1IOFA

X-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, pyrococcus furiosus, and its cys-free mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
208
structure length
208
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLCNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMCYEMELEAVKVAIEVALEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYRROLIDONE CARBOXYL PEPTIDASE
publication title X-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, Pyrococcus furiosus, and its cys-free mutant
pubmed rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 69
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2001-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1iofA00
1A2ZA 1Z8TA 2EO8A 1X10A 1X12A 1AUGA 1Z8WA 1Z8XA 1IOFA 3GIUA 3LACA 3RO0A 2DF5A 3RNZA 1IU8A 4HPSA 1IOIA 4GXHA 2EBJA
chains in the Genus database with same CATH superfamily
4UEFA 4PK2A 4P4EA 2PCUA 1VKCA 1VIXA 1XRYA 5ISVA 1IGBA 3QAYA 4KUAA 1QSMA 4JJXA 3A9LA 2PRBA 4FD4A 4HNYB 1MJ9A 4IAVA 3IGRA 4UIBA 2Q7BA 4CYOA 2V8VA 5F49A 4A30A 3L2NA 2G0BA 4FUUA 4ONWA 2P0WA 3D66A 5E96A 1CG2A 2F7VA 1Z8XA 3N5FA 4KLVA 4A31A 1IOFA 4MHDA 1ELMP 2FSRA 2NMTA 2ZW4A 4CYPA 2ZELA 4XPKA 4MCRA 4UCNA 4X5KA 4E8OA 1MJBA 4DYOA 2EK8A 2PJ8A 3ZJ0A 4QC6A 4JZ0A 4ONUA 3D68A 3FIXA 3KHZA 3DR6A 5HVHA 2X7BA 1LOKA 3TO9A 1AYEA 1R43A 2VZYA 4H6ZA 4JD6A 1R57A 4MCSA 2Z10A 3BXMA 3IJ3A 1BPMA 4PXBA 3SJXA 3R9EA 1XE4A 3NA6A 3PFEA 1YK3A 4G1PA 3BJ8A 3GYAA 3JVNA 3R96A 2ZEEA 2QMLA 4JWPA 4UWIA 3B8GA 3D2PA 2EUIA 3H8FA 2Q51A 5G20A 4AVCA 2VQYA 1Q2YA 2ZEMA 2PR8A 3LWUA 4MFZA 3DLJA 4OKOA 4RN7A 1S5KA 4HPSA 2AE6A 2PJAA 1J4JA 2WYRA 3QB8A 4YU9A 5HVFA 4CGPA 4RUHA 1A2ZA 1LAMA 2AFMA 2XEGA 4XNHB 3TC8A 1VHOA 3D67A 2PVVA 2HB6A 1X10A 3NH8A 3NH5A 4H6UA 3R95A 2WZNA 5LYDA 3R9GA 1PCAA 3D4UA 4MXUA 2B5GB 2FCKA 2PJBA 4AVBA 3DGVA 5AG7A 3FJUA 4P4FA 3B35A 1S3ZA 3D7HA 4YWYA 2FXFA 5KTDA 5F46A 3DR8A 2OB0A 5GCNA 2AFZA 4M6IA 4UFXA 2OOTA 2B58A 4XPDC 3RO0A 5EC4A 2FIAA 4QVTA 4NJQA 5THWA 1K4JA 5HXDA 3CDXA 4GXHA 3KHXA 3MN8A 1M44A 5G22A 4KSFA 4KOSA 3VWEA 4F0YA 4OMEA 2C27A 3HLPA 4UCPA 5AG6A 4MFKA 4A94A 1QSTA 7CPAA 1LRZA 8CPAA 2ANPA 2G3TA 1FNOA 2G9DA 3PB7X 1CBXA 2JEWA 4BMHA 2Z3PA 2IL4A 4MI4A 3KR4A 4K30A 1XFOA 1M4DA 3PZJA 3EXNA 2BUEA 2OR4A 2RFHA 2CF4A 5AGEA 5LRJA 2Z11A 4M6HA 1XF8A 5DS0A 4MCPA 4A95A 2DPSA 2ZW6A 4A2ZA 4DUKA 2Q4VA 4CGLA 3F5BA 5G1ZA 5F48A 1Z4EA 1IIDA 1YLOA 3QAHA 1L0CA 2P6EA 3S6HA 1KUYA 4FD5A 1S7LA 3KR5A 3S9NA 3D8PA 3C26A 4XPLA 2A4NA 1Z9UA 2WPWA 3B3VA 3NFZA 3I1UA 4C2ZA 1TXRA 3VWDA 3K2KA 3RYOA 2V77A 3FECA 3BJ7A 1Y0RA 3ZZIA 1PUAA 5KTCA 4NGSA 3CT9A 3CZXA 2CXAA 4X8IA 5JGFA 3CXQA 4MFQA 1UWYA 1RTQA 3VATA 3RAMA 5EBVA 1ZLHA 3V38A 1S7KA 2PQ8A 1M4LA 1OZPA 4UEEA 5F47A 3S6GA 4AVAA 2C6CA 5ELYA 4X3RA 4MY0A 1SQHA 3PB6X 4WJBA 1AMPA 5A28A 2HUZA 4UFVA 2GLJA 3B3CA 1IU8A 3SXOA 1VHSA 4UWJA 3CPXA 4B6ZA 2PE3A 1OBRA 4OLLA 3GKRA 3FX6A 2PJ4A 4IK2A 2EWBA 1Z8LA 1U6MA 1ARLA 2PJ3A 4IHMA 2YNEA 5IX3A 2QYVA 2YNCC 1KUVA 5J1QA 4R3LA 2DPTA 1FT7A 2QJ8A 2HQYA 3EO4A 1Y9WA 2YNDA 4MFJA 1IICA 2B3VA 4BBHA 3IU2A 1QSNA 1Z2LA 4LQGA 3WABA 3SI1A 1CJWA 2WPXA 2BCOA 2PJCA 4OC1A 4QUSA 4UBRA 4FWUA 4Z65A 3KI9A 4OC5A 2DEAA 5CNPA 4MBUA 5LRGA 2R1IA 2FE7A 3T90A 5K8PA 1YW4A 2R7HA 3PP9A 3R1KA 4P4JA 2BO9A 2B4BA 1NMTA 4B12A 5FVJA 4CAEA 4X2TA 1KUXA 4MY3A 1M4GA 2XEJA 4P44A 2AFWA 2ATRA 2ZENA 4CAXA 4CRYB 2I79A 3B2YA 3FVLA 4XNHC 3WR7A 4RS2A 3TX8A 4R76A 1I12A 2FIWA 1RXTA 2Q44A 4R87A 2Z3NA 4II9A 3K9UA 1VHEA 3FXTA 4MHNA 4DJLA 1AUGA 3RZAA 5C82A 3FF3A 1Q2DA 4PXEA 1Y7EA 4ZYQA 2AFXA 2FL4A 2VI7A 3FYNA 4Y49C 1YSJA 4CYNA 6CPAA 4FD7A 4MRIA 3S6KA 4W9YA 2PR1A 4NJRA 5EMIA 1YW6A 2J8NA 2POKA 4KZTA 3N7ZA 4BD9A 5LRKA 5I0CA 4MMOA 5K8OA 4F9UA 3EC4A 2QECA 2ZEFA 5J8FA 1Y0YA 3VH9A 1BPNA 3FH4A 5A27A 4R8FA 4CAVA 2EK9A 4HNWB 1IYKA 1N71A 1NE9A 4NF1A 1DTDA 4EVYA 3CXSA 3JRUA 3NH4A 2ARHA 1BAVA 2XEIA 1QMUA 2ZEDA 1M1DA 5LYLA 4AB7A 3E0KA 3B3TA 3G3SA 1M4IA 3TE4A 3B3SA 2PJ9A 1TIQA 2GLFA 3MGDA 3P2HA 4Q36A 3R9FA 2C6GA 2JLMA 2Q04A 4F9VA 3TO6A 4E0AA 5H86A 4P4BA 2VZZA 2WUUA 3GIUA 4OC2A 4LQ6A 1IYLA 1FY7A 1LAPA 4MHZA 4C2YA 4CAFA 5K8NA 2CTBA 1GYTA 3KGQA 4UA3A 4ZY2A 3NE8A 5JH9A 2BSWA 4P4DA 2PRQA 2CNTA 1Z8TA 1IY7A 3H5ZA 1P0HA 4E2AA 2PJ1A 2ZEPA 1YQEA 3NE7A 3SJFA 2BEIA 3PBBA 4KSIA 3CPAA 1XMBA 2Q7SA 4PPZA 4U9ZA 4ZGYB 4JLYA 1X12A 5IB0A 2P6GA 3IWEA 3D3SA 2PJ5A 2PJ7A 3OWCA 4YRHA 4CGNA 3GY9A 3KQZA 4PSXA 4KSAA 2PJ0A 1TF8A 3G8WA 4UEZA 2B3UA 4R9MA 3TFYA 3MRUA 2KCWA 2ABZA 5CBMA 3PB8X 3IWGA 2PIZA 2IJZA 1Q2CA 2Q4YA 1P4NA 2EBJA 2GU2A 2ZEOA 1DE4C 3GB0A 5CPAA 2WSAA 1Y9KA 5AG4A 4KOVA 2O4HA 3JTKA 4B14A 1I21A 1ZG9A 4B11A 3IEHA 4OC4A 1XEBA 2ZW7A 2OZHA 2Y0MA 4KUBA 4ZBGA 2HC9A 1QQ9A 2VEZA 4C68A 2OZUA 4NCZA 1YVKA 2Q0YA 2ZEGA 2IMOA 4O23A 4KOWA 2NSMA 2ZOGA 4YFJA 1B87A 5D8NA 4XPDB 5LYFA 2R98A 4Q38A 3B3WA 5D29A 2Z0ZA 1Q7LA 1ARMA 2PJ6A 4A37A 4CGOA 1QSRA 3SXNA 3IC1A 4P6YA 1CM0A 3D2MA 5H84A 4AG9A 3S9MA 1S60A 3V8IA 4U9YA 4OIDA 2C6PA 3WC7A 3KKWA 1TKFA 4B13A 1BOBA 4HNXB 4OC3A 1UFHA 4R3KA 2JDDA 4H89A 5HVGA 5DWNA 3JUWA 4FBEA 2ZEHA 3PEIA 4I49A 3DSBA 3FBUA 2Z3KA 3FEDA 2BL1A 4CGMA 3S9LA 2Z3OA 2YGWA 2V8GA 2Q43A 4OIWA 3LODA 2CIJA 3F8KA 4KOXA 1TKJA 5HMNA 4C2XA 3H4QA 1WWZA 1LANA 4NGPA 2IQ6A 4M85A 2QVPA 4A32A 3FB3A 4A33A 4HKFA 1BLLE 4EWTA 2GE3A 3FEEA 3D7GA 2VXKA 4CPAA 4MHPA 5BWAB 2GANA 3SI0A 5K8MA 3V7ZA 3TT2A 2YNCA 4OADA 3RBUA 4PQAA 4R7MA 1LCPA 3WC5A 2PC1A 1EE3P 1Z4RA 4NGNA 4QBJA 2EVNA 1PYTB 1Y7RA 1JWQA 4IF5A 1CPXA 4KOTA 2VL1A 4IUSA 4KORA 4NFRA 3TOBA 3I3GA 5I4MA 3DDDA 2JBKA 4PXDA 4NGMA 3WC6A 1S7NA 2C1CA 2PIYA 4LUAA 4CYQA 3B7IA 3W91A 3S6FA 1XMTA 2K5TA 4P45A 1IB1E 3ISXA 1R3NA 2PDOA 3KL9A 4Q7AA 3KZWA 4P10A 3BI1A 3GUXA 3PFOA 2FT0A 4FD6A 4NGRA 1CP6A 3PBEA 2O53A 1ZLIA 4P4IA 1QSOA 2BOAA 3TCVA 4KOYA 4ORFA 1ZG7A 3TO7A 1MK4A 1LFWA 3F0AA 4B5PA 2RB7A 4OP4A 4MFPA 4B10A 4KS9A 3FNCA 1GHEA 1ZG8A 5C88A 1F57A 2OZGA 1XOVA 4C7HA 2B5GA 3EFAA 2JBJA 2OU2A 4F0XA 5LYIA 1Z8WA 3D7FA 5JM6A 2B4DA 3CXPA 2AJ6A 5HH1A 1YR0A 1YVOA 3UY5A 3LACA 5IB9A 2GREA 4NGTA 2DF5A 1TF9A 2HV2A 4MFLA 3RNZA 3SJGA 2Z3MA 1IOIA 1Z5RA 4NGQA 3FMCA 3W6XA 3BHXA 4ZI6A 4PK3A 2PSWA 1BO4A 5JPHA 2R8VA 4B5PB 1F2PA 3H8GA 4UF4A 3LD2A 3WT4A 4M6GA 4RI1A 1VGYA 2PJ2A 4L89A 4QB9A 2XEFA 4MHYA 1CX8A 3PGPA 1YMEA 4OAEA 1XBUA 5J8CA 2D4OA 2P6FA 1NSAA 1TKHA 3K9TA 2H5MA 2JDCA 4K3NA 4NSQA 4EFDA 1H8LA 3IIBA 2AFUA 2V8HA 4JXRA 4KVME 4Y49B 3KQXA 2RC4A 3SHPA 4GM5A 2B4DB 1HDQA 1S7FA 2CTCA 3KASA 4A38A 4UFWA 4F6AA 2ZPAA 3TTHA 4DNCA 5AG5A 2GIVA 3LMSA 2ZOFA 3PRTA 5F09A 4MJ8A 2J8MA 1WK4A 1JQGA 3T8WA 4A39A 1ELLP 4ZX8A 5JQ4A 1YGHA 3PB4X 2VBQA 2PVWA 2I00A 4GS4A 4KVOE 4WWVA 2J9AA 4H2KA 1RO5A 4KVXA 1NSLA 4C7IA 4TNUA 3IFEA 2EO8A 1YX0A 2CNMA 4ZY1A 1I1DA 2O28A 4U5YA 3SI2A 5IV0A 4B5OA 4UIAA 2AFOA 4J3GA 3H8EA 3T9YA 2I3CA 2G3AA 4CAWA 4CRZB 3FRMA 4LX9A 3TOAA 2CNSA 1HDUA 1XIXA 2JEVA 2REFA 4NXYA 2REEA 4KOUA 4R6TA 3D7DA 3VARA 3DNSA 4PSWA 2FVGA 2V8DA 4M3SA 2CY2A 1B6BA 4KLWA 2ZW5A 2F5IA 4ZX9A 3SJEA 3W6SA 3EY5A 4BINA 2NYQA 4TWEA 4AXVA 1ON0A 4MCQA 4PXCA 1YLEA 3HUVA 4JYWA 2F8HA 2Z3LA 1KZFA 2GFQA 1V0CA 3BI0A 3PB9X 4L8AA 3QNVA 4NEXA 4YGOA 5G21A 4ZY0A 3I9SA 1CPSA 3BLNA 5KTAA 2DXQA 4PV6A 3GLJA 4JXQA 1MJAA 4FAIA 2OH1A 4CS0B 2QIRA 1ZO0A 3IU1A 5DWMA 3IWWA 1KWMA 1PU9A 4OC0A 3ISZA 4R57A 4UCMA 4F8ZA 1XJOA 2FS5A 1F2OA 2AFSA 1YREA 2ODFA 2Q4ZA 3P2FA 2J8RA 4EMEA 3IO1A 2ZXVA 1HEEA 1CP7A 2D4PA 4AG7A
chains in the Genus database with same CATH topology
1A2ZA 1Z8TA 2EO8A 1X10A 1X12A 1AUGA 1Z8WA 1Z8XA 1IOFA 3GIUA 3LACA 3RO0A 2DF5A 3RNZA 1IU8A 4HPSA 1IOIA 4GXHA 2EBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2Z A;  1Z8T A;  2EO8 A;  1X10 A;  1X12 A;  1AUG A;  1Z8W A;  1Z8X A;  1IOF A;  3GIU A;  3LAC A;  3RO0 A;  2DF5 A;  3RNZ A;  1IU8 A;  4HPS A;  1IOI A;  4GXH A;  2EBJ A; 
#chains in the Genus database with same CATH topology
 4UEF A;  4PK2 A;  4P4E A;  2PCU A;  1VKC A;  1VIX A;  1XRY A;  5ISV A;  1IGB A;  3QAY A;  4KUA A;  1QSM A;  4JJX A;  3A9L A;  2PRB A;  4FD4 A;  4HNY B;  1MJ9 A;  4IAV A;  3IGR A;  4UIB A;  2Q7B A;  4CYO A;  2V8V A;  5F49 A;  4A30 A;  3L2N A;  2G0B A;  4FUU A;  4ONW A;  2P0W A;  3D66 A;  5E96 A;  1CG2 A;  2F7V A;  1Z8X A;  3N5F A;  4KLV A;  4A31 A;  1IOF A;  4MHD A;  1ELM P;  2FSR A;  2NMT A;  2ZW4 A;  4CYP A;  2ZEL A;  4XPK A;  4MCR A;  4UCN A;  4X5K A;  4E8O A;  1MJB A;  4DYO A;  2EK8 A;  2PJ8 A;  3ZJ0 A;  4QC6 A;  4JZ0 A;  4ONU A;  3D68 A;  3FIX A;  3KHZ A;  3DR6 A;  5HVH A;  2X7B A;  1LOK A;  3TO9 A;  1AYE A;  1R43 A;  2VZY A;  4H6Z A;  4JD6 A;  1R57 A;  4MCS A;  2Z10 A;  3BXM A;  3IJ3 A;  1BPM A;  4PXB A;  3SJX A;  3R9E A;  1XE4 A;  3NA6 A;  3PFE A;  1YK3 A;  4G1P A;  3BJ8 A;  3GYA A;  3JVN A;  3R96 A;  2ZEE A;  2QML A;  4JWP A;  4UWI A;  3B8G A;  3D2P A;  2EUI A;  3H8F A;  2Q51 A;  5G20 A;  4AVC A;  2VQY A;  1Q2Y A;  2ZEM A;  2PR8 A;  3LWU A;  4MFZ A;  3DLJ A;  4OKO A;  4RN7 A;  1S5K A;  4HPS A;  2AE6 A;  2PJA A;  1J4J A;  2WYR A;  3QB8 A;  4YU9 A;  5HVF A;  4CGP A;  4RUH A;  1A2Z A;  1LAM A;  2AFM A;  2XEG A;  4XNH B;  3TC8 A;  1VHO A;  3D67 A;  2PVV A;  2HB6 A;  1X10 A;  3NH8 A;  3NH5 A;  4H6U A;  3R95 A;  2WZN A;  5LYD A;  3R9G A;  1PCA A;  3D4U A;  4MXU A;  2B5G B;  2FCK A;  2PJB A;  4AVB A;  3DGV A;  5AG7 A;  3FJU A;  4P4F A;  3B35 A;  1S3Z A;  3D7H A;  4YWY A;  2FXF A;  5KTD A;  5F46 A;  3DR8 A;  2OB0 A;  5GCN A;  2AFZ A;  4M6I A;  4UFX A;  2OOT A;  2B58 A;  4XPD C;  3RO0 A;  5EC4 A;  2FIA A;  4QVT A;  4NJQ A;  5THW A;  1K4J A;  5HXD A;  3CDX A;  4GXH A;  3KHX A;  3MN8 A;  1M44 A;  5G22 A;  4KSF A;  4KOS A;  3VWE A;  4F0Y A;  4OME A;  2C27 A;  3HLP A;  4UCP A;  5AG6 A;  4MFK A;  4A94 A;  1QST A;  7CPA A;  1LRZ A;  8CPA A;  2ANP A;  2G3T A;  1FNO A;  2G9D A;  3PB7 X;  1CBX A;  2JEW A;  4BMH A;  2Z3P A;  2IL4 A;  4MI4 A;  3KR4 A;  4K30 A;  1XFO A;  1M4D A;  3PZJ A;  3EXN A;  2BUE A;  2OR4 A;  2RFH A;  2CF4 A;  5AGE A;  5LRJ A;  2Z11 A;  4M6H A;  1XF8 A;  5DS0 A;  4MCP A;  4A95 A;  2DPS A;  2ZW6 A;  4A2Z A;  4DUK A;  2Q4V A;  4CGL A;  3F5B A;  5G1Z A;  5F48 A;  1Z4E A;  1IID A;  1YLO A;  3QAH A;  1L0C A;  2P6E A;  3S6H A;  1KUY A;  4FD5 A;  1S7L A;  3KR5 A;  3S9N A;  3D8P A;  3C26 A;  4XPL A;  2A4N A;  1Z9U A;  2WPW A;  3B3V A;  3NFZ A;  3I1U A;  4C2Z A;  1TXR A;  3VWD A;  3K2K A;  3RYO A;  2V77 A;  3FEC A;  3BJ7 A;  1Y0R A;  3ZZI A;  1PUA A;  5KTC A;  4NGS A;  3CT9 A;  3CZX A;  2CXA A;  4X8I A;  5JGF A;  3CXQ A;  4MFQ A;  1UWY A;  1RTQ A;  3VAT A;  3RAM A;  5EBV A;  1ZLH A;  3V38 A;  1S7K A;  2PQ8 A;  1M4L A;  1OZP A;  4UEE A;  5F47 A;  3S6G A;  4AVA A;  2C6C A;  5ELY A;  4X3R A;  4MY0 A;  1SQH A;  3PB6 X;  4WJB A;  1AMP A;  5A28 A;  2HUZ A;  4UFV A;  2GLJ A;  3B3C A;  1IU8 A;  3SXO A;  1VHS A;  4UWJ A;  3CPX A;  4B6Z A;  2PE3 A;  1OBR A;  4OLL A;  3GKR A;  3FX6 A;  2PJ4 A;  4IK2 A;  2EWB A;  1Z8L A;  1U6M A;  1ARL A;  2PJ3 A;  4IHM A;  2YNE A;  5IX3 A;  2QYV A;  2YNC C;  1KUV A;  5J1Q A;  4R3L A;  2DPT A;  1FT7 A;  2QJ8 A;  2HQY A;  3EO4 A;  1Y9W A;  2YND A;  4MFJ A;  1IIC A;  2B3V A;  4BBH A;  3IU2 A;  1QSN A;  1Z2L A;  4LQG A;  3WAB A;  3SI1 A;  1CJW A;  2WPX A;  2BCO A;  2PJC A;  4OC1 A;  4QUS A;  4UBR A;  4FWU A;  4Z65 A;  3KI9 A;  4OC5 A;  2DEA A;  5CNP A;  4MBU A;  5LRG A;  2R1I A;  2FE7 A;  3T90 A;  5K8P A;  1YW4 A;  2R7H A;  3PP9 A;  3R1K A;  4P4J A;  2BO9 A;  2B4B A;  1NMT A;  4B12 A;  5FVJ A;  4CAE A;  4X2T A;  1KUX A;  4MY3 A;  1M4G A;  2XEJ A;  4P44 A;  2AFW A;  2ATR A;  2ZEN A;  4CAX A;  4CRY B;  2I79 A;  3B2Y A;  3FVL A;  4XNH C;  3WR7 A;  4RS2 A;  3TX8 A;  4R76 A;  1I12 A;  2FIW A;  1RXT A;  2Q44 A;  4R87 A;  2Z3N A;  4II9 A;  3K9U A;  1VHE A;  3FXT A;  4MHN A;  4DJL A;  1AUG A;  3RZA A;  5C82 A;  3FF3 A;  1Q2D A;  4PXE A;  1Y7E A;  4ZYQ A;  2AFX A;  2FL4 A;  2VI7 A;  3FYN A;  4Y49 C;  1YSJ A;  4CYN A;  6CPA A;  4FD7 A;  4MRI A;  3S6K A;  4W9Y A;  2PR1 A;  4NJR A;  5EMI A;  1YW6 A;  2J8N A;  2POK A;  4KZT A;  3N7Z A;  4BD9 A;  5LRK A;  5I0C A;  4MMO A;  5K8O A;  4F9U A;  3EC4 A;  2QEC A;  2ZEF A;  5J8F A;  1Y0Y A;  3VH9 A;  1BPN A;  3FH4 A;  5A27 A;  4R8F A;  4CAV A;  2EK9 A;  4HNW B;  1IYK A;  1N71 A;  1NE9 A;  4NF1 A;  1DTD A;  4EVY A;  3CXS A;  3JRU A;  3NH4 A;  2ARH A;  1BAV A;  2XEI A;  1QMU A;  2ZED A;  1M1D A;  5LYL A;  4AB7 A;  3E0K A;  3B3T A;  3G3S A;  1M4I A;  3TE4 A;  3B3S A;  2PJ9 A;  1TIQ A;  2GLF A;  3MGD A;  3P2H A;  4Q36 A;  3R9F A;  2C6G A;  2JLM A;  2Q04 A;  4F9V A;  3TO6 A;  4E0A A;  5H86 A;  4P4B A;  2VZZ A;  2WUU A;  3GIU A;  4OC2 A;  4LQ6 A;  1IYL A;  1FY7 A;  1LAP A;  4MHZ A;  4C2Y A;  4CAF A;  5K8N A;  2CTB A;  1GYT A;  3KGQ A;  4UA3 A;  4ZY2 A;  3NE8 A;  5JH9 A;  2BSW A;  4P4D A;  2PRQ A;  2CNT A;  1Z8T A;  1IY7 A;  3H5Z A;  1P0H A;  4E2A A;  2PJ1 A;  2ZEP A;  1YQE A;  3NE7 A;  3SJF A;  2BEI A;  3PBB A;  4KSI A;  3CPA A;  1XMB A;  2Q7S A;  4PPZ A;  4U9Z A;  4ZGY B;  4JLY A;  1X12 A;  5IB0 A;  2P6G A;  3IWE A;  3D3S A;  2PJ5 A;  2PJ7 A;  3OWC A;  4YRH A;  4CGN A;  3GY9 A;  3KQZ A;  4PSX A;  4KSA A;  2PJ0 A;  1TF8 A;  3G8W A;  4UEZ A;  2B3U A;  4R9M A;  3TFY A;  3MRU A;  2KCW A;  2ABZ A;  5CBM A;  3PB8 X;  3IWG A;  2PIZ A;  2IJZ A;  1Q2C A;  2Q4Y A;  1P4N A;  2EBJ A;  2GU2 A;  2ZEO A;  1DE4 C;  3GB0 A;  5CPA A;  2WSA A;  1Y9K A;  5AG4 A;  4KOV A;  2O4H A;  3JTK A;  4B14 A;  1I21 A;  1ZG9 A;  4B11 A;  3IEH A;  4OC4 A;  1XEB A;  2ZW7 A;  2OZH A;  2Y0M A;  4KUB A;  4ZBG A;  2HC9 A;  1QQ9 A;  2VEZ A;  4C68 A;  2OZU A;  4NCZ A;  1YVK A;  2Q0Y A;  2ZEG A;  2IMO A;  4O23 A;  4KOW A;  2NSM A;  2ZOG A;  4YFJ A;  1B87 A;  5D8N A;  4XPD B;  5LYF A;  2R98 A;  4Q38 A;  3B3W A;  5D29 A;  2Z0Z A;  1Q7L A;  1ARM A;  2PJ6 A;  4A37 A;  4CGO A;  1QSR A;  3SXN A;  3IC1 A;  4P6Y A;  1CM0 A;  3D2M A;  5H84 A;  4AG9 A;  3S9M A;  1S60 A;  3V8I A;  4U9Y A;  4OID A;  2C6P A;  3WC7 A;  3KKW A;  1TKF A;  4B13 A;  1BOB A;  4HNX B;  4OC3 A;  1UFH A;  4R3K A;  2JDD A;  4H89 A;  5HVG A;  5DWN A;  3JUW A;  4FBE A;  2ZEH A;  3PEI A;  4I49 A;  3DSB A;  3FBU A;  2Z3K A;  3FED A;  2BL1 A;  4CGM A;  3S9L A;  2Z3O A;  2YGW A;  2V8G A;  2Q43 A;  4OIW A;  3LOD A;  2CIJ A;  3F8K A;  4KOX A;  1TKJ A;  5HMN A;  4C2X A;  3H4Q A;  1WWZ A;  1LAN A;  4NGP A;  2IQ6 A;  4M85 A;  2QVP A;  4A32 A;  3FB3 A;  4A33 A;  4HKF A;  1BLL E;  4EWT A;  2GE3 A;  3FEE A;  3D7G A;  2VXK A;  4CPA A;  4MHP A;  5BWA B;  2GAN A;  3SI0 A;  5K8M A;  3V7Z A;  3TT2 A;  2YNC A;  4OAD A;  3RBU A;  4PQA A;  4R7M A;  1LCP A;  3WC5 A;  2PC1 A;  1EE3 P;  1Z4R A;  4NGN A;  4QBJ A;  2EVN A;  1PYT B;  1Y7R A;  1JWQ A;  4IF5 A;  1CPX A;  4KOT A;  2VL1 A;  4IUS A;  4KOR A;  4NFR A;  3TOB A;  3I3G A;  5I4M A;  3DDD A;  2JBK A;  4PXD A;  4NGM A;  3WC6 A;  1S7N A;  2C1C A;  2PIY A;  4LUA A;  4CYQ A;  3B7I A;  3W91 A;  3S6F A;  1XMT A;  2K5T A;  4P45 A;  1IB1 E;  3ISX A;  1R3N A;  2PDO A;  3KL9 A;  4Q7A A;  3KZW A;  4P10 A;  3BI1 A;  3GUX A;  3PFO A;  2FT0 A;  4FD6 A;  4NGR A;  1CP6 A;  3PBE A;  2O53 A;  1ZLI A;  4P4I A;  1QSO A;  2BOA A;  3TCV A;  4KOY A;  4ORF A;  1ZG7 A;  3TO7 A;  1MK4 A;  1LFW A;  3F0A A;  4B5P A;  2RB7 A;  4OP4 A;  4MFP A;  4B10 A;  4KS9 A;  3FNC A;  1GHE A;  1ZG8 A;  5C88 A;  1F57 A;  2OZG A;  1XOV A;  4C7H A;  2B5G A;  3EFA A;  2JBJ A;  2OU2 A;  4F0X A;  5LYI A;  1Z8W A;  3D7F A;  5JM6 A;  2B4D A;  3CXP A;  2AJ6 A;  5HH1 A;  1YR0 A;  1YVO A;  3UY5 A;  3LAC A;  5IB9 A;  2GRE A;  4NGT A;  2DF5 A;  1TF9 A;  2HV2 A;  4MFL A;  3RNZ A;  3SJG A;  2Z3M A;  1IOI A;  1Z5R A;  4NGQ A;  3FMC A;  3W6X A;  3BHX A;  4ZI6 A;  4PK3 A;  2PSW A;  1BO4 A;  5JPH A;  2R8V A;  4B5P B;  1F2P A;  3H8G A;  4UF4 A;  3LD2 A;  3WT4 A;  4M6G A;  4RI1 A;  1VGY A;  2PJ2 A;  4L89 A;  4QB9 A;  2XEF A;  4MHY A;  1CX8 A;  3PGP A;  1YME A;  4OAE A;  1XBU A;  5J8C A;  2D4O A;  2P6F A;  1NSA A;  1TKH A;  3K9T A;  2H5M A;  2JDC A;  4K3N A;  4NSQ A;  4EFD A;  1H8L A;  3IIB A;  2AFU A;  2V8H A;  4JXR A;  4KVM E;  4Y49 B;  3KQX A;  2RC4 A;  3SHP A;  4GM5 A;  2B4D B;  1HDQ A;  1S7F A;  2CTC A;  3KAS A;  4A38 A;  4UFW A;  4F6A A;  2ZPA A;  3TTH A;  4DNC A;  5AG5 A;  2GIV A;  3LMS A;  2ZOF A;  3PRT A;  5F09 A;  4MJ8 A;  2J8M A;  1WK4 A;  1JQG A;  3T8W A;  4A39 A;  1ELL P;  4ZX8 A;  5JQ4 A;  1YGH A;  3PB4 X;  2VBQ A;  2PVW A;  2I00 A;  4GS4 A;  4KVO E;  4WWV A;  2J9A A;  4H2K A;  1RO5 A;  4KVX A;  1NSL A;  4C7I A;  4TNU A;  3IFE A;  2EO8 A;  1YX0 A;  2CNM A;  4ZY1 A;  1I1D A;  2O28 A;  4U5Y A;  3SI2 A;  5IV0 A;  4B5O A;  4UIA A;  2AFO A;  4J3G A;  3H8E A;  3T9Y A;  2I3C A;  2G3A A;  4CAW A;  4CRZ B;  3FRM A;  4LX9 A;  3TOA A;  2CNS A;  1HDU A;  1XIX A;  2JEV A;  2REF A;  4NXY A;  2REE A;  4KOU A;  4R6T A;  3D7D A;  3VAR A;  3DNS A;  4PSW A;  2FVG A;  2V8D A;  4M3S A;  2CY2 A;  1B6B A;  4KLW A;  2ZW5 A;  2F5I A;  4ZX9 A;  3SJE A;  3W6S A;  3EY5 A;  4BIN A;  2NYQ A;  4TWE A;  4AXV A;  1ON0 A;  4MCQ A;  4PXC A;  1YLE A;  3HUV A;  4JYW A;  2F8H A;  2Z3L A;  1KZF A;  2GFQ A;  1V0C A;  3BI0 A;  3PB9 X;  4L8A A;  3QNV A;  4NEX A;  4YGO A;  5G21 A;  4ZY0 A;  3I9S A;  1CPS A;  3BLN A;  5KTA A;  2DXQ A;  4PV6 A;  3GLJ A;  4JXQ A;  1MJA A;  4FAI A;  2OH1 A;  4CS0 B;  2QIR A;  1ZO0 A;  3IU1 A;  5DWM A;  3IWW A;  1KWM A;  1PU9 A;  4OC0 A;  3ISZ A;  4R57 A;  4UCM A;  4F8Z A;  1XJO A;  2FS5 A;  1F2O A;  2AFS A;  1YRE A;  2ODF A;  2Q4Z A;  3P2F A;  2J8R A;  4EME A;  3IO1 A;  2ZXV A;  1HEE A;  1CP7 A;  2D4P A;  4AG7 A; 
#chains in the Genus database with same CATH homology
 1A2Z A;  1Z8T A;  2EO8 A;  1X10 A;  1X12 A;  1AUG A;  1Z8W A;  1Z8X A;  1IOF A;  3GIU A;  3LAC A;  3RO0 A;  2DF5 A;  3RNZ A;  1IU8 A;  4HPS A;  1IOI A;  4GXH A;  2EBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...