1IO4C

Crystal structure of runx-1/aml1/cbfalpha runt domain-cbfbeta core domain heterodimer and c/ebpbeta bzip homodimer bound to a dna fragment from the csf-1r promoter
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
120
structure length
120
Chain Sequence
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSF-1R PROMOTER
publication title Structural analyses of DNA recognition by the AML1/Runx-1 Runt domain and its allosteric control by CBFbeta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 20
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2001-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1io4C00
3Q01A 4LOEA 2BINA 5AOIA 2BIPA 2J1XA 5LAPA 4IBTA 1E50A 5AOMA 1EAQA 4LO9A 2PCXA 5AOLA 1HJBC 2IOIA 5ECGA 3EXJA 3WTWA 1YCSA 4AGQA 2P52A 4AGOA 2RMNA 3US1A 3IGKA 1CO1A 1UOLA 4MZRA 2WGXA 3WU1A 4IBQA 1LJMA 1TUPA 5G4MA 2XWRA 4L18A 1IO4C 1GZHA 3Q05A 3QYNA 3D09A 2XWCA 2FEJA 2J1ZA 1EAOA 1H9DA 2ATAA 2J6WA 3TS8A 4AGPA 2BIOA 2MEJB 5AOJA 3D08A 2BIQA 4XR8C 1HJCA 3D07A 4L0ZA 4IJTA 3EXLA 3US0A 4AGLA 4AGNA 2X0WA 3VD2A 2J20A 4IBYA 2AHIA 3WTYA 4IBWA 2X0VA 3VD0A 5G4OA 4GUOA 2BIMA 3WTXA 4AGMA 2VUKA 5ABAA 4L0YA 1CMOA 3WTVA 3IGLA 3WTSA 1TSRA 3VD1A 4IBZA 2YBGA 4G82A 2OCJA 2IOMA 4LOFA 2ADYA 5AOKA 1KZYA 4G83A 3WTTA 3D0AA 3D06A 1HU8A 4GUQA 2X0UA 3QYMA 3KMDA 2J1WA 3KZ8A 5KBDA 1GZHC 3Q06A 5LGYA 3D05A 4IBVA 2GEQA 2IOOA 3ZMEA 2J1YA 4IBUA 2H1LM 1T4WA 2J21A 5AB9A 5G4NA 4KVPA 4MZIA 4HJEA 5A7BA 3WTUA 1EANA 4QO1B 5BUAA 2AC0A 4IBSA 4A63A
chains in the Genus database with same CATH superfamily
1VZIA 1A9EA 4M6OH 4Z7UE 4ODVH 4MQXC 4U1LA 1LEKA 1TEYA 4AENB 2F54A 1CFSA 4JFYB 1S7SB 1MELA 5IHBA 4Z7NB 3LHAA 3EYUH 4U3XA 3DETD 4PWIA 1IGTA 4XN7A 5GRVK 3LXCA 3KXFE 4U1SA 2OMTA 2CCVA 1U0QA 4CDHA 4X42A 5BO0D 4K94L 1DVYA 3EYVA 5F7EH 5HYJA 1YY9C 3BPOC 4JFDE 4W9JC 4XP5H 2IEPA 1FIGL 5EZJA 1BQLL 3V4PL 1PZ5B 1IC0A 2AANA 4RMRA 5B38A 4WTWA 5KYWB 1HWHB 1UXMA 2GTZA 2NSXA 2I32A 1MH5A 3RY4A 1QNZH 3KXFD 5EF0A 4M62L 5C0IA 4NQVB 3T0BA 2M83A 1TJHL 2J6WA 1R3IL 4AVIA 3AFLA 4JFDD 2Q7NA 4O2FA 4WHYH 4CILA 4F33A 5F3BA 4GW1B 1UENA 2KLTA 2C9QA 1JWUB 1U8HB 2Y36H 3NEOA 3US0A 4KK9D 4OGYL 2WB7A 4XVSL 3OJ2C 5EIIB 4EOWL 1S6NA 3ETSA 5JLZA 4YN3A 3TZVC 3DIFB 4PP1D 3APNA 5IVZA 2RQEA 5C9KA 5LDUA 2VQ4A 3L4ZA 3I6GB 4LZKA 1RXLA 2PW1B 1HFUA 2BSED 2DQFB 2WLKA 2FX7L 3CH1A 4QTIL 2X4TA 5I28A 4G5ZL 1M1XA 2JH2A 3FYEB 1BYPA 1NGZB 4YHZH 2L3BA 4ZUSA 1I8KA 4R26L 1N67A 4P2RD 4J4PA 4OZGF 3PPEA 1F0LA 2FSDA 4F8QA 5C2UB 4WWKC 1MCKA 5ECJE 3GS4A 3QAZC 4FNLL 5FYKH 2BSTB 3MLZH 3MRKB 3PLYA 1HCZA 1TTCA 4PJGE 5K9JL 4IU3B 4N2GA 1NGPL 1UT9A 1TJIH 1CDGA 1SLWA 4P2OD 5A1AA 2JB6B 2B59A 5FDWA 3V4UH 4N9OB 1JMZA 3UJIL 3WBDA 5EUOA 4G8IB 3TIEA 3BUYA 2FEDC 4IOSD 1G9NL 3O6LL 3GHBL 3K2UL 5HJDA 2OV0A 2YRBA 3A67H 1UXSB 3FMGH 3SYPA 5FYLL 2Y7QA 4UAHA 4AUJA 4N90E 4WI5A 2L7EA 2Z92A 1T4KA 2XFGB 4NNXA 1UZ8B 1L9RA 3Q7JA 2EVHA 1UACH 5LWYL 2IANE 3WEBA 1OB1A 1WFIA 2IPKA 5FCUH 5C6PB 4B9KC 2Z8SA 1VFAA 3SDAB 4KRLB 3QFDB 3S5LB 1AE6H 1R0AH 4NHCH 4AQ1A 4N90D 2GHZA 4WI9A 2WXPA 2MCPH 2O6FA 1J0IA 2IAND 2FSEA 2OW6A 3BDYH 4GAAA 4LCUB 4OM0H 4WKXA 4MBOA 3VB9A 2ZUYA 2AQNA 1AKJA 1HWGB 4TV3A 3CX5K 2QDWA 3MRMB 3W38A 1YN7A 2FHCA 2X7LB 4NO5A 5F71A 5C0GB 5EB9A 2CNYA 2VLKB 4OB5H 1X5YA 4Y4KC 5EC1A 1AQ8A 4GI9A 2VDRH 1CN4A 5EO0A 2FJHA 4M5YL 4MASA 5C2BH 3FAWA 3FO0H 2PCFA 5D7IB 1XIWC 4A37A 1FV1B 3T0AA 2J71A 4DERA 2VDLL 1SJHB 4Y2LA 2D4FA 3QJFB 4KKLD 3MNMA 4ZS6D 1CFTB 3MRDB 4PV9A 1OOWA 4JG0H 1G0DA 3VXRB 5G4OA 1P84J 4Z7OF 2X53A 4WU5B 3FT4A 3S2AA 1OM9A 4KMTL 5I30H 1KCVH 4XN1A 3SKUD 1S3KH 4FQJH 4F37F 4NDMA 4HX1B 5GZNC 3HZKA 2XN0A 4MXVF 3RKPA 2BO0A 2YXWA 4ZO6A 5IIEA 4TVSa 4LHUG 1NTDA 3JV0A 2P7TB 5AVVB 1OQXA 4JFPB 3MV7A 2GABA 5MEPB 1OWRM 3U83A 4N0CD 1BIIB 2ZX6A 4Y1AE 4POZC 2WSPA 3VXPA 3HI1B 4U1KB 3SY0B 1OAKH 3ARRA 3W0WE 2VLJA 3CDGA 1ZJBA 3EOBA 3B5TA 2K8QA 2FATH 2XTJD 4GMSL 2KHAA 3ULVL 2IOOA 1WFUA 1G7HB 4KKLC 1SQMA 1I3UA 4Y1AD 5JO5B 1MCNA 1OEZW 4X4ME 1OZUA 2Y06L 4BZYA 4A7GF 3MJWA 3W0WD 1AMYA 2WZ6A 3WJMB 4JZNA 3MXVL 4LVOC 2W59A 5AALA 4HJJH 3DJRA 2WLIA 3OKEB 4DUXA 1Q9LA 3MBXL 3GEFA 4HS6B 5CZXD 1R3IH 1WZ1H 3N1FC 5GSRA 4BHUA 2HFFB 5ANMB 3WFDH 4AC4A 2WK2A 5ENWB 2W0PA 1OE2A 4AVKA 3O2DA 3TYFB 1JZJA 5FM5O 1P4LA 5SX5K 3GXPA 2ED8A 5ADPH 1AP2B 3MBEA 1PG7H 1A3RL 3QJOA 4D0BB 3RGHA 3ARDB 1BQSA 1YC8A 1O5DT 5DVLA 4X6CF 4S1SL 1XR9A 1SJEB 1HWWA 3ZL4L 1FPTL 5GS0L 2WNGA 4X5XB 3ZE2E 3EHBD 2YD7A 4G5ZH 4FA8A 3RL1B 1ZVSB 3QHZH 2ED6A 4MD4B 4NQUA 4XP1L 2DWYA 1SVCP 3QDMA 2H9GA 2XTJC 1UXWA 2LTQB 3ILEA 4LKCB 2G2RA 4RDQG 2FZ3A 4N3UA 2WBJA 4JHVA 1CFQA 1IFGA 4U2YA 2PKDA 2R4RH 5DWUH 5BUPA 5BW7A 4K9EH 2ZG2A 2LVCA 3Q5TA 4FN0A 4L0ZA 4UQDA 4YXLH 3RJQB 4M7LT 1UOKA 3SD5A 5LBVA 3FB5B 3HUJF 5BVPL 5JIDA 3CCHB 5K9JH 4XO4A 3TV3L 4JRWA 2N1TE 3BZ5A 5BS0B 5CZXC 3RGVB 3H2QA 4S11A 1JN6B 2O5XL 4YDLB 5MP6H 5AENA 1DBJH 2IQAB 2YAFA 3EG9B 3BIBX 4OD1H 2VXQA 2BFVH 3GHBH 4KNUA 1P5UC 2H41A 5KYUA 4HAFA 4MB3A 3ZZLA 5I1HL 1UM6H 4Q14A 4X7SH 2EE3A 4G8EB 4PJXE 3PWUA 1N8ZA 2MOGA 5EUKB 4U0RC 3AXIA 1FNGA 1TEGA 4FHBD 4OCMC 5CEXB 2YA2A 3A47A 1MJUH 2X1OA 3NPSC 5D5MA 1OTUC 5J8OA 4JFQA 1F45A 3FSZA 1CD1A 1NDGB 1S2EA 4S0SD 5H2BB 5IQ9A 2PETA 2PR4L 4NT6B 4AYDC 4AYFA 3V5KA 4L1HA 1HHKA 5F7WC 3RVUD 3TU6A 4MD0A 5HPMB 5ISZE 2K45A 1DFXA 1DTUA 4TNFA 4FJYA 3OKOA 4PM1A 1JGUH 2QQNL 2X41A 5DD3L 5FV1L 5F9WC 4M4RB 3S96B 3BP7A 3TEWA 1KY7A 1BD2B 2R15A 1V55B 3SKJH 2JKLA 5H37A 3I6SA 2X4UA 4I87A 1EDHA 5ISZD 4XMTA 4XMXA 4UT7H 3SDYL 4LEEA 1N18A 2DDQL 1ZHKA 2C3VA 3K4AA 3MBWA 4F7TB 1WEJL 4KV5F 2AEQH 4M5YH 4HEPG 4R4NC 4PMEA 5IQNA 3CDZB 2DI7A 5I66B 3JYCA 2R0WL 4HF5H 4PJHE 4N2FA 3BVUA 4OLUH 1D9KA 4H1LB 1A0QH 1OD9A 4ONFL 5HBBA 2BY1A 2BOCB 2BMKB 5K9QI 3KAAA 1BBDL 4F1ZA 2FIRT 4OLWH 1T80A 1BV8A 4M7JH 5IR1A 4R0LC 1SEQL 2GJ6A 3DXAB 4JG1L 4TQ8A 1E4WH 4NP9A 3N1PC 5DSCB 1L9NA 2WAHA 1CYWA 3OG4B 4HJTA 4PY8J 4N24A 2DWDB 1NKGA 3HG2A 4EZKA 4G8FA 5JPNC 4CA4A 3WDJA 2R4SH 4GAGH 5KSVB 4DOHB 3V5DA 1JERA 2MEJB 4HFUL 3CIQA 4FA7B 4ADIA 1UD2A 4IIQA 1MI5B 2A7BA 3LKNA 3O3EB 3P3UA 3T3MF 3HAEA 4LU5L 4D3CL 3BUTA 1DZ0A 1ETZB 5A2BA 1MQKL 1VFBA 4ZOCA 3FU8A 5FCSH 3A4EA 2UUDH 4UILL 3DHJA 5DK0B 4PRDB 2ESVA 3WJLA 1VEOA 4X6DA 1U8CA 1XGPA 5KSUA 1TQSA 3MJ9A 1AFVL 3O41B 1L7TL 1TSHA 4N2LA 4AM0B 2GKIA 1FZMA 3CFNA 4GRLA 1JPFB 3QSKB 1P69B 1OWWA 2YBGA 4Y5YA 5DJCA 3VFUA 2Y06H 4PJ9A 4XGZA 5HGAB 4Z7VA 3CWGA 4RGNE 2J5WA 4TPRL 2UXFA 1B0GA 4YBQD 4G5AA 4YSRA 1PL3A 4MXQD 5KVEE 5E8PA 5I6KA 5IW6B 1DVFA 2PF6A 4IU2A 5KJ7E 2JI2A 5KN5A 2CBQA 3I9GL 5J5EA 4JGNA 4ZW3A 4GUQA 3S7GA 3U4KA 4PP2A 3NJIA 5EOTB 2G30A 4LSSL 1HL8A 1QW9A 3TJEH 4RGND 4DQOL 2A83A 3P0YL 1N4XL 2H1PL 1OB0A 4OJEH 4WW1A 4AKPA 2GSGA 1G1CA 3BN9D 5DR5L 4I0CC 5K33A 1KYOJ 3WO4B 5DYOB 3DDGA 3CBJB 3IETB 3WFHB 3NGBB 3QORA 1FNEA 2K1MA 5DRWB 1QP1A 1IGIH 3V9EA 1K8IB 3ROOB 2YMOA 4B60A 3WTUA 2DQGH 1TCMA 5KVDE 1C7TA 4I77H 1JPTL 1KENH 2YAHA 4IYKA 4TQPA 5DURB 2BSBA 3APFA 1LO2L 2CBMA 3CHPA 3V8OA 3GBNL 1OCWH 3AT0A 1JGIA 1UYWH 4P23B 1P5VA 4LCWE 1E27A 2ADFH 3ML8A 2VL5B 2PP7A 3HG1E 3P3TA 3VFGH 3CQPA 4GXUM 3SE8H 1I7UB 1KY6A 1C16B 5I8CB 3TV3H 4EO5A 3BD4A 5BV7B 1HEZB 2ENPA 2P45B 3K91A 3WOVA 4EUPA 1A02N 4APXB 1LYQA 3QJHB 4H8UA 3W81A 4ISVA 1JS4A 5E4IA 2PO6D 4OQTL 2MHAA 1OPGL 1NBQA 2DTMH 4ZDHB 4LCWD 4OCWH 4X4XB 3LEYL 1KIPB 3S3SA 5K9KA 3HG1D 2GB2A 3RWCA 2EO1A 3SGDH 3FL7A 5AQ0A 3MOAL 3TO4A 4DN4L 1MZZA 2B3RA 4KXCA 2XG5A 4L37B 4JN1H 1UQSB 4EI6A 4XXWC 3D09A 1ZV9A 2FEJA 3CVIH 3FQXA 1N68A 3TWCL 3VVWA 4LDCA 1JI1A 1T3FB 1QPPA 3G5VB 4KJQD 5IVXB 1QLEH 4ZG1A 3ABGA 5IOPA 2YPLE 1FYTE 1KCKA 4OZHF 5HHOA 4EKJA 3KPNB 1WBYA 4MJHA 5I75C 1WIOA 2EEXA 1G9MC 1U2CA 5I19H 5ERWB 2X4PA 2WV3A 3MRLB 3SE9H 4KGJA 5GS1B 4NUMA 3SZ6A 2CJSA 4QRBA 3SBWA 3R18A 2YPLD 1FYTD 1JF1B 3X12A 3GJFH 3QI9D 1CU4H 5C07E 4TF4A 2VERN 4PLJC 3DX2A 4QLWA 4ZO8A 3NEEA 4GRMB 1ANUA 2FNBA 5CBEA 1HILB 4BCZA 4HBCL 2AS5M 3GTNA 4OZGA 3RTQB 5F1SA 3HIZA 1IC7H 2QSCH 3KWWB 5ACMA 3U7WH 3X1GA 5CILH 1UB6B 3D5OF 4LPUA 2IBGA 2X10A 2XWJB 3BIKA 3ARXA 4L4TA 3D06A 1GY2A 3NPZB 5C07D 1R3HB 5IROC 4U1JB 3WMSA 2P80D 1TXKA 5DUML 1TTUA 2EICA 3LQMA 4R9HA 4YSAA 2FQFA 4IHOA 1WFOA 1Q0EA 2GK0B 3IN0A 2IH3B 2WCPA 3QA3B 1DDHB 1QVOB 4H40A 3HZYB 4PS8A 4XPHH 4OF6A 3Q06A 4AMWA 2V7HB 5C0BA 3D25A 3QR2A 1BVKB 2DQIH 4AEEA 4HJ1A 5FF6A 2IALA 4F1SA 1ETA1 2P42B 4CVXB 2WB1A 2Z7YA 3D18A 1FL6B 1JWSB 4JG1H 4LCCA 1KC5H 1NC2A 1R17A 1B0WA 2X88A 3HNTL 1R24A 2AC0A 4NRYA 3I9IA 4R97B 2I60L 2K8MA 2FYYB 3G6AA 2CIKB 4U6TA 4KUZH 5D8JH 3MSPA 1V05A 3RX5A 2ZQKA 3OZLA 3VNZA 2VR4A 2ZCKL 3BWUC 3TEYA 3C5JB 1ZXQA 1ZS8A 1T04B 1EJOL 4IOFD 3AITA 2X4OB 3OKDA 1IBDA 5SWQB 3B7UX 2R69L 1QFHA 1SXSA 3EFOB 4X2UA 1Y6NR 4UQCA 5K1VA 5DRXB 3HE7C 3O2DH 1WRFA 4PRHA 4UILH 4K23H 4PJCA 1OSYA 3WIHA 3D34A 2FX8L 4NZJA 2ZUQB 2VRKA 5D9SB 3VDAA 3EIFA 2YARA 3SHSA 5EOCJ 3V6FA 1WAEA 4NZFA 1A4KB 4BH7A 5FUZH 2IPTH 2FRGP 2UYLA 3A6OA 5JPMB 3B2MA 5EDXA 4A68A 1A1OB 2XWCA 2ZWSA 4QXUH 4WWID 3DJ9A 3J2PA 4K7PY 4QXVA 1YVLA 5F7BA 4XNQA 4FQLL 4EQ3A 4JANB 1XCTA 1GZPB 2FGWH 4M1GH 3IJ7A 4KTDH 4NS0A 5LGJA 3SQOL 4M56A 5DMJB 3I9GH 3UJJH 3FFCE 3RWFA 1GGCH 2X0WA 3AQDA 3SBRA 2VO5A 4LDOB 5E7FA 1QO3A 4LRIC 3V4VB 2X0VA 4C4KT 5KS9B 1XH3B 3FH5A 3D85D 1IKFH 1AC6A 4JFUA 3R0NA 2HKFL 3ALXA 5AZEH 2RQ8A 4XPFH 4HOMA 5MERB 2VW4A 2C4FT 3G08B 1ZT1A 3CNKA 4Q97A 2HTLC 3FFCD 1XEUA 3LMJL 4Y2DC 3QDGA 5GIRB 1E4XL 1LO5A 4WI3A 1BXUA 1N5AA 3AZUA 2R1YA 1OP3K 2W9LA 2ZG1A 3IPFA 2ADIA 3FT3B 3ZKMD 4AT6A 1J8KA 1IT9L 1URZA 4DUVA 1N64H 1DUYB 2XVBA 2WKGA 3NFSH 3QHFH 1JYXA 3D39B 3VI3F 2LVEA 4XCFL 3T4AA 4P9ML 5E94B 1PSKL 1A6VH 3P0VH 3FQ4A 5CJ8A 4FDWA 5DRNB 5DO2C 4RMBA 2JJSC 3LZQA 4PBXA 1AOHA 3N44B 1Z9OA 3KVPA 5DZJA 4HKJB 1BQKA 5GJTH 2VT0A 25C8L 2PPCA 5CINL 1Q94B 1OGPA 5DJDA 3LSOB 4HXAH 3VXUE 3RZCA 1AH1A 5IW1B 1GJIA 2LFEA 1MPAL 3QEUA 5EZIH 5CFAA 2R2HB 3DX4A 3K1KC 4FZ8L 2AAAA 4LOUC 4UV7L 4XTRD 3TCTA 1MJ7H 4ODWB 1KT2A 4IM8A 1SOSA 3S36L 4X83A 5H37H 3A4FA 3T08A 2PCYA 3TT3L 2J25A 4P5TD 5IV2A 3R06B 4K73A 4LKXB 4EN3C 1YEDA 2FX9H 2O4EA 3ARGD 3VXUD 3UCRA 4FLRA 2ALWA 3STZB 1RIUH 5BV7L 3VGAB 1OCRB 3MUZ1 3NRFA 1PD1A 3K2MC 4NSKA 2G5BB 4MHHG 5DRZA 3UC0H 2YZ8A 1DJGA 1L7IL 3ZTJG 4PLNC 2MJWA 1ZSDA 4DWHA 3VXSE 1Y6MR 4OCYL 1X7QB 1TU2B 2CXGA 4HPOL 5F1NA 4QXTB 5FB8B 5E99L 4WHCA 1PLBA 5HJBA 2OMUA 3BHBA 5EBWB 4OF0A 4QF1A 1XBDA 3ILPA 3DV4B 3BD5A 1K8DB 5E2TH 2E4FA 1IFHL 1HTYA 1JJUA 2NW3B 3OX8B 5KVFE 1KFAL 3VXSD 1X4YA 2YJQA 1F8TL 4I1NB 5C0AA 4Y4HD 3ZRCC 1YEIL 4H25B 3VW3L 4D9RE 2R51A 3HNVL 3F6JA 4S0HA 3VFOB 4IJTA 2ZOKA 1XB3A 3DROB 3WFEH 3WMPA 1A1NB 1HX0A 4OCSL 4F5CA 1SLVA 3HMXA 3S98A 1YSOA 1OT2A 1KYAA 2PXYD 1Q9WB 3BPCA 3HAEH 2AI0H 3PGCB 4QY8A 2VDPB 3HG0A 2BIHA 3L3KB 2B4CH 4LCYB 4ONGH 5FWQA 2BVTA 2YPVL 1JV2B 4D9RD 1A4CA 2VABB 1LNUA 5F1KC 3MJ9H 4ALAC 2DWSA 3CPUA 4I0PB 3F6IA 3MI6A 1U91B 1FH2A 1JWMB 2CHXA 1Y0LB 3MFFB 4Y5XB 5GGUA 1T1XA 2OFQA 1INDL 5IKCA 4WDIA 1ZT4B 4M29A 3K46A 4MJJA 3U0PB 3II1A 4L9LA 1A64A 15C8L 2EXYC 4QAMB 1U8JA 3VFVB 4BH8B 4BQBA 4X4YB 4RETB 1EXHA 2GBTA 2HX9A 3O11B 1QSEA 1U3HD 5JXAH 3DSFL 3FO9A 3L4UA 4HUWA 1A3ZA 4U49A 3U2SA 1KSRA 2D7MA 2YD2A 2MH4A 2IFGA 3VFRA 3IXTA 3LKQA 3HG5A 2QV2A 2XIIA 3PL6A 3CX5J 4N8PA 5JOFA 3AACA 3OMIB 2Q1EA 2QZQA 3KPTA 4PJ5A 5D1QA 4B95C 3FH8A 3OMZA 5I16A 2IGTA 1FFQA 2A4CA 1LO0L 1MHHB 1OARL 2Z34A 3OTTA 3S3JA 4QXGH 3KWUA 3SO3C 1TVHA 3IDGB 2YD8A 2DRUA 3WLBB 1KLGB 4LLWB 5HGBB 3K74B 3MCLH 3KGSA 3WFZA 5FUCE 1C12B 2F8OA 1FH5H 5ACLA 1L5GB 4F7EB 4L1BA 3AREC 1FNLA 3RGVC 2IAAC 4YDLC 5I17B 1F42A 1I7TB 1U2HA 3OKMB 1FUNA 4XBEL 4EUPH 1FZJA 2J6EL 2QVTA 5IB3A 2E9GA 4JRXE 3FN0L 1KDIA 1KXHA 3LEXB 1H6EA 1U3HC 3IDJA 5ICZB 1E7VA 3TN0C 3U0TA 4JFFA 1KXVC 3TVMD 1A22B 1UWXH 1LO3L 1P1ZA 1NBVL 3VSQA 3IGAA 2Y2TA 2FECI 2VAAA 4G7SB 1Y6KR 3UYPB 3VG9B 1SNRA 4UQ3A 4X80H 4JRXD 1NOAA 4DGVL 4NNYA 1HL9A 1AHWB 2G9HA 4HT1L 4PWFA 6FABH 4O2CB 4UIMA 2R29A 1GZQA 3NN8B 2VDNB 3DYPA 2F9BT 4R2GD 2UV3A 5E03A 3V4VL 4L3EA 3W9DB 4ZFGH 5JW4N 2NY1B 1RUAH 1JHTB 2FWLB 3D0LB 5CSGA 3S9DB 3LH9A 3MJ8A 2GT9A 1OOAA 3UGXA 3JZ7A 2X4SB 5HDQL 1O9ZA 3LEVL 1F02I 1NCJA 4K3JH 4PAZA 4EXKA 4YDIL 2XWTA 5J1SC 2EDQA 3IB4A 4PJFE 3CIAA 5CINH 5FW6A 1F2XK 2QGEA 4G42B 3REWB 4NYLA 2WIMA 4ZFZB 4F3FA 4D0DB 2OMBA 4ZFQA 4LQFH 1WCBA 4N8CH 4W6WB 2C7UA 3CAFA 4RWHA 3RB7A 5DMGD 4JFEB 1RMFH 3NIFE 4Z0XA 2BW5A 1NC4B 4OKDA 1WS8A 2GY7B 4R5VA 2UX6A 3OD3A 4GKLA 4JB9H 4Q2ZA 5DVMA 5F3HB 4PVLA 2CK0L 4I3RH 1X9UA 5C0FB 1EEZA 1JK9B 4L4VA 2Q8AL 1BZEA 3UTTB 5K9OB 3WNNA 4QD2E 5IJVB 2NZ9C 3E7JA 3TYGL 3VGGA 2WXKA 3UPCA 1XCQA 2WQ8A 2GFBA 1OCZB 5HDWA 3VXTB 3AQXA 5D2NE 3D6GA 3H9ZA 4RMWA 1UH2A 3DX9B 4NQQA 2R7EA 3T0EB 1NLDH 2EVFA 2VSDA 4CJ1A 2V2XB 2YEVB 1IGCH 5E99H 5DLML 2XJKA 1HSAA 3C8DA 4IMLA 4JN2A 4KO5A 1J5HA 5BZZA 1XZ0B 1T1YB 3AS1A 1P6AB 2YK1L 4ZMXA 3GNMH 1GL4B 3U9PL 1BJMA 1TTAA 5E8NA 5EO9A 5DD1H 4U3CA 4LE8A 3L5HA 4KDTC 5AUMB 3C5ZB 1DQDL 2NY4B 2YD3A 4HGKC 4PG9A 3QCUL 3NCMA 1WHPA 4FYSA 4R4FL 1F00I 2B39A 5FGBA 3RBSA 2HH0L 3H6AA 1RZJC 3RBGA 4J3VA 1C1EL 2YGOA 3G5ZA 3MLRH 4NUJA 3RKDD 3A6BH 3ASWA 3ORJA 2AJSL 3LQZB 3EGXB 4G7VH 5D7LB 3WV0A 1BZDA 3RX7A 3WIHH 3SGEI 3ZE0F 4BZ2H 2HMID 4ANKA 2VDRB 1P1VA 1BG1A 5D2LB 3UXFA 1TUPA 1X5LA 4JO4H 3VU1A 1A6AB 3G5XA 1A14H 5T1MA 3VMPA 4KKZA 1GZHA 2MNJB 3TFKC 4XXCA 1OM3L 1CDBA 4G3YH 4MS8C 4X5LA 3HFFA 3PY9A 2APSA 1MUJA 1RVFL 1ZSHA 4MJ6A 4OZHA 2CWRA 2VDPL 4AG4L 4LEXL 3WGUB 3L4XA 4NBXB 3GRGA 4NM4L 2DMKA 5CEZH 1LE9A 1JAEA 3U4BH 5B1AB 1HXYB 4JAMA 3ZTEA 3U25A 4X99B 5D2NC 2Q8BH 3WN5C 4J3SA 2X40A 1U8MB 1KLFA 3NGBC 1JRHL 4ZK8A 4X7DC 3VRJA 3SGKA 1MHCB 1MCQA 5E8PB 3JTSB 3EO9L 4IBZA 3EJSA 4MMXB 4I88A 4RDQF 5B1JC 1R3LA 3TFBA 5ILTL 1M4KA 2C3XA 2VMFA 2W9DL 1HC1A 5DJ8B 1OAUH 4PGJA 2B5IB 1TQUA 2XWBA 4P23C 3MGTB 2AJZB 3N04A 4RFEA 3SIKA 4LPCA 2WLLB 1GYAA 1IQWL 4L3CA 3DX7B 5B21A 4UT9H 4M43H 1EZVY 3ROLB 1GH7A 2QKSA 3D3VE 3FRUA 4FX5A 4RH4A 4GMTL 1T6BX 4KQ4L 4WU7B 4AYEC 1NCBL 3S6CA 1T0OA 2X09A 2XQBL 4JHAL 3QNZB 3EYOB 4PJIF 2BNRE 5ID1A 5EOCH 1KBPA 4F9PC 3UTSE 2FJSA 4XMUA 1LQBC 2PTVA 4PJDB 3GM0A 1R47A 4M03A 3D3VD 3EZJB 4YXKL 2OAAA 2IDFA 2YEZA 3DX8B 4FCAA 2VDKB 1ODAA 3D4ZA 3RP1A 4WUUE 4HETA 3QQXA 4OZIB 4LT7A 1AGEB 5AEAA 2CCLA 1R9FA 2BNRD 3CXDH 4LLMB 4UNTA 4PREB 3UTSD 1ONQB 2BIPA 4KI5C 4HYTB 2Y5QA 4FLOA 3DNKA 4GEIA 4LO9A 4YHNA 2FWSA 4MA8L 2CO4A 2YPKB 4FQIL 4YSOA 1UJ3B 4JO8A 1AO7E 4K8RL 4N5EC 5GS1C 43C9A 4HOXA 4FL4B 2JJVA 4ZAKA 3NSDA 1ZS2A 1CR9L 1QHOA 4M8QB 2FO8A 4HKZB 4GUPB 2J73A 1RZ7L 1SY6A 2IBZY 5AKVA 2P24B 1ZHBA 4Q6IC 2V8LA 4FG0A 3QW9A 2ROXA 1OHZA 1CYGA 1REIA 2EKJA 5GRUL 2EDMA 4BUHA 1I1AA 2VE6A 4FHKA 3ULUE 3BE1L 1A6ZA 1AO7D 1N3NA 1KGCE 4HJGA 1I85C 4IRSA 3K72B 5FA3B 5EU3B 4DGYL 2YRPA 3Q2WA 2KPWA 5FO7A 4RDBA 1IV8A 3O3AB 4A7VA 2VDNL 3MLPA 3GS7A 4KROB 3WEOA 1AQKH 3QG6B 3ULUD 5DHEA 1AVAA 1J1OH 2AXJA 3QFJA 4DO6A 4JDEA 2WY3B 3C5SB 4Q4EA 2NY3D 4ODUA 4NX0A 1RZQA 2BVEA 3N1MC 1VCBC 4L5FH 2F53A 3GSVB 2BPBA 2J4WL 3G3LA 2W0LA 4OLZL 1CDYA 4MJIE 4YHOL 2YIHA 5DFVC 3ARBC 1D5XA 5J9PB 1BXXA 4ILDA 2J8HA 3FOMA 5JNYA 3NCWA 5ESQB 3D30A 4KKNA 4R97C 3PP4H 1GS8A 1UA3A 2FJUB 3OJDB 3UAJA 2UY7B 3GGWA 3JT2A 4WJKB 2AK1L 3KM2A 1AZUA 3BP6A 1QBBA 4MJID 2BHUA 1UD4A 4EZLA 4QNPE 4NQTA 2B3IA 3UBXB 2Y0SA 2H26B 2F8XC 2XPGB 3ZDYB 3EGDB 3HS0B 4MA1B 1BFOA 3RDTC 3X11A 4R7NB 1J5DA 2R1XB 3C6SA 2PPFA 2ZOOA 4W9EC 1E4HA 3GSUA 3IEAA 3SBQA 2EVJA 3ZKXC 1JFQL 3ARFA 4LGPB 4J28A 4BFIA 3N43F 2W5PA 3D2UB 4LHQB 3BO8B 2Z8RA 1FORH 4UCFA 1OO2A 4LCIL 4AZ8A 5JHLA 1YMMA 3ECWA 4OV5A 5JZ7D 3IVKB 4K7PH 3FXIC 4M7KH 4NENB 4U1LB 1ZLSL 3SPCA 1OP5H 4Z7AA 4QRQA 5DMIH 5C6TH 1CFSB 2EIMB 3DX1A 4A7TA 1CFVL 4P3CH 5GZOD 3RAJL 1I3GH 3ZTDC 2AW2A 4HPYL 3UGUA 3V0VA 1IGTB 2YUVA 5AOZA 4JBSA 1RVFH 5CP7A 4CN4A 2IOIA 5L2KE 2ZP0T 4DP6X 2NUTA 1A5FH 3EYVB 4UUJA 1MJ8L 1B4JL 5G2NA 1G4RA 1VFOA 1BF2A 4Y16A 3ABZA 1KCBA 1WT5C 5FO9A 1CF8L 2GTZB 4FFWD 3TEZA 4OW6A 2Z4QA 4W9DC 1MH5B 1YUHA 3IAQA 4WI0A 5I9QC 5C0IB 5L2KD 3LRGA 4DP9X 4Y19A 1ZIAA 5K93A 3CLEL 3LNDA 1BVNP 2OTUB 1PKQA 3VH8A 2YWYA 4F33B 1PX4A 3BH8A 5EZLB 3M45A 1AANA 3QG7L 5D4HA 5GPRA 3UADA 4KZEL 2RCSH 3OZ9H 2CR6A 1CK0H 1IAKA 5FA4A 4Z7WF 3NG5A 5DMYA 3QNFA 5TDPA 4TULH 5DS8B 5JZ7C 4A04A 3LS4H 4BDVA 5E5UB 1K5WA 2AEOA 5IVZB 2AK4A 4N26A 4EIBA 1PU0A 5DK3A 1SFDA 1WIPA 3EFFB 3SE3A 2XQBH 5E5LA 3L4YA 2C7FA 2F5AH 2BIMA 4JCMA 1OAQL 2FGZA 2WO2B 3BQUC 3VDBA 4OLYH 4ZUSB 3TO2A 3SPVB 2KDYA 1A2YA 1IBHA 1Q4NX 1U8NA 4AW7A 4YSSA 1ORSB 2UZPA 1JNHB 2D3NA 5FLVA 3RWHA 1QR1A 3LNEA 1Z3GL 4DK5A 1RJLA 4TQHA 1U8OA 4HIQA 5CBAB 2W8CA 5I1CL 4R5XA 4QPEA 4H13C 4CW1A 4ZMWA 4FD0A 2B59B 4ZMYA 4AKOA 1MEXL 4LP4A 2X4NA 3UL4A 4HJ0C 4HC1H 2B1AL 2LFGA 5EUOB 1FO0B 3R7QA 1AR2A 2QFRA 2V5RA 2VOTA 4QKTA 4NP4L 3CK0L 1KPRA 2ED7A 2QPEB 4AH2A 4MA7L 1KULA 1MQ8A 1HHJA 1T5XA 1LQSR 1OIOA 1KGYE 2H2PC 3HFML 4OLXH 3ZMEA 1T4KB 4NNXB 2AERT 4BUGA 3RHWK 1KACB 3T0DA 4NPKA 3D0VA 1OB1B 2IPKB 5KSBA 1WBZA 3Q8AA 4LXFA 5LN4A 3PIQB 3HVDA 4XCNA 2XKNA 5GSVA 4H20L 2BSSA 2YQ3A 3NSFA 1F11B 1NDTA 2XNAB 3JWOC 4LSRH 5C0ND 4BXSV 3WGVB 2WW8A 3ESVF 4YSUA 3MXWH 4XB3A 5T1LD 4K0OA 4U0QB 4WI2A 2ZUTA 5IQ7H 2Z31D 4N22A 4YHPA 1HE7A 2FSEB 3MV9A 5K1JA 1VEMA 2QFPA 3WEXA 1KEMH 1BAFL 2ZUVA 4H8PA 5I15L 1JXGA 3P73A 3P4NA 5FUOL 5IVOA 5C08A 2RHEA 2A0LC 4MXWL 4NUPA 4W9CC 3CH8A 1KJ2B 2FQGA 2HLAB 3P30H 2DIJA 5E6SB 4KO7A 2VZSA 1VLXA 1ROCA 3TH2T 4ZZKA 1A6UL 4Y5XC 3RWEB 4HHAA 5IBUG 4QHNA 3T3PE 2GJZA 5HYSB 5HPOA 3Q2CA 1E40A 5AVWB 3NJGA 3PGFH 4XPGH 3T09A 4JFSA 3SOTA 2FJHB 4G7YH 4MA3A 1JGLH 4YDVA 5TDNB 1INEH 1NCAL 1X9QA 1JPST 4ZXBA 3LZFH 2R23A 2FWOA 4NQXB 4ZFFA 1FGVH 4KRPD 4OGXH 2AEPH 2ZSWA 3IJEB 4J3OC 2NW2A 2DS4A 3FT4B 4TTDD 4GRWB 3QNYA 3PWJA 1DQQA 2MTAA 4EE2A 4N0YL 4JGUA 4LLDB 4G43A 5I1JL 2X89D 1JZHA 4LMQE 4CU7A 3HZKB 1ECYA 5FYJL 3QIUA 1CGSL 2YA1A 4LNRA 2BVUA 4G11A 5E2WH 2HA1A 3KPRA 2NUPB 2DIAA 4PPTA 4E9QA 4APQD 3MLXL 5FYKE 2NQDA 1JNLL 1ZOXA 2I9LA 5HDBF 3NFNA 4NO2A 1RUML 2YAEA 2OMVA 3X3GL 3GK8L 4N1CA 1LP9B 1SHSA 3VXPB 5IJKA 4GSXA 3RAJH 2Y72A 5D93C 1TJGH 4NGHH 2VLJB 5HHME 1ZY9A 3EOBB 5BXFA 3DBXA 5FYKD 4AVHA 1MW3A 3DX6A 4GP4B 1BEYH 4NQEA 5AAWA 5KBPA 5DJ0B 2ZX7A 1CVSC 2NZ1A 5D1XE 3L3HA 4NC0B 4JY5H 1D7DA 5B39G 1RUPH 5DJ2A 2EYRA 3GYRA 1CF8H 4TL5A 5JIIA 5HHMD 4XMLL 1KB9K 1NUFA 4JZNB 1NWPA 2DF3A 4UU9A 1CICA 5C3IA 2X9XA 4HIIA 3AM8C 2V37A 4LHUA 5D1XD 5AVXB 5I73B 4I48B 3NABH 1H6UA 3GHEH 4UOW1 2V2WA 4A63A 3BZ4B 3FQ1A 3FT2A 3MTRA 1AHWC 3Q0HA 4FJ6A 4KGLA 4TUUA 5JIPA 1V3KA 4KJPC 4JQIH 4M00A 1J9CT 2F1EA 1CXEA 3DOHA 1I9IL 2NXYD 2XN9B 1FCGA 3MBEB 3BT2H 2IDSA 2Z7WA 3QJQB 2BWQA 3MLSL 1S5HB 3H0TB 1K6QL 2VLRE 2ZOWA 4AEIH 2XZQL 4P5MA 3SDDD 4DAGH 1T6VN 1UVQB 1I3VA 5IMMA 1SY6H 3KNBA 4HU2A 3POHA 1KELL 2Q6WB 1MDAA 3FONB 3KBEA 3BAIA 4XC1H 1FRGL 2X4RB 5CEYA 1J0KA 4A2FA 1SOXA 3DMMA 3RWDB 2VLRD 4ZMLA 3NJNA 1ESOA 3SGJC 1RJYA 1YJDL 1RULL 2Z65C 3GO1H 5J13C 5L6YL 3L9YA 4HMDA 5TQ0H 5HHQB 1M7XA 1N2RA 1GS6X 4AXWA 3PAVA 2WVUA 3BKCL 5DUJA 3TIDA 1AXIB 4D9LH 1B2WL 3WXVH 2D03H 1F3JA 5I1DA 1LEGB 3EF4A 1E28B 2VR3A 3O4LA 3KYMA 5E4EB 2XIDA 5SV4A 3FUIA 3V0GA 1VKXA 4N85A 3WTXA 3RUGA 2GBUA 2HWZL 3EH5B 1A7QH 2EE6A 3G5WA 1CTMA 1E6JL 1IC4H 4P8QA 5HVHB 1UOVA 5DQ9B 1KB3A 1OSPL 4JL2A 4NPYA 5D5MB 2A4ZA 4L1LA 4WZ9A 4PRPA 3V6OC 1QSFE 3ARQA 3L9RA 2HG0A 4GIOA 3T1WA 2Y6SD 4PSRA 2AXHA 3H7BB 5HHXL 5TGBA 3DVGA 3C5ZC 4LDEB 4PD4K 5IQ9B 4TNGA 4G59C 1FO0L 2VITB 2PWDA 2A3TA 3LD8C 2BCMA 1HHKB 1HNYA 4P4KC 4K7FA 4PGEA 2OM5A 3QUMB 1QSFD 4WUKL 4WWOA 1JV5A 3T77A 3C87A 2WP3T 2HRGA 3OKOB 3R7RA 4Z7UA 5HTSA 4J7RA 3BP7B 3CQQA 2UXVA 4YMPA 5J56B 2LHAA 1MFUA 2FIKA 1QUNA 4NAMA 3VWKB 1DVZA 4NN7B 4Z7NF 2X4UB 1YQ2A 5DK2B 1A6UH 3N9GH 4FG6D 2B9AA 4KTYA 3RJOA 5DD0H 4KK8C 2GUYA 1AGBA 1J0YA 5JHLH 2C3VB 1ZHKB 1X4XA 3CFKB 3FCUB 3HRZA 3BEVA 3KXFA 3OQ3B 2DL2A 3QPKA 4XO5A 2DQJH 3IDXH 3T2LA 3BZEA 3EBAA 5C0RL 1NQBA 4JFDA 4H2AA 2Y5EA 2ZNXA 1D9KB 3OKLA 2WZ0A 4AIEA 3MREB 2QMJA 1XZWA 2F8IA 3RHWF 1CB4A 3RGBA 3CSFA 1CBVL 1KJ2L 3BEWA 5IR1B 4JY6A 1GC1L 3F04A 3SOBH 2ZX8A 4QRFA 5I1JH 1GCFA 1OAJA 1YNKH 4PJAE 4XNBA 4E41E 1F4YL 1VADA 2XXFA 3QQ9D 4OCLC 5LGHH 2BSEA 5SX4I 3EJRA 4G8FB 2XKUA 1AXTH 3BWUF 4F2ME 4R4BA 3L5XL 4MZ3A 3UDWA 4DPCX 2BX5A 2P8PA 1JL8A 4P2RA 5FGCE 1H5BB 4KI1A 1E4KA 2VISA 3LKNB 5EFIA 4DKFH 1IUZA 1EGJL 1W0VA 2YFNA 4E41D 4HEPA 2XQYG 4GSDL 2XDHA 4G8GE 4PRIE 2WWKT 3TCXA 3DSNA 1VEPA 5L2JA 4DZ8A 3B83A 5DVNA 4AGNA 3EDFA 3BT0A 2COVD 4Y2OB 1JXDA 1QI3A 1XGPB 2WINA 4P2OA 3O3BA 5E6ID 3Q8CA 3VWJB 4C47A 3QXWA 5K69A 2ITFA 3DO3A 5FYLE 1BVLB 4G8GD 4YDJA 3VFUB 1TZGL 4IOSA 4Y5YB 4Z7VB 4ELMF 5KG9A 1U8LA 4P2YA 4PJGA 2Y3NA 4NWTL 1ES0A 4PN6A 1LDSA 3Q6GL 3D51A 5IMLB 3FU7A 3B2PA 1GAFL 2EXSA 2N7BA 3B2VH 3GIVA 3IPEA 4IU2B 4LBEA 2DMBA 3MRPA 4O5LH 4PTUA 5GISL 5TDOA 4HA1A 4KX7A 3QUKB 3M17B 1OD7A 4PP2B 5DCCA 1OT4A 2WXLA 5FYLD 4PG2C 2RB8A 5A40E 3EJYC 3GSNB 1VAHA 1FAIH 4N68A 2A83B 2F7QA 4FL4C 4G9DA 2OMWA 2GSGB 2APWA 4WHYG 1NMCB 3MRFB 1EO5A 1NMAH 1M7DA 2JJUA 5D1ZI 3WSQH 3PUUA 3PQYE 4HK0A 2HJKB 3MLSH 3EUDA 1U8KB 2ZXCA 3GBMH 2IANA 3EZ8A 3VE0B 4LPWA 3QORB 2JCCB 4OSUL 1FNEB 3PWNB 3WE6A 4UQ9A 1JD9A 1URLA 3IJ8A 4TNWK 2HFGH 3CV5A 4TMPA 5AW6B 2R2EA 4K9EC 1KELH 2AV1A 4OAWA 3RVVD 3GMMA 3L1EA 4YIQA 5D6DA 2ZCZA 3PQYD 5DZPA 3WKML 4HUUB 2EEBA 3QUZD 2E6QA 1P5VB 4MRBA 3EYQC 1H3PL 1CFBA 2W38A 9PCYA 3FRPG 3NAAH 3FU5A 4KHTH 5AWNL 4FFYA 5EPMA 1GOGA 4O9HH 5BQ7A 1YHPA 2ADJA 4FJZA 4ISVB 5B8CB 4Y9GA 3GLEA 4JS7A 3FQTA 4XCCH 3CTTA 1F6AB 1B90A 3GXTA 4O58L 3ZMRA 2ZJSL 5J1TC 5EU6D 2VQ1A 2QV4A 3TO4B 1JDAA 1KG0A 1F4WH 3IDNA 2HVJA 5A2LH 4FQ1H 4ZW8A 4ANVA 3ZIYA 3LDBB 3FCBA 1NAKL 4XWOC 1V7NH 2QSQA 4JY4A 3V9CA 4F57H 5IOPB 4YPGA 2B7DT 5T1KB 3UBHA 4TRPH 3S88H 4R8WH 1FL5B 4BKLA 5HHOB 4F2EA 1C08B 4XZ4A 1HHIB 4UI2A 2WBXA 3DJZA 5E1AA 5AOJA 4FC3E 2DQMA 2X4PB 3K6IA 4MA1C 3HS0C 5HHXH 1NGWB 2N0KA 2VR8A 3EJUA 3EDKA 4P2CG 4I18C 3V5HA 1HL5A 3L08A 4JCWA 2H2SC 1U2YA 3AY4C 1DQMH 5F9JB 1UH3A 4AEHL 4EKXA 3ULVE 3VQLA 1ZGLM 4FP8L 4HGWB 3X12B 2Q7YA 4IBYA 4LSTL 3TH3T 1O5PA 4M48H 3ARZA 2E7DA 4ZQKA 3UPRB 4K71C 1R5IA 4OF7A 1TNMA 2COQA 1MFVA 3BJ91 1BFTA 4OZGB 4PS3A 1J8SA 4Y1AA 2JKSA 1JE6A 1IARB 1AZBA 1RIVL 5LBSH 2CKBB 3ULVD 3W0WA 3B7YA 1QA9A 2WM0A 3EOYG 4LOFA 4NXKA 3SDXF 1QLRB 3WFBL 4YH6A 1GGIL 3VGBA 2F15A 3ZKND 3ECVA 3QFGA 1DFBH 2FD6L 2FO1A 1L0QA 1DQLL 3QUML 4X4MA 2EIEA 2PMZA 1PD0A 3BSHA 4ZW6A 5E0FA 3TX4A 1NIAA 1WVZA 2PW2A 3W1ZA 5C0BB 5FF6B 4PGDB 1E3XA 4RGOH 2XRAL 4X5WA 4AIZB 3D18B 3NCEB 2AXFA 1JPSL 2KZ1B 3O9WB 4N8VG 4NPJA 3VFTB 5KTEL 2NSMA 1BVNT 4FF9A 2NCEA 4F58L 4NRYB 4LK4A 1YPZE 5K39B 3ZDWA 5FOBA 5BO1H 4ZUWA 5HDOA 2NY6C 3FTYA 4LVHC 2Y6TE 1ZS8B 1N5YL 1Y18B 4QJ3B 4JREB 3AMKA 4JZJB 3OXRA 1W15A 4DW2L 1RFDL 2WLYA 4AX3A 5KZCD 2AITA 1IM9B 4GYBA 5HJGA 4DFHA 4OJFH 1X5HA 3L1OL 1NAMB 4KXZI 1QLFB 3NTCH 5I1IL 3GSOB 4NFDA 4WK2B 1Z0MA 3WD5H 1MCCA 3L3JB 4L8SB 4PRBB 1HNFA 1WWAX 3OR6A 1P4BL 4J4PC 2HRPH 1PGRB 3ZPDA 2JI1A 4W9HC 1NEZG 5EU7E 5IQOA 1SPDA 4MZRA 4WFGE 2QSVA 4OCXL 3WE1A 2ATPB 3U1QA 2A6DA 2VDQH 3LNIA 3MUUA 3S36X 5KSAB 4RISH 3Q6GH 3RFZA 4HOZA 2Y5TB 4FYRA 3TNNB 3H9YA 5LGJB 4LSVL 1EAOA 4GNKB 4YOKA 5J12B 2BNQE 3IT8D 2AQTA 1U4EA 4WFGD 5D72H 1MW0A 5A16B 4GUCA 4Q0XL 1QO3B 2IXQA 2R8SL 3MKGA 2XXCB 4L29B 4HCRA 1VGEL 1ILSA 5BZWB 4PJXA 1DN0B 3AQYA 1SOQA 3QIWD 4PEEA 2J2ZA 1SBSL 2XBZA 4ZUUB 1JUFA 3U9UA 3VXOA 5DC0A 3BX7C 2LOEA 1RZGA 2BNQD 1LO5B 5FHBH 2WWOA 1EQWA 2YD9A 4AT6B 2NYYD 3QUYD 1TSRA 3ML9A 3QQDA 5T3XL 2C4XA 2Y2WA 2BERA 1B88A 2Z35B 1RZ8A 2X6BA 3IBEA 2BXZA 1EA9C 3DA0A 4AQ1C 3GSNL 3T4AB 3BP4A 5ISZA 4E9VA 3DPDA 1DQIA 3GB7A 4QAWA 4DO4A 2WQWA 3AXHA 1UKSA 1IGFH 1MCRA 3DVIA 4IQHA 4LEOA 3SDAD 2JVUA 4PTTA 4ESKA 3IRCA 3MLUH 1UUSA 2GSMB 3ZW3A 2O5ZL 3VFPB 1KCSH 2R2CA 3SGEH 1N70A 1XT5A 5EO1A 1B0IA 4YX2L 5I24A 1E2VA 3D4GA 3LQAH 4LLYA 3TGXA 3UTZA 5ACZB 1GIGL 2QVFB 1Y1DA 4PJHA 3Q9QA 3SKOA 1ZV5A 3DGCR 5C70A 3I02A 2F5BH 1GTFA 3ETBJ 1SHXA 1TTBA 2GUOB 1YEDB 1XWVA 2HRHA 4NFCA 1AQHA 1LHZA 3DECA 4KAQL 4MKTA 5TE7L 4KHXL 1OCCB 2ZWLT 4XBGA 3FUDA 2HPTA 4TNWF 4WFHE 1U21A 1JVKA 2QKIB 2VDMH 3LRMA 1ZSDB 2FL5A 2W0KA 1UB5A 4LASL 1R5VB 3CVDA 3KBPA 4JJHA 4P5KA 5HJ3A 5F1NB 4PWKA 3HMWH 5FW7A 1QR4A 1QBMH 3LH8A 2FEEI 3Q43A 4YFLF 4WFHD 3L81A 1XF1A 3M1OA 4N2OA 1G7IA 4AC2A 5LGKA 5DJ6A 1JZEA 3NCXA 1TYEB 4L8BB 5INCA 3F58L 2C3WA 3PDGA 5C0AB 2E3VA 3CG8A 4QRRE 12E8H 3RPKA 3T0WA 3L3DA 2PR9A 5LN8A 2VM9A 1VFUA 4PJFF 2RJMA 4J8QA 3HUJB 2A9DA 3D08A 1AQDA 1MFBL 1OK0A 2GIXA 4N6QA 3NACL 4ORZC 4QY8B 4F8TA 4YXHH 4ZTOL 3U0WH 1A4JA 1UWGL 1N19A 3CUPB 1ZHLB 3AG4B 5E8OA 2WBJD 1CZ8H 4HLZG 4QRRD 4Y2NA 1PJ9A 3O6FD 1MKFA 4S1QL 1T03H 4DK3A 3TBCA 4DP4X 4GUOA 2SODB 1YEJH 3N0AA 3ZKSD 1DANU 1GYVA 1W72B 2HX8A 3WS6A 4UTBA 2RD0A 5MEQA 1T1XB 4WEUD 2CKBL 4WDIB 5I73C 4AUYA 1TF4A 2VKXA 5TQ2H 4F58H 4Z8FL 1NM9A 4QRPE 4YGAB 2LAGB 3TOPA 1U8JB 4C4KO 5F2FA 4HIXL 2FLBT 5IK3B 5GGRY 2LU3A 2UZYA 2ICEB 4F92B 4XXDB 4PLKC 2HLFD 3FO9B 3FTUA 3E8UH 4HUWB 1WF5A 3P0GB 4X6EA 3VFWA 2BS9A 3MBEC 3CFDA 1RFDH 2JV6A 3ATFA 3MUJA 5DUBA 3V7MA 4QRPD 5CLYA 1S9YA 3VFRB 3LKQB 1SM3L 2MNUA 4NJAL 5FM5M 4CNIA 5IEKA 1MAJA 4MYPA 5JOFB 3QYMA 3SB3A 1A21A 3L1OH 3IXAA 4PJ5B 2VZ3A 3FTWA 1HH6A 5I16B 4WKZB 2ZCLL 1UM4L 3CXFA 5CJOH 3V7AE 2AV7A 2PO6A 3HRPA 5L9DH 3DRQB 3ZUNC 3ARDD 1FG2A 4LCWA 4Y7OC 4GI6A 2WBJC 3HG1A 2E4TA 3GZQA 4OCXH 5BW7C 3Q8EA 1IGYB 3B9DA 5A7BA 4HMCA 1X6NA 5LBGA 2JQAA 3KPSB 1DCEA 4BK5C 1SF5A 5CSZB 1EUTA 1I8AA 5BS0E 4NN6C 4GAYA 1J5OH 2J8UF 4OT1L 3RU8L 1NAML 1MCBA 3Q9PA 4FZEH 2R8SH 3TPUA 1FZJB 5IB3B 1J11A 2FUTA 2VJXA 3GT6A 5DJXB 3TT1H 4GJTB 5CNHA 3O0RL 3PNWA 1RU9L 1DBBH 2IGLA 3ZT7A 4UT6L 4TQEH 2JLLA 5BS0D 3U0TB 4YHYC 4WWNA 1OK8A 4KZDH 4PJBF 2YPLA 1FYTA 4NUGL 2Z9TA 3QI9A 3DV6A 1NCOA 1F1DA 1TQTA 1U93A 3A6CH 2VAAB 5HVHC 1FL3A 1BLNB 1QOKA 2IFFL 3I2CH 4DEUA 1P9MA 3ULSA 3KR3L 1ZANH 4MVBC 5T3XH 3V4LA 1KTLB 1HEJC 3IFLL 2G9HB 3JYBA 4U3SB 5DC4B 4UNIA 4LRNL 1L0PA 2A6JB 4Q8BA 4G6MH 4K3HA 1HH9A 4UIMB 1FHGA 4YO0A 4NQDB 3T3MB 1BZ8A 1EXGA 3BDBA 4XVOA 3UTPE 1FGNH 2WUBL 2P1YA 5C07A 1K4CB 5JA8B 3L3OC 2ATKB 2GT9B 3MJ8B 4ODHH 4BK8A 2P80A 3MNZB 4F7MB 5JHDE 2DQEH 4PS7A 2KKQA 1VDGA 2X3BA 5C8JA 2XWTB 4B0MM 4R3SA 1BD2E 1ID5I 3H3BC 2P5PA 4QHLA 4HG4K 1KB9J 2B16A 4F3FB 2EH7H 4K2UL 4Z0BL 3O4OB 3UTPD 2ZCHH 4K5NA 4ZSOB 3P3SA 5I82A 1CUOA 1Z9MA 4Z0XB 3F8UB 2WXMA 2V0AA 5JHDD 1ZK5A 3I75A 8FABB 4Q6YA 1ECZA 2C3HA 2DWTA 2B0SL 4Q2ZB 4F8PA 1D5IL 5GHWL 3FHAA 3WENA 1D9KC 1NL0L 3A22A 3W11C 4NZ8A 5I6XC 1JNNH 1ZD6A 3MROA 3PXHA 4KHXH 1JF5A 4LPTA 4URTB 5E6UB 3NVQA 5B4MD 2HZHA 3OGOE 3C08L 4I2XB 4N2NA 5HI4D 3ESOA 2Y07L 3MC0A 3DXAE 4I3SL 1Z9NA 4KKRA 3ZYIA 1A8JH 1BQHA 1FLTX 3PG2A 3T65A 1TVDA 5HYQA 1S7QA 3CGTA 3QZLA 4AQOA 2BCKB 3L45A 3CFCH 4GQQA 3S37L 3MJ7B 3KGTA 4JG9A 4JN2B 1HSAB 2Y7SA 4FXKB 4IMLB 1MFCL 4R5TA 4DOHE 2FJFA 1HXKA 4FERA 2OI9C 1KPVB 1I1RA 2OL3A 1A7BA 3DXAD 7PAZA 3LJ3A 3MRGB 1TETH 1MI5E 4IIQC 5E8NB 3K0YA 2HB0A 1WD9A 3FQWB 3N40F 4Y4FD 3TBTA 4PUBL 1AZCA 4FAAB 4XNMA 4LOEA 3CLFH 3TV8A 4PG9B 3I50H 5GGSY 1CG9A 3MOBL 3DGGA 2ENJA 4NUJB 1MI5D 4FYTA 2FE0A 5DD6A 2XY1A 3S5LG 1ZIBA 1OAZL 4GRLC 4Y5YC 2YQBA 4MDJA 1XMEB 3FYIB 4PJ9C 4XWGL 5TF1H 4N1HB 3D85A 5GRVL 3VRIA 4A6YA 5B4MC 4E9LA 2CGZA 1RZKH 5T1MB 3G5XB 2PTUA 4YQXL 3SODB 5I23A 2AJXH 4IBQA 5GGRA 4XP4L 4RMTA 3BAWA 1MVYA 3FFCA 1DVFC 3Q48A 3S0PA 4MKMA 3X1EA 2I26N 3GIZH 3WNOA 5KS9F 2X70A 1MCWW 2ZP8A 3HMXL 4PD4J 1KIUA 5IBTL 2NYKA 2XWXA 4OZHB 3APMA 1YG9A 4HJIA 3AU1A 5F9DC 1NJ9A 3IJHA 1XX9C 4M61A 1YYLL 2AXGB 5E00A 1T22A 2MRYA 3BKML 2JXMB 4YSQA 3RPIA 1NM4A 1MFDH 3DHPA 1KLFB 5A2FA 3QORC 2G2NA 3WNMA 1W72L 4C55A 1YYCA 4IKNA 3AXLB 3E6HA 1ORQB 2B1HL 4QNPF 2ARWA 3K6NA 1UM4H 4N6RA 5FM4A 4L2YA 3FQRB 2DLIA 2DQTL 3BSZA 1R3LB 3CSGA 3KPMA 3M88A 5ALBL 5LUMA 4MNHA 4PYHA 4Z77B 4KK5C 1A3QA 3EJZD 3MGOA 4IRZA 1TYRA 2A6IA 2E7BA 1KPUA 2CR3A 2NXZC 1R46A 5AYUH 4LARH 5CR1A 3H42L 1A25A 1FVDA 1J88A 3W2DH 4P5TA 5E0QA 3SDXA 5E1QA 3BLPX 3T5WA 2F08A 3ARGA 4G1MA 3CZUB 3VXUA 1RD6A 3U1PA 5H35A 5AKRA 2CHNA 2OSLB 2VTFA 4L4TD 2WBWB 3PHQA 4P2QE 5EU5A 5F9OL 4CMHC 4DTGL 3TO4C 3E3QC 3WS3A 4OM1H 4XPTL 1MNUL 2YEZB 4H5SA 2ZE0A 1WE5A 1A9VA 3LDBC 5I1LA 5IVXE 4XP9L 4OR1A 4NO0D 1YEEH 2CLVB 3THMH 4P2QD 2YKLH 3PJNA 1T0PB 4AMKH 3QUXD 1VACB 2CRYA 3KR3H 3OGCB 5ITFA 5DT1L 3LIUA 4YHNB 2YMXL 3GJEA 4P9HH 3VXSA 3GSXA 3QZWB 4Y4HA 4ZUTA 1WA0X 43C9B 2LQRA 1S7TA 1F3DJ 1JZIA 2BP8A 2WUCH 2OSWA 4XMPH 3SBWC 2BJMH 3AG3B 4WO4D 4ZW7A 5HGDA 4HFWB 2OYKA 1Q1JH 3OXSA 4XAWH 2VJ8A 4V1DB 1WO2A 2PXYA 4L23A 4NFBA 2WZ5A 3SQRA 4DPBX 1MRDH 1SUHA 2KBGA 2X87A 3B9KB 2H0EA 4BYHA 1KIQA 1I1AB 1TQCC 1A6ZB 4A39A 1BXVA 4TSBH 2ETWA 2BOBA 1P4IL 4HJGB 4IRSB 1DE4A 3N06B 2EDLA 1P2CA 2JKRM 5FO7B 1RIHL 1AZZC 2R29L 5DI8B 2Z8WC 2BS8A 3FTXA 4JFZL 1YNTA 1KF9B 1JHLL 4GQPH 5E8EB 3T8XA 3WDIA 3RTQD 2ZYSA 4UQEA 4XT1C 5CD5C 1FI8C 1UUNA 2VM3A 2ENQA 3MZGB 2R0KL 2HT2D 2HAZA 4HIJB 5IB1A 4Z3EA 3POCA 4CSTA 1MWOA 2UZIH 3REVB 4ODUB 1T21B 2DI8A 4YL9A 2BY3A 3GFUA 5I18H 2A9NH 4I3SH 3MO1A 4WEMB 2V3EA 1QX1A 2O72A 2X12A 4LCCC 1CBJA 4BGLA 2IAMB 1D5XB 3AAZB 1ZT7B 2E7MA 3HTLX 4RWYH 4NM8H 4U4BA 4EN2A 4M8UA 3FOMB 5JNYB 1HHGA 1KBVA 5I8OL 1MREL 4B50A 2OPCA 1FWXA 3P3YA 3NEXA 3GGWB 2XYBA 5DZNA 5BZDA 4K3EL 3GXIA 3QISA 4OFPA 1YN6A 3GF8A 4LF3A 3MRHA 3P11H 2MQGA 4J3OF 4P57B 3DO7A 2CE6A 2CDEB 3D9AH 3FZUD 3OHXB 5DJAA 3KLAB 1G43A 3VI3B 5GGSA 4DGIH 1LDPH 3CFJA 3O2VL 2KLRA 2PPAA 4R6UA 1I4FB 1NSNL 2EE0A 4FQXD 1BFOB 1E5AA 1U9KA 4O2EB 1XV8A 3X11B 1NCCH 3C6SB 2AFNA 4LMQI 4RESB 4GG6E 3GSUB 3CBRA 4IOIA 1JIBA 3ARFB 2OJEA 3UJTH 1AYRA 3BDXA 1XH2A 2HT2C 2FK9A 4FFVD 1A7PH 1F1GA 3UG5A 4BCXA 1YMMB 4DEWA 3AGVA 2DTSA 1WAAE 3HAEG 4IKLA 2WKOA 3OKKA 3V6ZA 3Q6FB 4CN1A 4YFEA 7CGTA 4WJ5A 4QRQB 5IB2A 2C9SA 3DUSA 2D31A 2FHBA 5KOVC 3TVMA 3QXUA 1I9EA 1XCWA 4QO1B 2GPZA 3V0VB 1GOFA 3CN1A 4UTCA 5J12C 3RZCD 5HHVL 3QRGH 5EHFA 2CSPA 3KG5A 5FO8A 1O9WA 2EDEA 2NUTB 3BVVA 4JRXA 1I8MB 4U2ZA 4XI5C 3C6LB 1T2JA 5LLIC 3L3IA 1M6OA 2X9WA 4MCNA 1UZ6E 1YCSA 1T7ZA 5FO9B 1YUHB 3LPOA 4WI0B 5ICXA 4PI0A 1AXSA 3R1GH 4MDIA 4N87A 3IFOA 3O8XD 3ARWA 4FQXC 4Y19B 3VH8B 4YAQB 1EMTL 1TT6A 5F0JB 1NUNB 2IADA 1O7DE 4QJ4B 3Q1SH 2I27N 1QBAA 1DL7H 2XWRA 1Y7VA 3T4AC 4ATTA 1CIDA 5FA4B 1S7UB 3Q05A 3RVTC 4OFVA 5TDPB 3HC4L 2BVYA 3KPPB 1CXIA 4NKQB 2WQSA 3JWDL 3KPOA 2OXGA 2XG4A 43CAA 4PJFA 3STBA 1TVBA 1AGFA 4J8RA 2BIQA 1TJMA 3FT0A 3QRBA 2XBDA 3CSPA 3ZOAA 1YMHB 3T71A 2BVOB 3RZCC 1W6WA 1G9EA 4DTGH 1O6TA 1PZAA 5LNDA 2NNRA 2OMXA 3TO2B 1A2YB 4RAVA 1MRFH 3M8OH 4NZRL 4L0YA 2BNUA 1CE1H 4KK6C 5I5JA 3T6WA 1CMOA 1YAZA 1H3XA 5LNEA 5F7MC 2DIEA 4M3JA 4TUJB 3RWHB 1QR1B 4TLUA 4ADJA 1U8OB 5CLTA 4XZUA 4RGMB 4X50A 1JXFA 2OTPA 4CW1B 2D7TH 3NIGE 4D0CB 5I6LA 3QEHA 1GYWA 1JXJA 3U46A 2IC2A 4KUCD 1KZYA 2BC4A 2X4NB 4QOKB 5D2NA 3FU6A 2BWIA 4HWEL 5J6SA 4CN6A 4Z78A 4XAKE 4K5OA 4JKKA 4YK4C 5LO7A 4DN3L 1GW0A 1EHKB 4IGBD 3SZKC 5IB4A 5EEVA 1MCLA 4AH2B 4R96A 5JORA 3P69A 3AADB 2GJJA 5B1JA 4HCGA 4MS6A 5EZOH 3BAYA 3OHMB 5SX4H 1HYSC 3KWTA 3GSWB 3AS3A 4HZLA 4PR5B 4XAKD 3QWQB 4RRPM 1AJ7L 3HPJB 4NOBA 5MENB 1WBZB 2PWFA 5IFJA 2DQ6A 4PB9L 2ZKXA 1UXLA 5GSVB 3HS8A 4XMWA 3GMPA 4ZO9A 2J56A 4N0FA 4XHJC 1OAYH 2X2UA 1EXUA 4W4NA 3IU4L 1UGKA 3U7AA 1M57B 3MMEA 3S2CA 2GJRA 1XSOA 4MAUL 4XVJH 2UUDK 3MV9B 3WEXB 4BFNA 5I8KH 3MYJA 3WLWD 1P0SE 2F58L 3MRCA 4BFBD 2I25N 2F68X 1WSST 3CC5B 1UCBH 3C8HA 4PQXA 1L3NA 1J8HD 2EIZA 2WVVA 3WNIA 2YRZA 3GI8L 5L88H 1KLUA 3GLZA 2YD1A 4PJBA 1RURH 2CLRA 1R4XA 4A6YH 4CBPA 1SJVA 4L9LC 2IMNA 3GRWA 4YDVB 3MLYH 3MJGX 4LVNB 5CSBA 4I0PD 3HBZA 2WLZA 4PSPA 3VMOA 3B7RL 1K3IA 1SEBB 4WCYL 2FWOB 4CBZA 4I7ZC 4ZFFB 1JP5A 2EYTA 3GMLA 3ZT6A 2ZSWB 1KTCA 2F74A 2OMNA 4AI7A 1EAPA 1QPKA 4DF9A 2PNDA 3PL6C 3PWJB 1DQQB 3QNYB 3QGVA 2BDNL 1YEHH 3E9UA 5IFAL 3BYTA 5D1QC 3ZZSA 1URIA 4OZFH 4TUOA 2DYPD 2XFXA 1H3GA 4KU1A 3VGEA 1CLOL 4HKBA 1SDYA 5IEHB 3KPRB 4YHLL 1EFXB 1X9RA 4YHKH 4AGMA 1RV6X 1SYVA 2R2BA 2I9LB 3AGWA 4MNQE 1PEZA 4M8RA 3D3VA 4UMGA 3TEUA 3UTQB 4LLUA 4Z7QF 1W2KT 3QQNA 4OTXH 3IU3A 4BWTA 3D52A 3GINA 4UF7C 1NGYB 1RK0A 2VXVL 2BNRA 4IRZH 3TP4A 2ZUXA 5CJXA 2L4OA 3TBVA 3UTSA 5BXFB 4G83A 3DX6B 1D5ZA 4MNQD 5C7XL 5AW1B 3L13A 3CVBA 4WY7H 5B1CA 1FLRL 1HU8A 5F7YC 3T2PA 2CO2A 5KW9H 1WZLA 4WUUA 2CNZA 5DJ2B 2X4QA 2D2OA 3QUHA 2ARJA 1SMAA 4N5UA 4GSQA 3L3GA 4UU9B 1CICB 1GRWA 1I1YB 2EEAA 3MTXA 1DSWA 2L7QA 3NOIA 4HIIB 1BM3L 4LHUB 3HC0B 5GGVH 2CG9X 3FT2B 3NA9L 2VH5L 4FKHA 3U4EB 1AO7A 3B2UC 1H3WM 4WNQB 3SDCB 4GW5A 1I82A 1MLBA 3DVFA 4PJEF 4B9GA 3LKRB 2Y7OA 5DHVH 4WNSA 1XF3A 1MNNA 1NCWL 3IK2A 1ETB1 3O0LA 4Z3GA 4YFDB 4H44C 1GGBH 3N1QC 4NI6A 5SWSB 3GJFK 1IIKA 4PVMA 4FQQA 3ARTA 4QHKI 5F70A 5DA4A 4E9XA 1HZKA 2NY1D 4PHXA 1MHPH 2Z91A 3ZE0B 4HWNA 4D9QE 1HINL 1YQVH 4OJAA 3BN3B 4JFEE 2JB5L 5I2IA 1QRNB 5AVZB 5CEYB 2I5YH 3OMNB 5KVFH 2UZXA 1HCYA 3ABKB 2Z93B 4WNJA 4XPAL 2ZWZA 3QZOA 5IFHH 5BRQA 4PB0H 4PRNB 3V0WH 3CVHA 5CGYC 3IFPA 4H8WH 4L1TA 4KWUA 1I9JL 2V5MA 4D9QD 1N2RB 4JFED 1BX2A 3JBG7 2HT4D 4WAFA 1NC4D 4MJIA 3ATAA 3BP5B 3TIDB 1RY7B 3SSGA 1F3JB 3ATBA 1SN0A 4GEJA 2CRMA 3O4LB 4MCMA 4A2EA 4YLCA 4JDVB 4L3AA 1BM7A 4MCYA 1IB5A 4JPKL 4JO2L 4IS6A 1S3RA 3VG0H 4DVRL 1SVBA 2OK0L 4KJWC 1W0WB 1I8IA 2J20A 2VXUH 3FQNB 4W4OA 1IKNA 1CFMA 2YSSA 3H3KA 4HWBA 4WV1A 2WQVA 4GW4B 4CJ0A 1BYNA 4AY0A 3U30C 4UV4H 2W95A 3L54A 4MNGB 4NPYB 3ZDYF 1NPNA 4MJ4A 2D7NA 2NNCA 1IBFA 2DQCH 4U1GC 2NTFA 3TZVB 2OBGA 2ZSVA 4RVBA 5TGBB 1XL6A 1S9WA 4JO1L 3P9WB 2RH0A 1F3DH 1TZOA 5FGBC 5F44A 3DPBA 2EDHA 3E1F1 5GZOA 3ISRA 1A3LL 3DHMA 5D7LE 4BEIA 4FABH 2ENSA 3QARA 1EJ6A 2H32A 2PUQT 3QUGA 4PJIB 2DN7A 5D2LE 5BQDA 3HC3H 4WIQA 3C8KA 4IKKA 4JLRA 4WWKB 1TMQA 4UZUA 1MCPH 1HNGA 2HT4C 1T2XA 4YJZL 1BREA 3QAZB 2RTTA 1GZHC 1USQA 5D7LD 1QSZA 4XXCC 1AGBB 2H6PA 2CGRL 3HRZB 1WGVA 3KXFB 1UGNA 4F20A 5L2KA 2I24N 5K59F 2QSTA 1MCWM 2I7OA 1E9PA 5KUKA 3MNWB 3BZEB 5I1GH 3VXQB 3AMLA 2WMPB 1WA2X 3DIVA 3OKLB 3BFQG 1HHHB 2RAMA 5B1BB 2VXTL 3GXMA 5D6CA 5AOIA 4TUKL 4QHPA 2WZPD 4YHML 1HI6B 5JR1H 3E2HC 3VD7A 2DLFH 4LVEA 1MCIA 2DQHH 4R90L 3QXAB 1JCVA 5FW8A 4DKTA 3ARVA 3SGKC 1C5DA 4GIAA 3DWTA 4UQ2A 1QQDA 5FFGA 5I71C 1WHOA 3MRJA 3WIIH 2P52A 5J4MA 3GEWB 1KBWA 3GHPA 3DK2A 3DTUB 2PN5A 1T20A 4R4BB 3P02A 2D73A 1JGDA 4X8CA 1OSEA 3HZVA 4P2RB 4LNVA 1G6RB 3BVWA 4M9PA 3CFUA 3MACH 5G5DA 2EP6A 2VISB 1W0VB 4X8JA 1UM5L 4DGUA 1CYXA 5C9JA 5JIQA 4HWZA 4GS7C 4N28A 1SXBA 5T33H 3DSNB 4HULB 1FFTB 2P5WE 3NIDE 4U1IA 4DZ8B 5L2JB 1V3MA 3NQKA 5KAQG 1AQMA 4UTAH 4C4UA 1PYWA 4JKPL 4KY1H 4EJ1C 2Z4TA 3K71A 5BOPA 1S5IL 1FBIH 3GC3A 1FLRH 2YWZA 1JBJA 1XAUA 3FSWA 4YBLB 4YDJB 4JO5A 3HE6A 4MZ2A 3LPPA 4OZIE 4U7SA 5KG9B 3MJ6A 5A3ID 2P5WD 2J88L 2DEWX 2DEYX 2GITA 1XIWB 5T5FA 3EO0A 1GJUA 3KYAA 4DP0X 3FU7B 5I6NA 1TCRA 2WQRA 2BVPA 5EOQL 5GQBA 2DJMA 3KJ6L 3ZE1F 3MRPB 1N7ML 5TDOB 5EUOF 4AWJC 5FKPA 1ET7A 1DCLA 5CM1A 4XC3L 4JFXA 1ASOA 3IFNL 4JRYB 4DP8X 3MOQA 1N59B 1JGVH 1I8LA 1RJZA 2CRIA 2ITEA 2XQYA 4M6MH 4RNRB 2XETA 2OMWB 4ZAKC 1GHFL 2KQMA 3CPLA 3K0WA 4RBPH 3GSRB 4X5QA 1M7DB 2XA8H 3Q1EA 4HK0B 4K55A 1YPZF 3TA3D 5T1LA 5CIPA 3ESNA 4Q9RH 3NUKA 2IANB 1J48A 2Z31A 1IBBA 4H88L 4KTEL 1I1AC 1HYRC 3WE6B 2ZOLA 4HXBH 1RK1B 3U2IA 5KBLA 3NJHA 3ASOB 4NN5C 1QFOA 2AV1B 4IRSC 4OAWB 4MX7B 3GMMB 5IGXL 4YIQB 3D05A 4G80A 2QPFA 3L4WA 1NIDA 2YGPA 2R56L 3DLQR 4M1CD 2V17H 1M71A 3EJQA 1PZBA 4X8XA 4TKWA 1JZDC 2XACC 2ZUUA 4UYPA 3ZRFC 1CL7H 2IV8A 2WP3O 3GMQB 4NCDA 5KUMA 5FK9A 3RNKA 3T2OA 1R5WA 1IGML 3RA7L 5EPMB 2OSXA 1JYVA 5BQ7B 1VF5C 3KWXA 4KBPA 5JXED 3S34L 2GSIA 5DFTA 1AD9A 1K3ZA 1G5AA 1F4XL 1S9VA 3FQTB 4PJ8D 4KROD 1AR1D 4HUXA 2Y1VA 2VQ1B 3ZYJA 1JGEA 4LVOB 1KG0B 4XBPA 3K6DA 1DQJA 3V52H 1PDKB 4JPKH 2VRAA 3CFMA 3MV8B 1WTLA 2EE2A 1QG3A 3UAJC 4AL8L 1IFRA 3IPBA 4OLVL 5IBLC 2X89A 5C0EA 2MCG1 5K9QG 3QS3A 2V9UA 4YPGB 4ZODA 1YO4A 3B1UA 4RQQB 1C5BH 3TEXA 4YUEL 3CFBA 3BKYL 3FB7A 4P3WA 4PGCA 4KVCL 4APQA 1XTLA 5E1AB 5J3HD 3AC0A 5BVJB 1MG3C 2AQQA 3QYNA 4Z7WB 3EOAA 2R0ZH 2I69A 3RVWC 3V5HB 4Q9QL 5I1EH 4BSWA 4JHWH 3MODL 5JOEA 3FUHA 2O1AA 1X7TA 3DKHA 3EBHA 5IESH 2C9RA 5I1AA 5HDLA 1HZHL 2QL1A 2VN4A 1A6WL 3BD3A 4X0NA 4NJ9H 5CKGA 1F4AA 3S35L 1CFNA 1ODUA 1Q9KA 7FABH 2XTJB 1S7WA 1E30A 4MJ5A 3LN4A 3G6DH 1SYSA 3EGSB 4GOSA 4HZ1A 1D5BB 3LB6D 3LZPA 4M7ZB 3ZJAA 4WHTA 4ETQA 2WWKO 3JZYA 3SGJA 1DQKA 2ZYRA 1CXFA 2DD8L 3LHPL 4LQ1A 3W0WB 3WXWH 4KVNL 3G9AB 3PABA 4R7VA 4NCC2 2YSTA 5D1XA 1N0XH 1UD8A 3RNQB 1WA1X 2AABL 3ARSA 3BZFA 2W80C 3QC5X 2DLHA 1Z1WA 2X2IA 3G04A 5ESAB 3RPBA 2VXTH 3ILQC 4PWJA 3QWRA 1BZOA 4Y16C 1X6LA 1NPUA 2PW2B 4YHMH 2QQKH 3TURA 4KKPA 2DY2A 2QR0B 2UVEA 4JRLA 3KEHA 4S1DD 4HIHA 5EBMA 4WW2A 1UASA 1IJ9A 1RUKH 4F2FA 1UWXK 1E0OB 2DM3A 2PCPA 3F7YB 3HCVA 2OTWA 3QNXB 1RPUA 3NPSB 3SDDA 2R9HC 4KKAD 3ZHFA 5J6HA 3LIZH 5T3ZH 2VIRA 3MLWL 4OD3L 4EI5D 4XMKL 4LSQH 1EANA 3FF7A 3S8GB 2VLRA 3OXRB 4NBYB 5F0PB 3LRHA 2JCWA 4QI3A 1KYOK 3GTVA 1X5ZA 2WO3B 2Z6FA 3SE3C 5CJQL 3ALPA 5F9WB 3QXVA 2A6KA 4IRJD 3FB6A 4KO6A 3RWGA 4ERSL 1IE5A 4K3GA 4JM4H 1KJMB 5J1AB 4P06A 3OR6B 4MCZB 4PW3A 3ULUH 1H3VA 4DP2X 2FB4H 2BRRH 2QHLA 3VB8A 1E5YA 1A4BA 1G6RL 3IMVA 2EDOA 1F6FB 3FCSB 3MA9L 1ASQA 3P4OA 3RFZB 1MCEA 2FQDA 4R83A 4FI8A 4W9KC 1BCIA 5EOQH 3RVXC 4BQ8A 1YAIA 3CBKB 2OJZL 2FBJH 3CVHH 1QBLL 2G75A 3MX0A 1X5AA 2DJUA 1OVZA 2EDNA 4ELKA 4Y89A 5DQJA 3GUTB 3HBQA 2W9EL 3KL3A 2FJGA 2KUTA 5F96L 2W65A 4JFVA 3KD4A 2OQJB 4KKCD 1USZA 2VAJA 1HIMH 1F58H 4O4YL 5L7XL 4LEBA 1IL1B 3QO0A 1RZGB 4H88H 5TPWL 4AYGA 2A99A 4YHIA 5JPNB 5DFWH 5DHYB 1QSFA 3QEQB 1E90A 1IJNA 4ZPTB 1SDDB 2VR5A 4DVBB 3QQDB 1YNLH 1N26A 1QEWA 4HGMA 3QWOB 2Y4SA 2EQDA 2QVMA 2R56H 4OIIH 3WTSA 1KB5B 1XEDA 4TSAL 4P46D 4XCYA 3V4PA 4ZTEA 2W07B 1Q72H 2NT1A 4MQ7A 3UG4A 1BIHA 3TNMA 3ZDZE 3CXHJ 4MMYB 4CDGC 3S34H 2OR9L 5DGQA 3N40P 2O30A 2MPVA 1F4XH 1L0XA 1G7QA 3HVNA 5EEZA 1YEGH 4S10A 1SLXA 2H32H 1KEGL 4XOAA 3U6RA 1J12A 2YQGA 5JIHA 1FNFA 1IC5L 4LLYB 3UTZB 1M42A 3VX1A 2FDBP 5I1KL 3LAFA 3UZVB 3II2A 5HY9A 1QTSA 3SYQA 4UAOC 4GKZB 4PG2A 5EBGA 4OBSA 1OV8A 5E1GA 2GEQA 3CZJA 4ZXBC 2H0FA 3U1SL 2MSPA 3B7SA 2YAOA 3H2PA 3VXME 1D5MB 4FFYL 1FFOB 4BM7A 1SXNA 1IBGH 3UZQA 3F12B 3GMNA 1U6AH 1YDPB 4IBSA 4Q7DA 5GRYA 4GRWE 4M5SA 1ILUA 1NH6A 4PJAA 4TXVB 2PYFA 4E41A 4HU8A 3MODH 2KLSA 4H2CA 4M93C 5CAYB 2SEBA 4N2IA 2YR3A 3MDJA 2ZPKL 3QIUC 4P46C 5HJ3B 4F2MA 3NK4A 3VXMD 3LPWA 1N6VA 4QHKJ 1PEWA 4FNTA 5E6IA 5BRZB 4I9WE 1G7IB 3GKWH 5DJ6B 4N8UA 3HEIB 2DAVA 5INCB 4X7EC 2IG2H 4G8GA 4HQQH 1LP9E 5IUCA 4G9FB 1FG9C 3SYOA 5IJKC 4HLJA 4X6DF 3L3DB 1P7HL 4WJG3 5C97A 3EYFB 4QRTA 4I9WD 3NZHH 1U8IA 1AQDB 1KN2H 1MCOL 5AAWC 3EJCA 3JVFC 3MRIB 3LRSB 3KCPB 5AZ2H 3QR1A 1G0YR 5E95B 3LZRA 2D8KA 1ZJAA 2D2CC 4F8NA 1T0NB 2NDFA 5SWZB 1ZTXH 2WQUA 1A7RH 2DQDH 3QRFM 3BRFA 1CC3A 2OMZB 1E4XI 2DKUA 4XMZA 2QADC 3UYRH 2QTEA 2YC1A 1MSPA 1QFUL 3NCJL 1HVXA 2EH8L 2HKHH 1K5NB 3O6KL 2YOAA 4X9HA 4WI7A 1QYGH 3EYSL 1IAOB 5I75B 2CJUH 5T5FH 3P9LA 4FEIA 3T0XA 5FAAA 3NZSA 1DO6A 1H3UA 5DHMC 1DP0A 3B56A 2PP9A 3WHE0 5BRPA 1SDAB 2XN9E 1QZNA 1XF5B 4N9GA 1AOZA 3MLWH 3PQYA 4OD3H 3LZLA 4FS0A 4X6EB 3QUZA 4LLQA 4BKSC 2Z1PA 3F7VB 1NGXA 4KQ3L 4KJYA 3L4CA 4OJDH 3LH2H 4ODSH 5IEKB 1J5IA 4XCEB 4UB0L 3VM5A 3NZ8A 1MWAH 1Q90A 2XN9D 1ZLEA 5CIPH 1JDCA 4Z95L 4UNVA 1YEFL 2PO6B 4QR7A 4M8VA 1ZLWH 4LCWB 2DBLH 5AAPA 3HG1B 3DMMC 5EU6A 4AL8C 3FFDA 4KC3B 5ITBH 2GAZA 2Z7ZA 1KCRL 1QMUA 3HC2A 4QYOA 5IM7B 3L7FA 3MGAA 5LGYA 5C1MB 1JHKH 1XSJA 3I84A 4U6XA 2F19H 2MCMA 2OSYA 3BOVA 3U36B 5DJZA 5LCVH 5L4JA 2UY6A 3BUQA 2HFEB 4F15C 5J7CC 2NDGA 2BINA 5D7JD 3TPUB 1KN4L 1I8UA 3MLVL 4MMZC 2ITCA 4CC4A 1E2ZA 2E27H 3PNWB 1VENA 1R34A 5H94A 4RAHA 2DL9A 4WEEA 2O61A 2YPLB 1FYTB 1OTTD 3GLAA 3S37X 5I76A 3QI9B 4ZFOB 5DHXB 3OR7B 3BAKA 3GSQA 3INUL 4M6NH 2XI9A 4AGOA 4ZS7L 3PWVA 4X0KB 1ML0A 5D4IA 1LK3L 5AVTB 1LEIA 2VW6A 3AG1B 2NY5H 2QGCA 1DBAH 1PFCA 3LV3A 1OL0A 2YRLA 3FB8A 3NP4A 5SV3A 3HE7B 1CLYL 2IF7A 4HCRL 3FN3A 2R1WA 3ZHLA 3DETC 1DEEB 5GRJL 3S4SB 1MF2L 2NY7L 3EKCA 2GI0A 3L4TA 4TSCH 5DDHA 3K3QA 3OAWA 2OR7A 5C8JB 2AVGA 3LQAC 4R3SB 1GCYA 3KL5A 5AB2A 1XHHA 3L9EA 2ZONA 1LD9B 4QHLB 4N0UE 4JFYA 1S7SA 4WF7A 3OPZH 2K70A 3O81A 4G1EB 5DJYA 2HUHA 4DKEL 4ELMB 3W5MA 1LO4H 3VD0A 3HRZC 4XNZB 3QDJE 1OP5K 5I1KH 1DLHB 1KB5L 1DJWA 2C9UA 2MPAH 5T1DL 1DBKH 2OR8A 4I8DA 2R0LH 3VWKD 1PZ5A 2J1KA 4IJ3B 1XF4B 1BAGA 1TZAA 5GJSH 4NZUL 3QQ4B 1HKLH 4TNVK 1XR8B 1QFWM 4ODTL 2JJWA 1R3KB 1ACYL 5TFSH 4EDXB 1V7MH 4KK9C 2B2XL 4HKXA 5HP5A 3QDJD 5DS1A 4A1RA 1X5GA 2ADYA 3UG3A 4ZBJA 5CFHA 5BOZG 4EEEA 2PWHA 4Y2DB 4PP1C 2Y1AA 4JR9H 1YPZA 4UIKL 3K4DA 3T2NH 2G60L 1QKZL 5IMOA 1CCZA 1HCFX 1S7QB 2W60A 5TH2B 1XXFC 4E9WA 1A1MB 3D2TA 1KYUA 4XNYL 4MAYD 3TTYA 2XA3A 2NPLX 2V5YA 5EIIA 2Y1ZA 2AGJH 3UDWC 1MFNA 1Q0XL 2OL3B 3DIFA 3OAZH 5F21B 3OL2A 4E5XB 3N85L 2XLLA 4M9OA 5INDA 4TL4A 5T8IA 1E4KC 1I75A 2OXHA 3I6GA 3TBTB 1FNSH 2DLTA 2DQFA 1NCDH 2PW1A 2HX7A 3M86A 4PJCF 4ETYA 4IBUA 2IGFL 2J21A 1IM3D 2I07A 2EAEA 2WD0A 2VC2L 4NC1E 1DSFH 1WLHA 4HJEA 5EA0L 4LSPL 2AJ3B 3VRLE 2Z3FA 2F1AA 4P2OC 4TN9A 4PBWD 2AJYL 5DD6B 5B3JF 1O6SA 1PX8A 1BGXL 4NQSB 3LZOA 4YBLC 3MRKA 4K7PX 4RZCA 4XNXL 2Q86B 1OALA 4UNUA 4IU3A 4MQTB 4HPHA 2G3MA 3WN6A 5LXGH 4PS4L 3QIWA 3IMRA 2JB6A 4FXTA 4EN3B 2LGNA 3PWLB 5CN1A 5GGRB 1PFOA 3OG6B 3VWJD 3FFCB 5T3XE 1TEFA 2BNQA 3JT0A 1MG2C 3BPLC 4G8IA 3OKNA 3GXFA 4J2QA 1KIUB 3QUYA 3VA2C 5BMFH 5C6WH 1UXSA 1WISA 1Z32X 3GJFA 3SKMB 2Q20A 2F7PA 2Q9OA 3KWVA 4CSPA 3FC8A 3PV6A 4M61B 3IJHB 3F64A 5GRWA 1UZ8A 3LCYA 4YSPA 5T3XD 5JW4Q 5E00B 4ABWA 4M5ZH 2Q87A