A 4CSDA 2F11A 2YA7A 4KS4A 4BBWA 4CPZA 4AHAA 1SLIA 1RWLA 2G8SA 1W0PA 4O5SA 2W8BA 4QN4A 1L7FA 1PJXA 2Z32A 1INVA 4HZVA 1S1DA 3SILA 3DR2A 1N1SA 3K38A 3ADEA 4D52B 1IVGA 4H53A 4GZWA 4K3YA 2H2NA 1L7GA 2VK5A 2DG1A 1C5KA 4X47A 2W8BB 3TC9A 4QN6A 4X49A 4YZ1A 4X6KA 2HTYA 4MWUA 4FOYA 3UC1A 3K36A 4D52C 5HUNA 1CRZA 2X9MA 3H73A 4FOVA 2QWDA 2HT7A 4HIZA 1S0IA 3H6JA 1NN2A 4MWQA 4MWYA 4WA5A 4FJ6A 1IVFA 2XZIA 2F24A 2YA5A 4M4NA 1Q7FA 4K1KA 1INXA 2SILA 3H71A 4C1YA 1MWEA 1BJIA 3D11A 2HT8A 5GTQA 4MWVA 1X2JA 4FPJA 2VAQA 1F8EA 4K1HA 1SUUA 4XJQA 5FNUA 3TI4A 1MS0A 4J9TA 2A75A 1V04A 4MWXA 2YA6A 3G4HA 3HRPA 4Q6KA 4XMAA 3LI3A 3O9JA 3A71A 3GVLA 3SOBB 3B69A 1MS4A 3A9GA 4FOWA 4CPYA 3HLIA 4FPGA 4XJAA 3K37A 4CPLA 1V3DA 1N7DA 1V0EA 2DYHA 1Z50A 4L7CA 4SLIA 4CPOA 1E8UA 1MR5A 1NCCN 2XZKA 5FNSA 3V65B 4GB1A 5CGJA 1NNBA 2VPJA 5JYYA 2JKBA 2VK6A 4GNCA 4ZY3A 5HUKA 3SRGA 2HTVA 1NCAN 2V91A 4JMLA 1MS5A 2C4LA 2QWCA 5NN9A 1ZGKA 2AEPA 1MZ5A 1QLGA 2F0ZA 2IAVA 3ZGCA 2XN4A 3SOQA 2ZZKA 3GVJA 2IATA 5F9TA 1W20A 1Z4VA 2W38A 2IAOA 1WCQA 5D9DA 3NN9A 4DG6A 3ALXA 2AGSA 5EO7A 2GVVA 3NSSA 1K32A 2IARA 4MC7A 1X2RA 2HQSA 5B2DA 4FZHA 2HU4A 4XMIA 4ASCA 4FP3A 4A0PA 3IAXA 2QWFA 3O4PA 1RWIA 4FPHA 4HHQA 3S2KA 4HZXA 2IAXA 2QWIA 2SIMA 5HUMA 1N6EA 4MWJA 3G4EA 5HUGA 5M1ZA 3W09A 1N1TA 3SANA 2IASA 4GZPA 1QBIA 1V2IA 1IVBA 1E8TA 4ZGCA 1EUSA 1A4QA 4XYXA 4YZ2A 3V64C 3TI5A 1A14N 2FHRA 3VNHA 2ZB5A 3I1CA 5GX4A 4YZ4A 1NSCA 1N6DA 4NC5A 1CQ1A 4HW6A 1E1AA 5GX3A 2POOA 2IAQA 1V3CA 2AEQA 3CL2A 4K1JA 2F12A 4AGIA 4CPMA 4Q1UA 4YW3A 4MJUA 4B7QA 2SLIA 4GDJA 1IVCA 1V3BA 3U0SA 1F8BA 1IUBA 3FW0A 6NN9A 4YW5A 3AMRA 4XJUA 2QWGA 3H72A 2BZDA 4IQKA 4MWLA 3K3AA 3S94A 3T1EA 2BF6A 4MWWA 3L6VA 4XJ8A 3P5BL 4B7JA 2GHSA 2VW0A 1WCSA 4XJWA 4XE9A 2YDTA 1SNTA 2W5OA 2YA8A 2B8HA 3Q6PA 4DGRA 1INWA 1CVMA 4GZTA 4MWRA 2F10A 3LI4A 4MJVA 1XOEA 3TI3A 4FPKA 4XHXA 2XCYA 2VW1A 4YW2A 3SOVA 1CRUA 3CYEA 2QWHA 2IAWA
chains in the Genus database with same CATH topology
4FPFA 4JF7A 1MS9A 7NN9A 1NSDA 1DILA 3TIAA 2F29A 4KS3A 4GJTA 1Z4WA 2VSMA 1XOGA 4FPLA 1B9SA 4B7MA 2BATA 2HTRA 4QN3A 4KS2A 1MZ6A 2RKCA 2HT5A 2YDPA 1SO7A 4MX0A 1USRA 2C4AA 4FPEA 4GZOA 2QWKA 1L7HA 4GZXA 4NN9A 4WA4A 1SLLA 3D12A 1EUUA 2CMLA 2W5NA 1W0OA 1B9TA 4FOQA 1Z4YA 1W1XA 3INBA 4M4VA 1W8NA 2F25A 1DIMA 4YW1A 2QWBA 2HU0A 4GZQA 2HTQA 2QWEA 4HZZA 1V0FA 4XJ9A 1IVDA 4GDIA 1NCDN 4FP2A 4FVKA 4QNPA 1A4GA 1W8OA 4KS5A 1NMCA 4CPNA 3TICA 1MS1A 3TI6A 4MZAA 4FPCA 1IVEA 3TIBA 4B7NA 1N1YA 4FPYA 4I00A 3CL0A 1Z4XA 5HX0A 1INYA 4YW4A 1V3EA 1KITA 4YZ5A 1S0JA 2F13A 2YA4A 4WA3A 1INHA 1B9VA 2QWAA 2VW2A 1S18A 4WEGA 3B7EA 3O9KA 2AH2A 4HZWA 4XJRA 1MS3A 2F28A 2HTUA 4FQ4A 1N1VA 2VK7A 4D8SA 1NNCA 1VCJA 2F27A 1NMAN 2VVZA 1EUTA 4X4AA 4YZ3A 4XOGA 4M4UA 4XIOA 1INFA 1F8CA 1EURA 5B2CA 2BERA 3SLIA 3SALA 1INGA 4B7RA 1USXA 4H52A 2QWJA 4XJZA 4HZYA 2HTWA 1Z4ZA 3ALWA 2ZB6A 4KS1A 4FPOB 1VCUA 4GEZA 2XZJA 4XILA 1E8VA 1F8DA 1MS8A 1NNAA 2VSKA 3A72A 3TI8A 4QN7A 4WEFA 2H2UA 3PJQA 4K1IA 3BEQA 4XIKA 1NMBN 4GZSA 2F26A 4MZEA 2VWDA 1NCBN 4XHBA 1NSBA 3K39A 4NCSA 3GVKA 1V0ZA 1W21A 4UF7A 3JU4A 4M3MA 2W20A 3CKZA 3OPZA 4QN5A 2F11A 2YA7A 4KS4A 4BBWA 4CPZA 1SLIA 1W0PA 4QN4A 1L7FA 1INVA 4HZVA 1S1DA 3SILA 1N1SA 3K38A 1IVGA 4H53A 4GZWA 4K3YA 2H2NA 1L7GA 2VK5A 4X47A 4QN6A 4X49A 4YZ1A 4X6KA 2HTYA 4MWUA 4FOYA 3K36A 5HUNA 2X9MA 3H73A 4FOVA 2QWDA 2HT7A 4HIZA 1S0IA 3H6JA 1NN2A 4MWQA 4MWYA 4WA5A 4FJ6A 1IVFA 2XZIA 2F24A 2YA5A 4M4NA 4K1KA 1INXA 2SILA 3H71A 1MWEA 1BJIA 3D11A 2HT8A 4MWVA 4FPJA 1F8EA 4K1HA 4XJQA 3TI4A 1MS0A 4J9TA 2A75A 4MWXA 2YA6A 4Q6KA 4XMAA 3O9JA 3A71A 3GVLA 3B69A 1MS4A 4FOWA 4CPYA 4FPGA 4XJAA 3K37A 4CPLA 1V3DA 1V0EA 1Z50A 4SLIA 4CPOA 1E8UA 1MR5A 1NCCN 2XZKA 4GB1A 1NNBA 5JYYA 2JKBA 2VK6A 5HUKA 2HTVA 1NCAN 1MS5A 2C4LA 2QWCA 5NN9A 2AEPA 1MZ5A 2F0ZA 3GVJA 5F9TA 1W20A 1Z4VA 2W38A 1WCQA 3NN9A 3ALXA 2AGSA 3NSSA 4MC7A 5B2DA 4FZHA 2HU4A 4XMIA 4FP3A 2QWFA 4FPHA 4HZXA 2SIMA 2QWIA 5HUMA 4MWJA 5HUGA 5M1ZA 3W09A 1N1TA 3SANA 4GZPA 1V2IA 1IVBA 1E8TA 1EUSA 1A4QA 4XYXA 4YZ2A 3TI5A 1A14N 2FHRA 2ZB5A 4YZ4A 1NSCA 4NC5A 3CL2A 1V3CA 2AEQA 4K1JA 2F12A 4CPMA 4YW3A 4MJUA 4B7QA 2SLIA 4GDJA 1IVCA 1V3BA 1F8BA 6NN9A 4YW5A 4XJUA 2QWGA 3H72A 2BZDA 4MWLA 3K3AA 3T1EA 2BF6A 4MWWA 4XJ8A 4B7JA 2VW0A 1WCSA 4XJWA 4XE9A 2YDTA 1SNTA 2W5OA 2YA8A 2B8HA 4DGRA 1INWA 4GZTA 4MWRA 2F10A 4MJVA 1XOEA 3TI3A 4FPKA 4XHXA 2XCYA 2VW1A 4YW2A 3CYEA 2QWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FPF A;  4JF7 A;  1MS9 A;  7NN9 A;  1NSD A;  1DIL A;  3TIA A;  2F29 A;  4KS3 A;  4GJT A;  1Z4W A;  2VSM A;  1XOG A;  4FPL A;  1B9S A;  4B7M A;  2BAT A;  2HTR A;  4QN3 A;  4KS2 A;  1MZ6 A;  2RKC A;  2HT5 A;  2YDP A;  1SO7 A;  4MX0 A;  1USR A;  2C4A A;  4FPE A;  4GZO A;  2QWK A;  1L7H A;  4GZX A;  4NN9 A;  4WA4 A;  1SLL A;  3D12 A;  1EUU A;  2CML A;  2W5N A;  1W0O A;  1B9T A;  4FOQ A;  1Z4Y A;  1W1X A;  3INB A;  4M4V A;  1W8N A;  2F25 A;  1DIM A;  4YW1 A;  2QWB A;  2HU0 A;  4GZQ A;  2HTQ A;  2QWE A;  4HZZ A;  1V0F A;  4XJ9 A;  1IVD A;  4GDI A;  1NCD N;  4FP2 A;  4FVK A;  4QNP A;  1A4G A;  1W8O A;  4KS5 A;  1NMC A;  4CPN A;  3TIC A;  1MS1 A;  3TI6 A;  4MZA A;  4FPC A;  1IVE A;  3TIB A;  4B7N A;  1N1Y A;  4FPY A;  4I00 A;  3CL0 A;  1Z4X A;  5HX0 A;  1INY A;  4YW4 A;  1V3E A;  1KIT A;  4YZ5 A;  1S0J A;  2F13 A;  2YA4 A;  4WA3 A;  1INH A;  1B9V A;  2QWA A;  2VW2 A;  4WEG A;  3B7E A;  3O9K A;  2AH2 A;  4HZW A;  4XJR A;  1MS3 A;  2F28 A;  2HTU A;  4FQ4 A;  1N1V A;  2VK7 A;  4D8S A;  1NNC A;  1VCJ A;  2F27 A;  1NMA N;  2VVZ A;  1EUT A;  4X4A A;  4YZ3 A;  4XOG A;  4M4U A;  4XIO A;  1INF A;  1F8C A;  1EUR A;  5B2C A;  2BER A;  3SLI A;  3SAL A;  1ING A;  4B7R A;  1USX A;  4H52 A;  2QWJ A;  4XJZ A;  4HZY A;  2HTW A;  1Z4Z A;  3ALW A;  2ZB6 A;  4KS1 A;  4FPO B;  1VCU A;  4GEZ A;  2XZJ A;  4XIL A;  1E8V A;  1F8D A;  1MS8 A;  1NNA A;  2VSK A;  3A72 A;  3TI8 A;  4QN7 A;  4WEF A;  3PJQ A;  4K1I A;  3BEQ A;  4XIK A;  1NMB N;  4GZS A;  2F26 A;  4MZE A;  2VWD A;  1NCB N;  4XHB A;  1NSB A;  3K39 A;  4NCS A;  3GVK A;  1V0Z A;  1W21 A;  4UF7 A;  3JU4 A;  4M3M A;  2W20 A;  3CKZ A;  3OPZ A;  4QN5 A;  2F11 A;  2YA7 A;  4KS4 A;  4BBW A;  4CPZ A;  1SLI A;  1W0P A;  4QN4 A;  1L7F A;  1INV A;  4HZV A;  3SIL A;  1N1S A;  3K38 A;  1IVG A;  4H53 A;  4GZW A;  4K3Y A;  1L7G A;  2VK5 A;  4X47 A;  4QN6 A;  4X49 A;  4YZ1 A;  4X6K A;  2HTY A;  4MWU A;  4FOY A;  3K36 A;  5HUN A;  2X9M A;  3H73 A;  4FOV A;  2QWD A;  2HT7 A;  4HIZ A;  1S0I A;  3H6J A;  1NN2 A;  4MWQ A;  4MWY A;  4WA5 A;  4FJ6 A;  1IVF A;  2XZI A;  2F24 A;  2YA5 A;  4M4N A;  4K1K A;  1INX A;  2SIL A;  3H71 A;  1MWE A;  1BJI A;  3D11 A;  2HT8 A;  4MWV A;  4FPJ A;  1F8E A;  4K1H A;  4XJQ A;  3TI4 A;  1MS0 A;  4J9T A;  2A75 A;  4MWX A;  2YA6 A;  4Q6K A;  4XMA A;  3O9J A;  3A71 A;  3GVL A;  3B69 A;  1MS4 A;  4FOW A;  4CPY A;  4FPG A;  4XJA A;  3K37 A;  4CPL A;  1V3D A;  1V0E A;  1Z50 A;  4SLI A;  4CPO A;  1E8U A;  1MR5 A;  1NCC N;  2XZK A;  4GB1 A;  1NNB A;  5JYY A;  2JKB A;  2VK6 A;  5HUK A;  2HTV A;  1NCA N;  1MS5 A;  2C4L A;  2QWC A;  5NN9 A;  2AEP A;  1MZ5 A;  2F0Z A;  3GVJ A;  5F9T A;  1W20 A;  1Z4V A;  2W38 A;  1WCQ A;  3NN9 A;  3ALX A;  2AGS A;  3NSS A;  4MC7 A;  5B2D A;  4FZH A;  2HU4 A;  4XMI A;  4FP3 A;  2QWF A;  4FPH A;  4HZX A;  2SIM A;  2QWI A;  5HUM A;  4MWJ A;  5HUG A;  5M1Z A;  3W09 A;  1N1T A;  3SAN A;  4GZP A;  1V2I A;  1IVB A;  1E8T A;  1EUS A;  1A4Q A;  4XYX A;  4YZ2 A;  3TI5 A;  1A14 N;  2FHR A;  2ZB5 A;  4YZ4 A;  1NSC A;  4NC5 A;  3CL2 A;  1V3C A;  2AEQ A;  4K1J A;  2F12 A;  4CPM A;  4YW3 A;  4MJU A;  4B7Q A;  2SLI A;  4GDJ A;  1IVC A;  1V3B A;  1F8B A;  6NN9 A;  4YW5 A;  4XJU A;  2QWG A;  3H72 A;  2BZD A;  4MWL A;  3K3A A;  3T1E A;  2BF6 A;  4MWW A;  4XJ8 A;  4B7J A;  2VW0 A;  1WCS A;  4XJW A;  4XE9 A;  2YDT A;  1SNT A;  2W5O A;  2YA8 A;  2B8H A;  4DGR A;  1INW A;  4GZT A;  4MWR A;  2F10 A;  4MJV A;  1XOE A;  3TI3 A;  4FPK A;  4XHX A;  2XCY A;  2VW1 A;  4YW2 A;  3CYE A;  2QWH A; 
#chains in the Genus database with same CATH topology
 4GNB A;  3DAS A;  4FPF A;  4JF7 A;  1MS9 A;  3V1S A;  7NN9 A;  1NSD A;  1DIL A;  3TIA A;  2OJH A;  2F29 A;  4KS3 A;  5FZJ A;  2FP9 A;  4GJT A;  1Z4W A;  2VSM A;  1XOG A;  4FPL A;  1B9S A;  4B7M A;  2BAT A;  2HTR A;  3BYC A;  4QN3 A;  2P4O A;  4KS2 A;  1MZ6 A;  4AH4 A;  2RKC A;  2HT5 A;  2YDP A;  1SO7 A;  2ZWA A;  1C9U A;  4MX0 A;  1USR A;  2C4A A;  4R40 A;  4FPE A;  5F72 C;  4GZO A;  4ZLR A;  2QWK A;  1L7H A;  4GZX A;  2IAU A;  4NN9 A;  4WA4 A;  4CH9 A;  1SLL A;  2GVW A;  5FNR A;  3D12 A;  2DG0 A;  1EUU A;  2CML A;  2W5N A;  1W0O A;  4GN7 A;  1B9T A;  3Q6K A;  5D9C A;  3SRE A;  4FOQ A;  5FNQ A;  2IAP A;  1Z4Y A;  4YY8 A;  1W1X A;  3INB A;  5EX7 A;  2FP8 A;  4M4V A;  2QE8 A;  5D9B A;  1W8N A;  5FNT A;  2F25 A;  4N1B A;  1DIM A;  4YW1 A;  3AMS A;  3WWA A;  2QWB A;  2HU0 A;  4GZQ A;  2HTQ A;  2QWE A;  4HZZ A;  4XMB A;  2ZW9 A;  1V0F A;  1U6D X;  4XJ9 A;  4GNA A;  1IVD A;  4GDI A;  1NCD N;  4FP2 A;  4GN8 A;  3E5Z A;  4FVK A;  4D52 A;  1A4G A;  4QNP A;  1W8O A;  4KS5 A;  1NMC A;  4CPN A;  3TIC A;  1MS1 A;  3TI6 A;  4L7B A;  4MZA A;  4FPC A;  1IVE A;  3TIB A;  3II7 A;  4B7N A;  1N1Y A;  4FPY A;  4I00 A;  3CL0 A;  1Z4X A;  5EO8 A;  5HX0 A;  1INY A;  4YW4 A;  2FPC A;  1IJQ A;  1V3E A;  1POO A;  1KIT A;  4YZ5 A;  3A9H A;  1S0J A;  2F13 A;  2YA4 A;  4WA3 A;  1INH A;  1OFZ A;  1B9V A;  2QWA A;  2VW2 A;  1S18 A;  4O5T A;  4WEG A;  5H47 A;  3B7E A;  3O9K A;  2AH2 A;  3LI5 A;  3WW9 A;  4C1Y B;  4AGT A;  4CHB A;  4HZW A;  4XJR A;  1MS3 A;  2F28 A;  2HTU A;  4FQ4 A;  3Q6T A;  1N1V A;  2VK7 A;  4D8S A;  1NNC A;  1VCJ A;  2F27 A;  4HHO A;  1NMA N;  2GVX A;  4IN4 A;  2ISM A;  2VVZ A;  1EUT A;  4X4A A;  3S8V A;  4IMB A;  4YZ3 A;  3ZGD A;  4XOG A;  4M4U A;  4XIO A;  4IFJ A;  4L7D A;  5GX1 A;  5FZN A;  1INF A;  1F8C A;  3WN7 A;  1EUR A;  5B2C A;  4UOU A;  2BER A;  3SLI A;  1WP5 A;  1ING A;  3SAL A;  4B7R A;  1ZI0 A;  1USX A;  3WDZ A;  4H52 A;  4IFN X;  2QWJ A;  4XJZ A;  4HZY A;  1N6F A;  2HTW A;  4PWZ A;  4IYG A;  1Z4Z A;  2FLU X;  3ALW A;  2ZB6 A;  4KS1 A;  4FPO B;  1VCU A;  4G3N A;  4GEZ A;  2XZJ A;  4IFL X;  4XIL A;  1E8V A;  1F8D A;  2DSO A;  1MS8 A;  1NNA A;  3KGG A;  2VSK A;  3A72 A;  2GVU A;  5GX2 A;  3TI8 A;  4QN7 A;  4WEF A;  3S8Z A;  2H2U A;  1H6L A;  2IVZ A;  3PJQ A;  4K1I A;  3BEQ A;  2FPB A;  5GX5 A;  4XIK A;  4D4U A;  1NMB N;  2WOZ A;  3VNG A;  1IUC A;  5FWW A;  4GZS A;  2F26 A;  4MZE A;  2VWD A;  1NCB N;  1NPE A;  3KYA A;  4GN9 A;  4XHB A;  1NSB A;  3HLH A;  3K39 A;  4NCS A;  3GVK A;  1V0Z A;  1W21 A;  4UF7 A;  3JU4 A;  4M3M A;  3NO0 A;  2W20 A;  3CKZ A;  3FVZ A;  3OPZ A;  4QN5 A;  4CSD A;  2F11 A;  2YA7 A;  4KS4 A;  4BBW A;  4CPZ A;  4AHA A;  1SLI A;  1RWL A;  2G8S A;  1W0P A;  4O5S A;  2W8B A;  4QN4 A;  1L7F A;  1PJX A;  2Z32 A;  1INV A;  4HZV A;  1S1D A;  3SIL A;  3DR2 A;  1N1S A;  3K38 A;  3ADE A;  4D52 B;  1IVG A;  4H53 A;  4GZW A;  4K3Y A;  2H2N A;  1L7G A;  2VK5 A;  2DG1 A;  1C5K A;  4X47 A;  2W8B B;  3TC9 A;  4QN6 A;  4X49 A;  4YZ1 A;  4X6K A;  2HTY A;  4MWU A;  4FOY A;  3UC1 A;  3K36 A;  4D52 C;  5HUN A;  1CRZ A;  2X9M A;  3H73 A;  4FOV A;  2QWD A;  2HT7 A;  4HIZ A;  1S0I A;  3H6J A;  1NN2 A;  4MWQ A;  4MWY A;  4WA5 A;  4FJ6 A;  1IVF A;  2XZI A;  2F24 A;  2YA5 A;  4M4N A;  1Q7F A;  4K1K A;  1INX A;  2SIL A;  3H71 A;  4C1Y A;  1MWE A;  1BJI A;  3D11 A;  2HT8 A;  5GTQ A;  4MWV A;  1X2J A;  4FPJ A;  2VAQ A;  1F8E A;  4K1H A;  1SUU A;  4XJQ A;  5FNU A;  3TI4 A;  1MS0 A;  4J9T A;  2A75 A;  1V04 A;  4MWX A;  2YA6 A;  3G4H A;  3HRP A;  4Q6K A;  4XMA A;  3LI3 A;  3O9J A;  3A71 A;  3GVL A;  3SOB B;  3B69 A;  1MS4 A;  3A9G A;  4FOW A;  4CPY A;  3HLI A;  4FPG A;  4XJA A;  3K37 A;  4CPL A;  1V3D A;  1N7D A;  1V0E A;  2DYH A;  1Z50 A;  4L7C A;  4SLI A;  4CPO A;  1E8U A;  1MR5 A;  1NCC N;  2XZK A;  5FNS A;  3V65 B;  4GB1 A;  5CGJ A;  1NNB A;  2VPJ A;  5JYY A;  2JKB A;  2VK6 A;  4GNC A;  4ZY3 A;  5HUK A;  3SRG A;  2HTV A;  1NCA N;  2V91 A;  4JML A;  1MS5 A;  2C4L A;  2QWC A;  5NN9 A;  1ZGK A;  2AEP A;  1MZ5 A;  1QLG A;  2F0Z A;  2IAV A;  3ZGC A;  2XN4 A;  3SOQ A;  2ZZK A;  3GVJ A;  2IAT A;  5F9T A;  1W20 A;  1Z4V A;  2W38 A;  2IAO A;  1WCQ A;  5D9D A;  3NN9 A;  4DG6 A;  3ALX A;  2AGS A;  5EO7 A;  2GVV A;  3NSS A;  1K32 A;  2IAR A;  4MC7 A;  1X2R A;  2HQS A;  5B2D A;  4FZH A;  2HU4 A;  4XMI A;  4ASC A;  4FP3 A;  4A0P A;  3IAX A;  2QWF A;  3O4P A;  1RWI A;  4FPH A;  4HHQ A;  3S2K A;  4HZX A;  2IAX A;  2QWI A;  2SIM A;  5HUM A;  1N6E A;  4MWJ A;  3G4E A;  5HUG A;  5M1Z A;  3W09 A;  1N1T A;  3SAN A;  2IAS A;  4GZP A;  1QBI A;  1V2I A;  1IVB A;  1E8T A;  4ZGC A;  1EUS A;  1A4Q A;  4XYX A;  4YZ2 A;  3V64 C;  3TI5 A;  1A14 N;  2FHR A;  3VNH A;  2ZB5 A;  3I1C A;  5GX4 A;  4YZ4 A;  1NSC A;  1N6D A;  4NC5 A;  1CQ1 A;  4HW6 A;  1E1A A;  5GX3 A;  2POO A;  2IAQ A;  1V3C A;  2AEQ A;  3CL2 A;  4K1J A;  2F12 A;  4AGI A;  4CPM A;  4Q1U A;  4YW3 A;  4MJU A;  4B7Q A;  2SLI A;  4GDJ A;  1IVC A;  1V3B A;  3U0S A;  1F8B A;  1IUB A;  3FW0 A;  6NN9 A;  4YW5 A;  3AMR A;  4XJU A;  2QWG A;  3H72 A;  2BZD A;  4IQK A;  4MWL A;  3K3A A;  3S94 A;  3T1E A;  2BF6 A;  4MWW A;  3L6V A;  4XJ8 A;  3P5B L;  4B7J A;  2GHS A;  2VW0 A;  1WCS A;  4XJW A;  4XE9 A;  2YDT A;  1SNT A;  2W5O A;  2YA8 A;  2B8H A;  3Q6P A;  4DGR A;  1INW A;  1CVM A;  4GZT A;  4MWR A;  2F10 A;  3LI4 A;  4MJV A;  1XOE A;  3TI3 A;  4FPK A;  4XHX A;  2XCY A;  2VW1 A;  4YW2 A;  3SOV A;  1CRU A;  3CYE A;  2QWH A;  2IAW A; 
#chains in the Genus database with same CATH homology
 4FPF A;  4JF7 A;  1MS9 A;  7NN9 A;  1NSD A;  1DIL A;  3TIA A;  2F29 A;  4KS3 A;  4GJT A;  1Z4W A;  2VSM A;  1XOG A;  4FPL A;  1B9S A;  4B7M A;  2BAT A;  2HTR A;  4QN3 A;  4KS2 A;  1MZ6 A;  2RKC A;  2HT5 A;  2YDP A;  1SO7 A;  4MX0 A;  1USR A;  2C4A A;  4FPE A;  4GZO A;  2QWK A;  1L7H A;  4GZX A;  4NN9 A;  4WA4 A;  1SLL A;  3D12 A;  1EUU A;  2CML A;  2W5N A;  1W0O A;  1B9T A;  4FOQ A;  1Z4Y A;  1W1X A;  3INB A;  4M4V A;  1W8N A;  2F25 A;  1DIM A;  4YW1 A;  2QWB A;  2HU0 A;  4GZQ A;  2HTQ A;  2QWE A;  4HZZ A;  1V0F A;  4XJ9 A;  1IVD A;  4GDI A;  1NCD N;  4FP2 A;  4FVK A;  4QNP A;  1A4G A;  1W8O A;  4KS5 A;  1NMC A;  4CPN A;  3TIC A;  1MS1 A;  3TI6 A;  4MZA A;  4FPC A;  1IVE A;  3TIB A;  4B7N A;  1N1Y A;  4FPY A;  4I00 A;  3CL0 A;  1Z4X A;  5HX0 A;  1INY A;  4YW4 A;  1V3E A;  1KIT A;  4YZ5 A;  1S0J A;  2F13 A;  2YA4 A;  4WA3 A;  1INH A;  1B9V A;  2QWA A;  2VW2 A;  1S18 A;  4WEG A;  3B7E A;  3O9K A;  2AH2 A;  4HZW A;  4XJR A;  1MS3 A;  2F28 A;  2HTU A;  4FQ4 A;  1N1V A;  2VK7 A;  4D8S A;  1NNC A;  1VCJ A;  2F27 A;  1NMA N;  2VVZ A;  1EUT A;  4X4A A;  4YZ3 A;  4XOG A;  4M4U A;  4XIO A;  1INF A;  1F8C A;  1EUR A;  5B2C A;  2BER A;  3SLI A;  3SAL A;  1ING A;  4B7R A;  1USX A;  4H52 A;  2QWJ A;  4XJZ A;  4HZY A;  2HTW A;  1Z4Z A;  3ALW A;  2ZB6 A;  4KS1 A;  4FPO B;  1VCU A;  4GEZ A;  2XZJ A;  4XIL A;  1E8V A;  1F8D A;  1MS8 A;  1NNA A;  2VSK A;  3A72 A;  3TI8 A;  4QN7 A;  4WEF A;  2H2U A;  3PJQ A;  4K1I A;  3BEQ A;  4XIK A;  1NMB N;  4GZS A;  2F26 A;  4MZE A;  2VWD A;  1NCB N;  4XHB A;  1NSB A;  3K39 A;  4NCS A;  3GVK A;  1V0Z A;  1W21 A;  4UF7 A;  3JU4 A;  4M3M A;  2W20 A;  3CKZ A;  3OPZ A;  4QN5 A;  2F11 A;  2YA7 A;  4KS4 A;  4BBW A;  4CPZ A;  1SLI A;  1W0P A;  4QN4 A;  1L7F A;  1INV A;  4HZV A;  1S1D A;  3SIL A;  1N1S A;  3K38 A;  1IVG A;  4H53 A;  4GZW A;  4K3Y A;  2H2N A;  1L7G A;  2VK5 A;  4X47 A;  4QN6 A;  4X49 A;  4YZ1 A;  4X6K A;  2HTY A;  4MWU A;  4FOY A;  3K36 A;  5HUN A;  2X9M A;  3H73 A;  4FOV A;  2QWD A;  2HT7 A;  4HIZ A;  1S0I A;  3H6J A;  1NN2 A;  4MWQ A;  4MWY A;  4WA5 A;  4FJ6 A;  1IVF A;  2XZI A;  2F24 A;  2YA5 A;  4M4N A;  4K1K A;  1INX A;  2SIL A;  3H71 A;  1MWE A;  1BJI A;  3D11 A;  2HT8 A;  4MWV A;  4FPJ A;  1F8E A;  4K1H A;  4XJQ A;  3TI4 A;  1MS0 A;  4J9T A;  2A75 A;  4MWX A;  2YA6 A;  4Q6K A;  4XMA A;  3O9J A;  3A71 A;  3GVL A;  3B69 A;  1MS4 A;  4FOW A;  4CPY A;  4FPG A;  4XJA A;  3K37 A;  4CPL A;  1V3D A;  1V0E A;  1Z50 A;  4SLI A;  4CPO A;  1E8U A;  1MR5 A;  1NCC N;  2XZK A;  4GB1 A;  1NNB A;  5JYY A;  2JKB A;  2VK6 A;  5HUK A;  2HTV A;  1NCA N;  1MS5 A;  2C4L A;  2QWC A;  5NN9 A;  2AEP A;  1MZ5 A;  2F0Z A;  3GVJ A;  5F9T A;  1W20 A;  1Z4V A;  2W38 A;  1WCQ A;  3NN9 A;  3ALX A;  2AGS A;  3NSS A;  4MC7 A;  5B2D A;  4FZH A;  2HU4 A;  4XMI A;  4FP3 A;  2QWF A;  4FPH A;  4HZX A;  2SIM A;  2QWI A;  5HUM A;  4MWJ A;  5HUG A;  5M1Z A;  3W09 A;  1N1T A;  3SAN A;  4GZP A;  1V2I A;  1IVB A;  1E8T A;  1EUS A;  1A4Q A;  4XYX A;  4YZ2 A;  3TI5 A;  1A14 N;  2FHR A;  2ZB5 A;  4YZ4 A;  1NSC A;  4NC5 A;  3CL2 A;  1V3C A;  2AEQ A;  4K1J A;  2F12 A;  4CPM A;  4YW3 A;  4MJU A;  4B7Q A;  2SLI A;  4GDJ A;  1IVC A;  1V3B A;  1F8B A;  6NN9 A;  4YW5 A;  4XJU A;  2QWG A;  3H72 A;  2BZD A;  4MWL A;  3K3A A;  3T1E A;  2BF6 A;  4MWW A;  4XJ8 A;  4B7J A;  2VW0 A;  1WCS A;  4XJW A;  4XE9 A;  2YDT A;  1SNT A;  2W5O A;  2YA8 A;  2B8H A;  4DGR A;  1INW A;  4GZT A;  4MWR A;  2F10 A;  4MJV A;  1XOE A;  3TI3 A;  4FPK A;  4XHX A;  2XCY A;  2VW1 A;  4YW2 A;  3CYE A;  2QWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...