1IOFA

X-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, pyrococcus furiosus, and its cys-free mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
208
structure length
208
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLCNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMCYEMELEAVKVAIEVALEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYRROLIDONE CARBOXYL PEPTIDASE
publication title X-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, Pyrococcus furiosus, and its cys-free mutant
pubmed rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 69
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2001-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1iofA00
1IOIA 1IU8A 3GIUA 1AUGA 3LACA 3RNZA 1IOFA 1Z8WA 1Z8XA 3RO0A 1X12A 1A2ZA 1Z8TA 4HPSA 2EBJA 2DF5A 4GXHA 1X10A 2EO8A
chains in the Genus database with same CATH superfamily
1FNOA 1HDQA 3KI9A 2PQ8A 5H86A 2PJ9A 1Q2YA 4ZYQA 4CYOA 5AG5A 3IWWA 2GREA 5CBMA 2QIRA 5HMNA 2V77A 3DLJA 2B4DB 2G3TA 2PJCA 2Q4ZA 2VXKA 4AVCA 1IOFA 3BHXA 4KOSA 4CPAA 4EMEA 4ZX8A 4UCNA 4I49A 3BJ7A 3SXOA 4PXDA 5KTDA 4B13A 2QJ8A 2G9DA 4CYQA 3G8WA 3D2PA 4C68A 3VH9A 4GM5A 4FD5A 5I4MA 1WK4A 2P6EA 2OH1A 2PJ3A 3D68A 3I1UA 3R9FA 2AFMA 3ZZIA 5AG4A 3G3SA 4H6UA 4P4FA 4X5KA 5AG6A 1M1DA 4UA3A 4FUUA 3T90A 2O28A 2ZW5A 5LYIA 3NA6A 1IYLA 1N71A 3K9UA 3MN8A 1YLOA 1CM0A 4HNWB 2PJ2A 2POKA 3RAMA 4CGNA 1M4LA 1Y9KA 4P4DA 1QQ9A 1XIXA 5HVHA 2EWBA 2D4OA 4B6ZA 3LACA 4ZI6A 5HVGA 4MHNA 1XOVA 2KCWA 3H8FA 3KGQA 4PK2A 4U9YA 3V7ZA 5G21A 4OKOA 1XMTA 2HQYA 2RB7A 4X3RA 2QMLA 3D7GA 3E0KA 1YSJA 5DWNA 3S9MA 8CPAA 2GLFA 1M4IA 1QSTA 4FWUA 2PC1A 2PIZA 3H5ZA 4GS4A 4TNUA 3S6FA 2XEJA 1WWZA 2A4NA 4OC0A 4CGMA 4KSAA 3UY5A 1Z8LA 2PRQA 4FBEA 2Z11A 4MJ8A 4LX9A 2WPWA 3B35A 3QAYA 3R96A 3BI1A 3FB3A 1CBXA 4NF1A 1F57A 1YVKA 1ZLHA 2ZW4A 3FRMA 3MGDA 2FIWA 4UBRA 2EK9A 1BPMA 4ORFA 4CGOA 4BMHA 2P6FA 3TO9A 4R7MA 3RNZA 4XNHB 4WJBA 1IICA 5D8NA 4M3SA 4MFPA 4A30A 4OP4A 5G20A 4MHYA 3GB0A 4PQAA 4NCZA 4Y49C 1VHSA 1RO5A 4ZBGA 2EBJA 5LYFA 4UCMA 2Q7BA 3SJGA 4CGPA 3CXQA 2FIAA 2FVGA 4CYPA 2IL4A 1ARMA 4R6TA 2EK8A 4E0AA 2Q44A 3IIBA 4K3NA 2C1CA 4C7IA 2EO8A 3FH4A 2Z3LA 3PP9A 5JH9A 2ZEFA 3NFZA 3TCVA 3B3TA 1K4JA 5HXDA 4CAEA 3GIUA 4EVYA 4RI1A 2B4BA 5GCNA 3WC7A 4YU9A 1XE4A 4Q7AA 4F0YA 1A2ZA 3PRTA 4KVME 4FD6A 4QC6A 2GLJA 4NGTA 1PCAA 5F46A 3RYOA 1S3ZA 5I0CA 1QSOA 1S7KA 1Z9UA 2HC9A 2CXAA 3EO4A 2OU2A 2VI7A 2CTCA 4UCPA 3TT2A 4A94A 1AMPA 4AVBA 4FD4A 3B3CA 3KHZA 3P2FA 4KOXA 3DR6A 4RN7A 4JD6A 2GFQA 3CPXA 4NGMA 3SJXA 3DGVA 4AB7A 4UFVA 5EBVA 2CNSA 3IC1A 1Y9WA 1LOKA 3NE7A 5JQ4A 3KHXA 3FYNA 3NH5A 3KASA 4YGOA 2Z3OA 1UFHA 2EUIA 2ATRA 4OLLA 2JEVA 1Z8TA 4CAFA 4RUHA 4JLYA 2P6GA 3GKRA 2QECA 4MHZA 2Q43A 2DF5A 2DEAA 4KVXA 3QAHA 2AFUA 2XEGA 4R8FA 4NXYA 3CPAA 4UWJA 1XEBA 2ZELA 4HKFA 2J9AA 1LFWA 3PZJA 3S6KA 4NSQA 1IY7A 4TWEA 2CNMA 3L2NA 4P45A 1Q7LA 3WR7A 1KUXA 3SI0A 3PBEA 1XRYA 2JDCA 4IF5A 5FVJA 2AFSA 2C6GA 3B3SA 4QVTA 3VARA 4YWYA 2PDOA 5CPAA 1S5KA 2ZOFA 4MY0A 1SQHA 4DJLA 3TTHA 2B3VA 3ZJ0A 4U5YA 5LYLA 3B3WA 4R76A 4KOVA 1KUYA 2R1IA 2AJ6A 2C27A 2O53A 1X10A 1AYEA 3D3SA 3EXNA 3FIXA 3H8GA 4HNYB 3CZXA 1YW4A 3KR5A 4MFQA 3PFEA 2O4HA 4MMOA 4J3GA 4R9MA 4P4BA 1MJAA 3R1KA 3VWEA 6CPAA 2R8VA 1YREA 5AG7A 4PV6A 5EMIA 2CTBA 4EFDA 4CYNA 1VHEA 2JBKA 4KLWA 2RC4A 2VBQA 4M6IA 1LAPA 4PXEA 2G3AA 1VHOA 3I3GA 2ZEMA 1ARLA 4M6HA 4QUSA 2J8MA 3D7DA 4UIAA 4CS0B 4Y49B 4DNCA 2DPTA 2ZW6A 2G0BA 5LRKA 2Q04A 4M85A 2OR4A 2ZOGA 2ZEEA 4XPDC 4FAIA 4NGNA 4UFXA 4XPKA 4B14A 4AXVA 4L89A 1KWMA 3EFAA 1UWYA 3IWGA 4NJRA 2BUEA 2PVVA 3GLJA 4NGQA 4P4EA 3K9TA 3KQZA 5LRGA 4JXQA 3D7FA 1TF9A 4ZY0A 4FD7A 2I00A 2ZPAA 3PGPA 4IAVA 5H84A 4F6AA 3JTKA 4MHDA 3WABA 4LQ6A 1YK3A 4AVAA 3FECA 3I9SA 3PFOA 3HLPA 4KOUA 4OC4A 4Q36A 5LYDA 1Z4RA 1RTQA 4E8OA 4PXBA 3W6XA 3KQXA 1S60A 4JXRA 3IWEA 3PBBA 3CDXA 2AFWA 2BCOA 2REEA 3PEIA 4LQGA 1XBUA 2BOAA 5DWMA 4B5PB 4C2XA 4ZY1A 5JM6A 3S9NA 3N5FA 1TKFA 1M4GA 2WUUA 5K8MA 2F8HA 1MJBA 3TE4A 1I1DA 1QSRA 3EC4A 4UIBA 2PRBA 1R57A 1ZG9A 1ZG7A 2C6CA 2GIVA 2PJ1A 1XF8A 3F5BA 1P4NA 2V8HA 1LCPA 2PJ0A 2B5GA 5IV0A 1YW6A 4WWVA 2R7HA 3RZAA 1H8LA 2OZUA 4AG7A 4KVOE 2PR1A 5KTAA 1CPSA 5F47A 4UEFA 4R87A 2YNDA 3FJUA 2BSWA 2ZEDA 4OC1A 4A37A 4ZY2A 3TFYA 1LRZA 4KOTA 2QYVA 2FSRA 5BWAB 4NGPA 1IYKA 3B3VA 1M44A 5K8NA 3FX6A 1ON0A 3W6SA 1TXRA 3PB9X 3R9EA 2Y0MA 1QSMA 2ZEGA 1NSLA 3HUVA 1LANA 1YVOA 2AE6A 3A9LA 4UWIA 4AG9A 4KOWA 4A95A 2Q0YA 2XEFA 4PXCA 2WZNA 3SXNA 2IMOA 4XPLA 4ONWA 5D29A 2CIJA 1Y0RA 2NSMA 2CY2A 2BEIA 3JRUA 1GHEA 3IU1A 5LRJA 3D8PA 3DNSA 5IB0A 4OIWA 4KZTA 3N7ZA 2K5TA 4MFKA 4YRHA 2HUZA 4P44A 5E96A 3V8IA 4A31A 2ZEPA 4PSWA 3TO6A 2VZYA 4MFJA 4ZX9A 5AGEA 3S6HA 4B10A 4CAXA 4HPSA 2I3CA 1YX0A 1P0HA 4H6ZA 5A27A 3IGRA 4OAEA 1BO4A 1YR0A 4MCRA 4MI4A 2B4DA 4MRIA 3WT4A 1ZLIA 4B11A 4MBUA 1M4DA 1CPXA 3H8EA 1FY7A 1OBRA 3D66A 3W91A 5K8OA 4CRZB 3WC5A 5ISVA 1CP7A 1Z4EA 2PJ7A 3IFEA 1L0CA 1I21A 3R9GA 3NH4A 4KSFA 3KKWA 4A2ZA 2PJBA 2R98A 5F49A 2GANA 2PJ8A 1QMUA 3C26A 3D67A 5K8PA 3KZWA 2IQ6A 5KTCA 3FEDA 3TO7A 5J8FA 2IJZA 1JWQA 3DSBA 5J8CA 4MCQA 3LWUA 3NH8A 4X2TA 4KS9A 4R3LA 7CPAA 2PVWA 4XPDB 4QBJA 1ZG8A 2H5MA 4Z65A 3B8GA 2FXFA 2I79A 4MCPA 2AFXA 3SI2A 4F0XA 1BLLE 2JLMA 5C88A 3BXMA 4MY3A 3S6GA 4BINA 2ZENA 4F9UA 2YGWA 2WSAA 3D4UA 3GY9A 1F2OA 4NGSA 1QSNA 4JZ0A 3S9LA 3NE8A 3IO1A 4DUKA 3JVNA 2FT0A 5CNPA 1IB1E 1OZPA 1F2PA 2REFA 4OC2A 4CRYB 3DDDA 4C7HA 1CJWA 1B6BA 5HVFA 1VGYA 2GU2A 3GYAA 3RBUA 2Q7SA 2C6PA 2YNCA 1LAMA 1MK4A 4KUBA 2AFOA 1U6MA 1Z8XA 3KR4A 3RO0A 4G1PA 4P4IA 2Z0ZA 4MHPA 4NGRA 3TX8A 3BJ8A 3SI1A 3BLNA 3F8KA 2CNTA 4BBHA 1XMBA 5G22A 5IB9A 1ELLP 4OADA 4P4JA 1IIDA 4MFLA 3PB7X 2OZHA 4X8IA 2EVNA 4QB9A 2ZEHA 4JJXA 1TKJA 1FT7A 4K30A 1MJ9A 2PCUA 2JBJA 4ZGYB 2ODFA 5HH1A 1IOIA 1Z2LA 2X7BA 1PUAA 1Q2CA 2BO9A 1IU8A 1J4JA 3FVLA 2V8VA 4P10A 1PU9A 4IK2A 4P6YA 4EWTA 1B87A 4NFRA 3B2YA 5EC4A 4C2ZA 2VZZA 5ELYA 3VWDA 4R3KA 5A28A 1CP6A 1X12A 2PJ6A 2OZGA 3OWCA 4ONUA 1V0CA 4C2YA 2VQYA 4MCSA 3IU2A 2BL1A 2NMTA 2Q4YA 2FS5A 2PJ4A 5JGFA 1ZO0A 1I12A 1S7NA 3T8WA 3LODA 3QB8A 4KORA 4PPZA 2OOTA 1XJOA 5J1QA 3D2MA 2WYRA 2F5IA 4UEZA 2J8NA 1JQGA 2ANPA 2PR8A 2VEZA 1YQEA 4B12A 4CAVA 3VATA 1Y7EA 3MRUA 4IHMA 2Q51A 2QVPA 4PK3A 3CXSA 1GYTA 3FBUA 1VKCA 3SJEA 2PIYA 4OC3A 4W9YA 3FNCA 1S7FA 2VL1A 4CGLA 5C82A 4Q38A 2ZXVA 3ISXA 3SHPA 1CX8A 4A39A 1YMEA 4IUSA 1Y0YA 2ARHA 1YLEA 2ZW7A 2XEIA 1KZFA 4F9VA 2ABZA 2HV2A 4KOYA 5THWA 3D7HA 2PSWA 2YNEA 1RXTA 3H4QA 1VIXA 3TOBA 2YNCC 1IGBA 5IX3A 4JWPA 3QNVA 5JPHA 1TF8A 3DR8A 2FL4A 3PB6X 2OB0A 3GUXA 4OIDA 2PE3A 2B58A 2FE7A 3EY5A 2FCKA 3FF3A 2PJAA 3FEEA 3F0AA 1Y7RA 4H89A 4KUAA 1CG2A 1HEEA 3IJ3A 3R95A 3IEHA 2GE3A 5F48A 2Z3NA 3JUWA 2B3UA 2NYQA 2DPSA 5DS0A 3K2KA 4UEEA 4YFJA 2Q4VA 5G1ZA 4HNXB 4II9A 1YGHA 1Q2DA 1NSAA 2B5GB 3TC8A 2JDDA 1EE3P 3PB8X 4XNHC 4M6GA 4A38A 2PJ5A 2Z3PA 1TIQA 4NEXA 4E2AA 1KUVA 4H2KA 1S7LA 4GXHA 4LUAA 4OC5A 1HDUA 4U9ZA 3WC6A 4JYWA 1R3NA 2AFZA 3ISZA 3V38A 3CXPA 3SJFA 3FMCA 4CAWA 4BD9A 3KL9A 2WPXA 3PB4X 1DE4C 4A32A 4OMEA 2J8RA 1TKHA 2V8GA 3CT9A 1BOBA 2Z10A 1R43A 2HB6A 4NJQA 2Z3MA 1DTDA 2DXQA 3TOAA 3T9YA 3P2HA 3LD2A 1AUGA 4RS2A 1Z5RA 1NMTA 4A33A 1PYTB 4MFZA 4B5PA 1Z8WA 4KLVA 3B7IA 4R57A 3BI0A 3LMSA 2CF4A 4O23A 2JEWA 4F8ZA 2P0WA 4DYOA 4PSXA 1XFOA 2V8DA 4UF4A 4B5OA 2D4PA 2ZEOA 4MXUA 4UFWA 3FXTA 2Z3KA 4KSIA 1NE9A 5F09A 2RFHA 1BAVA 2F7VA 1BPNA 4L8AA 1ELMP
chains in the Genus database with same CATH topology
1IOIA 1IU8A 3GIUA 1AUGA 3LACA 3RNZA 1IOFA 1Z8WA 1Z8XA 3RO0A 1X12A 1A2ZA 1Z8TA 4HPSA 2EBJA 2DF5A 4GXHA 1X10A 2EO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IOI A;  1IU8 A;  3GIU A;  1AUG A;  3LAC A;  3RNZ A;  1IOF A;  1Z8W A;  1Z8X A;  3RO0 A;  1X12 A;  1A2Z A;  1Z8T A;  4HPS A;  2EBJ A;  2DF5 A;  4GXH A;  1X10 A;  2EO8 A; 
#chains in the Genus database with same CATH topology
 1FNO A;  1HDQ A;  3KI9 A;  2PQ8 A;  5H86 A;  2PJ9 A;  1Q2Y A;  4ZYQ A;  4CYO A;  5AG5 A;  3IWW A;  2GRE A;  5CBM A;  2QIR A;  5HMN A;  2V77 A;  3DLJ A;  2B4D B;  2G3T A;  2PJC A;  2Q4Z A;  2VXK A;  4AVC A;  1IOF A;  3BHX A;  4KOS A;  4CPA A;  4EME A;  4ZX8 A;  4UCN A;  4I49 A;  3BJ7 A;  3SXO A;  4PXD A;  5KTD A;  4B13 A;  2QJ8 A;  2G9D A;  4CYQ A;  3G8W A;  3D2P A;  4C68 A;  3VH9 A;  4GM5 A;  4FD5 A;  5I4M A;  1WK4 A;  2P6E A;  2OH1 A;  2PJ3 A;  3D68 A;  3I1U A;  3R9F A;  2AFM A;  3ZZI A;  5AG4 A;  3G3S A;  4H6U A;  4P4F A;  4X5K A;  5AG6 A;  1M1D A;  4UA3 A;  4FUU A;  3T90 A;  2O28 A;  2ZW5 A;  5LYI A;  3NA6 A;  1IYL A;  1N71 A;  3K9U A;  3MN8 A;  1YLO A;  1CM0 A;  4HNW B;  2PJ2 A;  2POK A;  3RAM A;  4CGN A;  1M4L A;  1Y9K A;  4P4D A;  1QQ9 A;  1XIX A;  5HVH A;  2EWB A;  2D4O A;  4B6Z A;  3LAC A;  4ZI6 A;  5HVG A;  4MHN A;  1XOV A;  2KCW A;  3H8F A;  3KGQ A;  4PK2 A;  4U9Y A;  3V7Z A;  5G21 A;  4OKO A;  1XMT A;  2HQY A;  2RB7 A;  4X3R A;  2QML A;  3D7G A;  3E0K A;  1YSJ A;  5DWN A;  3S9M A;  8CPA A;  2GLF A;  1M4I A;  1QST A;  4FWU A;  2PC1 A;  2PIZ A;  3H5Z A;  4GS4 A;  4TNU A;  3S6F A;  2XEJ A;  1WWZ A;  2A4N A;  4OC0 A;  4CGM A;  4KSA A;  3UY5 A;  1Z8L A;  2PRQ A;  4FBE A;  2Z11 A;  4MJ8 A;  4LX9 A;  2WPW A;  3B35 A;  3QAY A;  3R96 A;  3BI1 A;  3FB3 A;  1CBX A;  4NF1 A;  1F57 A;  1YVK A;  1ZLH A;  2ZW4 A;  3FRM A;  3MGD A;  2FIW A;  4UBR A;  2EK9 A;  1BPM A;  4ORF A;  4CGO A;  4BMH A;  2P6F A;  3TO9 A;  4R7M A;  3RNZ A;  4XNH B;  4WJB A;  1IIC A;  5D8N A;  4M3S A;  4MFP A;  4A30 A;  4OP4 A;  5G20 A;  4MHY A;  3GB0 A;  4PQA A;  4NCZ A;  4Y49 C;  1VHS A;  1RO5 A;  4ZBG A;  2EBJ A;  5LYF A;  4UCM A;  2Q7B A;  3SJG A;  4CGP A;  3CXQ A;  2FIA A;  2FVG A;  4CYP A;  2IL4 A;  1ARM A;  4R6T A;  2EK8 A;  4E0A A;  2Q44 A;  3IIB A;  4K3N A;  2C1C A;  4C7I A;  2EO8 A;  3FH4 A;  2Z3L A;  3PP9 A;  5JH9 A;  2ZEF A;  3NFZ A;  3TCV A;  3B3T A;  1K4J A;  5HXD A;  4CAE A;  3GIU A;  4EVY A;  4RI1 A;  2B4B A;  5GCN A;  3WC7 A;  4YU9 A;  1XE4 A;  4Q7A A;  4F0Y A;  1A2Z A;  3PRT A;  4KVM E;  4FD6 A;  4QC6 A;  2GLJ A;  4NGT A;  1PCA A;  5F46 A;  3RYO A;  1S3Z A;  5I0C A;  1QSO A;  1S7K A;  1Z9U A;  2HC9 A;  2CXA A;  3EO4 A;  2OU2 A;  2VI7 A;  2CTC A;  4UCP A;  3TT2 A;  4A94 A;  1AMP A;  4AVB A;  4FD4 A;  3B3C A;  3KHZ A;  3P2F A;  4KOX A;  3DR6 A;  4RN7 A;  4JD6 A;  2GFQ A;  3CPX A;  4NGM A;  3SJX A;  3DGV A;  4AB7 A;  4UFV A;  5EBV A;  2CNS A;  3IC1 A;  1Y9W A;  1LOK A;  3NE7 A;  5JQ4 A;  3KHX A;  3FYN A;  3NH5 A;  3KAS A;  4YGO A;  2Z3O A;  1UFH A;  2EUI A;  2ATR A;  4OLL A;  2JEV A;  1Z8T A;  4CAF A;  4RUH A;  4JLY A;  2P6G A;  3GKR A;  2QEC A;  4MHZ A;  2Q43 A;  2DF5 A;  2DEA A;  4KVX A;  3QAH A;  2AFU A;  2XEG A;  4R8F A;  4NXY A;  3CPA A;  4UWJ A;  1XEB A;  2ZEL A;  4HKF A;  2J9A A;  1LFW A;  3PZJ A;  3S6K A;  4NSQ A;  1IY7 A;  4TWE A;  2CNM A;  3L2N A;  4P45 A;  1Q7L A;  3WR7 A;  1KUX A;  3SI0 A;  3PBE A;  1XRY A;  2JDC A;  4IF5 A;  5FVJ A;  2AFS A;  2C6G A;  3B3S A;  4QVT A;  3VAR A;  4YWY A;  2PDO A;  5CPA A;  1S5K A;  2ZOF A;  4MY0 A;  1SQH A;  4DJL A;  3TTH A;  2B3V A;  3ZJ0 A;  4U5Y A;  5LYL A;  3B3W A;  4R76 A;  4KOV A;  1KUY A;  2R1I A;  2AJ6 A;  2C27 A;  2O53 A;  1X10 A;  1AYE A;  3D3S A;  3EXN A;  3FIX A;  3H8G A;  4HNY B;  3CZX A;  1YW4 A;  3KR5 A;  4MFQ A;  3PFE A;  2O4H A;  4MMO A;  4J3G A;  4R9M A;  4P4B A;  1MJA A;  3R1K A;  3VWE A;  6CPA A;  2R8V A;  1YRE A;  5AG7 A;  4PV6 A;  5EMI A;  2CTB A;  4EFD A;  4CYN A;  1VHE A;  2JBK A;  4KLW A;  2RC4 A;  2VBQ A;  4M6I A;  1LAP A;  4PXE A;  2G3A A;  1VHO A;  3I3G A;  2ZEM A;  1ARL A;  4M6H A;  4QUS A;  2J8M A;  3D7D A;  4UIA A;  4CS0 B;  4Y49 B;  4DNC A;  2DPT A;  2ZW6 A;  2G0B A;  5LRK A;  2Q04 A;  4M85 A;  2OR4 A;  2ZOG A;  2ZEE A;  4XPD C;  4FAI A;  4NGN A;  4UFX A;  4XPK A;  4B14 A;  4AXV A;  4L89 A;  1KWM A;  3EFA A;  1UWY A;  3IWG A;  4NJR A;  2BUE A;  2PVV A;  3GLJ A;  4NGQ A;  4P4E A;  3K9T A;  3KQZ A;  5LRG A;  4JXQ A;  3D7F A;  1TF9 A;  4ZY0 A;  4FD7 A;  2I00 A;  2ZPA A;  3PGP A;  4IAV A;  5H84 A;  4F6A A;  3JTK A;  4MHD A;  3WAB A;  4LQ6 A;  1YK3 A;  4AVA A;  3FEC A;  3I9S A;  3PFO A;  3HLP A;  4KOU A;  4OC4 A;  4Q36 A;  5LYD A;  1Z4R A;  1RTQ A;  4E8O A;  4PXB A;  3W6X A;  3KQX A;  1S60 A;  4JXR A;  3IWE A;  3PBB A;  3CDX A;  2AFW A;  2BCO A;  2REE A;  3PEI A;  4LQG A;  1XBU A;  2BOA A;  5DWM A;  4B5P B;  4C2X A;  4ZY1 A;  5JM6 A;  3S9N A;  3N5F A;  1TKF A;  1M4G A;  2WUU A;  5K8M A;  2F8H A;  1MJB A;  3TE4 A;  1I1D A;  1QSR A;  3EC4 A;  4UIB A;  2PRB A;  1R57 A;  1ZG9 A;  1ZG7 A;  2C6C A;  2GIV A;  2PJ1 A;  1XF8 A;  3F5B A;  1P4N A;  2V8H A;  1LCP A;  2PJ0 A;  2B5G A;  5IV0 A;  1YW6 A;  4WWV A;  2R7H A;  3RZA A;  1H8L A;  2OZU A;  4AG7 A;  4KVO E;  2PR1 A;  5KTA A;  1CPS A;  5F47 A;  4UEF A;  4R87 A;  2YND A;  3FJU A;  2BSW A;  2ZED A;  4OC1 A;  4A37 A;  4ZY2 A;  3TFY A;  1LRZ A;  4KOT A;  2QYV A;  2FSR A;  5BWA B;  4NGP A;  1IYK A;  3B3V A;  1M44 A;  5K8N A;  3FX6 A;  1ON0 A;  3W6S A;  1TXR A;  3PB9 X;  3R9E A;  2Y0M A;  1QSM A;  2ZEG A;  1NSL A;  3HUV A;  1LAN A;  1YVO A;  2AE6 A;  3A9L A;  4UWI A;  4AG9 A;  4KOW A;  4A95 A;  2Q0Y A;  2XEF A;  4PXC A;  2WZN A;  3SXN A;  2IMO A;  4XPL A;  4ONW A;  5D29 A;  2CIJ A;  1Y0R A;  2NSM A;  2CY2 A;  2BEI A;  3JRU A;  1GHE A;  3IU1 A;  5LRJ A;  3D8P A;  3DNS A;  5IB0 A;  4OIW A;  4KZT A;  3N7Z A;  2K5T A;  4MFK A;  4YRH A;  2HUZ A;  4P44 A;  5E96 A;  3V8I A;  4A31 A;  2ZEP A;  4PSW A;  3TO6 A;  2VZY A;  4MFJ A;  4ZX9 A;  5AGE A;  3S6H A;  4B10 A;  4CAX A;  4HPS A;  2I3C A;  1YX0 A;  1P0H A;  4H6Z A;  5A27 A;  3IGR A;  4OAE A;  1BO4 A;  1YR0 A;  4MCR A;  4MI4 A;  2B4D A;  4MRI A;  3WT4 A;  1ZLI A;  4B11 A;  4MBU A;  1M4D A;  1CPX A;  3H8E A;  1FY7 A;  1OBR A;  3D66 A;  3W91 A;  5K8O A;  4CRZ B;  3WC5 A;  5ISV A;  1CP7 A;  1Z4E A;  2PJ7 A;  3IFE A;  1L0C A;  1I21 A;  3R9G A;  3NH4 A;  4KSF A;  3KKW A;  4A2Z A;  2PJB A;  2R98 A;  5F49 A;  2GAN A;  2PJ8 A;  1QMU A;  3C26 A;  3D67 A;  5K8P A;  3KZW A;  2IQ6 A;  5KTC A;  3FED A;  3TO7 A;  5J8F A;  2IJZ A;  1JWQ A;  3DSB A;  5J8C A;  4MCQ A;  3LWU A;  3NH8 A;  4X2T A;  4KS9 A;  4R3L A;  7CPA A;  2PVW A;  4XPD B;  4QBJ A;  1ZG8 A;  2H5M A;  4Z65 A;  3B8G A;  2FXF A;  2I79 A;  4MCP A;  2AFX A;  3SI2 A;  4F0X A;  1BLL E;  2JLM A;  5C88 A;  3BXM A;  4MY3 A;  3S6G A;  4BIN A;  2ZEN A;  4F9U A;  2YGW A;  2WSA A;  3D4U A;  3GY9 A;  1F2O A;  4NGS A;  1QSN A;  4JZ0 A;  3S9L A;  3NE8 A;  3IO1 A;  4DUK A;  3JVN A;  2FT0 A;  5CNP A;  1IB1 E;  1OZP A;  1F2P A;  2REF A;  4OC2 A;  4CRY B;  3DDD A;  4C7H A;  1CJW A;  1B6B A;  5HVF A;  1VGY A;  2GU2 A;  3GYA A;  3RBU A;  2Q7S A;  2C6P A;  2YNC A;  1LAM A;  1MK4 A;  4KUB A;  2AFO A;  1U6M A;  1Z8X A;  3KR4 A;  3RO0 A;  4G1P A;  4P4I A;  2Z0Z A;  4MHP A;  4NGR A;  3TX8 A;  3BJ8 A;  3SI1 A;  3BLN A;  3F8K A;  2CNT A;  4BBH A;  1XMB A;  5G22 A;  5IB9 A;  1ELL P;  4OAD A;  4P4J A;  1IID A;  4MFL A;  3PB7 X;  2OZH A;  4X8I A;  2EVN A;  4QB9 A;  2ZEH A;  4JJX A;  1TKJ A;  1FT7 A;  4K30 A;  1MJ9 A;  2PCU A;  2JBJ A;  4ZGY B;  2ODF A;  5HH1 A;  1IOI A;  1Z2L A;  2X7B A;  1PUA A;  1Q2C A;  2BO9 A;  1IU8 A;  1J4J A;  3FVL A;  2V8V A;  4P10 A;  1PU9 A;  4IK2 A;  4P6Y A;  4EWT A;  1B87 A;  4NFR A;  3B2Y A;  5EC4 A;  4C2Z A;  2VZZ A;  5ELY A;  3VWD A;  4R3K A;  5A28 A;  1CP6 A;  1X12 A;  2PJ6 A;  2OZG A;  3OWC A;  4ONU A;  1V0C A;  4C2Y A;  2VQY A;  4MCS A;  3IU2 A;  2BL1 A;  2NMT A;  2Q4Y A;  2FS5 A;  2PJ4 A;  5JGF A;  1ZO0 A;  1I12 A;  1S7N A;  3T8W A;  3LOD A;  3QB8 A;  4KOR A;  4PPZ A;  2OOT A;  1XJO A;  5J1Q A;  3D2M A;  2WYR A;  2F5I A;  4UEZ A;  2J8N A;  1JQG A;  2ANP A;  2PR8 A;  2VEZ A;  1YQE A;  4B12 A;  4CAV A;  3VAT A;  1Y7E A;  3MRU A;  4IHM A;  2Q51 A;  2QVP A;  4PK3 A;  3CXS A;  1GYT A;  3FBU A;  1VKC A;  3SJE A;  2PIY A;  4OC3 A;  4W9Y A;  3FNC A;  1S7F A;  2VL1 A;  4CGL A;  5C82 A;  4Q38 A;  2ZXV A;  3ISX A;  3SHP A;  1CX8 A;  4A39 A;  1YME A;  4IUS A;  1Y0Y A;  2ARH A;  1YLE A;  2ZW7 A;  2XEI A;  1KZF A;  4F9V A;  2ABZ A;  2HV2 A;  4KOY A;  5THW A;  3D7H A;  2PSW A;  2YNE A;  1RXT A;  3H4Q A;  1VIX A;  3TOB A;  2YNC C;  1IGB A;  5IX3 A;  4JWP A;  3QNV A;  5JPH A;  1TF8 A;  3DR8 A;  2FL4 A;  3PB6 X;  2OB0 A;  3GUX A;  4OID A;  2PE3 A;  2B58 A;  2FE7 A;  3EY5 A;  2FCK A;  3FF3 A;  2PJA A;  3FEE A;  3F0A A;  1Y7R A;  4H89 A;  4KUA A;  1CG2 A;  1HEE A;  3IJ3 A;  3R95 A;  3IEH A;  2GE3 A;  5F48 A;  2Z3N A;  3JUW A;  2B3U A;  2NYQ A;  2DPS A;  5DS0 A;  3K2K A;  4UEE A;  4YFJ A;  2Q4V A;  5G1Z A;  4HNX B;  4II9 A;  1YGH A;  1Q2D A;  1NSA A;  2B5G B;  3TC8 A;  2JDD A;  1EE3 P;  3PB8 X;  4XNH C;  4M6G A;  4A38 A;  2PJ5 A;  2Z3P A;  1TIQ A;  4NEX A;  4E2A A;  1KUV A;  4H2K A;  1S7L A;  4GXH A;  4LUA A;  4OC5 A;  1HDU A;  4U9Z A;  3WC6 A;  4JYW A;  1R3N A;  2AFZ A;  3ISZ A;  3V38 A;  3CXP A;  3SJF A;  3FMC A;  4CAW A;  4BD9 A;  3KL9 A;  2WPX A;  3PB4 X;  1DE4 C;  4A32 A;  4OME A;  2J8R A;  1TKH A;  2V8G A;  3CT9 A;  1BOB A;  2Z10 A;  1R43 A;  2HB6 A;  4NJQ A;  2Z3M A;  1DTD A;  2DXQ A;  3TOA A;  3T9Y A;  3P2H A;  3LD2 A;  1AUG A;  4RS2 A;  1Z5R A;  1NMT A;  4A33 A;  1PYT B;  4MFZ A;  4B5P A;  1Z8W A;  4KLV A;  3B7I A;  4R57 A;  3BI0 A;  3LMS A;  2CF4 A;  4O23 A;  2JEW A;  4F8Z A;  2P0W A;  4DYO A;  4PSX A;  1XFO A;  2V8D A;  4UF4 A;  4B5O A;  2D4P A;  2ZEO A;  4MXU A;  4UFW A;  3FXT A;  2Z3K A;  4KSI A;  1NE9 A;  5F09 A;  2RFH A;  1BAV A;  2F7V A;  1BPN A;  4L8A A;  1ELM P; 
#chains in the Genus database with same CATH homology
 1IOI A;  1IU8 A;  3GIU A;  1AUG A;  3LAC A;  3RNZ A;  1IOF A;  1Z8W A;  1Z8X A;  3RO0 A;  1X12 A;  1A2Z A;  1Z8T A;  4HPS A;  2EBJ A;  2DF5 A;  4GXH A;  1X10 A;  2EO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...