1IOFA

X-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, pyrococcus furiosus, and its cys-free mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
208
structure length
208
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLCNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMCYEMELEAVKVAIEVALEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, Pyrococcus furiosus, and its cys-free mutant
pubmed rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords PYRROLIDONE CARBOXYL PEPTIDASE
total genus 69
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2001-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1iofA00
1Z8XA 1A2ZA 4HPSA 3LACA 1IOFA 1X10A 4GXHA 2DF5A 2EO8A 3GIUA 1IOIA 1AUGA 1Z8TA 1X12A 3RO0A 1Z8WA 1IU8A 2EBJA 3RNZA
chains in the Genus database with same CATH superfamily
1BPNA 2AFZA 2P6EA 1HDQA 5THWA 2B5GB 3WC7A 3KHZA 3TC8A 4P4FA 2ZENA 2JDCA 4G1PA 1CJWA 4NSQA 4H2KA 4M3SA 4R57A 3PB4X 2QYVA 2FT0A 4UFVA 2EBJA 1YLEA 2ANPA 3KI9A 4MBUA 3R9FA 2HB6A 4BMHA 4MY3A 2JBJA 2OH1A 2PJ4A 4LX9A 4XPDC 5EMIA 4YWYA 5BWAB 3WR7A 4YFJA 1YX0A 4ZGYB 2GLJA 4MJ8A 4E2AA 2R8VA 3GUXA 2Y0MA 4UCNA 3T9YA 2DPTA 3D7HA 3KHXA 3VATA 4CRYB 5I4MA 2BOAA 3FJUA 2NYQA 4NGMA 3IU2A 4OKOA 4UIBA 2QVPA 2P6FA 4CGLA 1UFHA 4OAEA 2BSWA 5LYLA 4MFQA 1QSOA 2ZW4A 3FECA 3D4UA 3KKWA 1EE3P 4B6ZA 1MJBA 2Z10A 4PSXA 2ZW6A 3F5BA 3R9GA 4OC0A 5DWNA 4CAWA 2BL1A 1WWZA 2PJ3A 4H6ZA 5LYIA 4DJLA 4AG9A 4KVXA 2WZNA 3DR6A 4AVBA 2QECA 1YSJA 4R3KA 1TIQA 1QSTA 3QAHA 4KUBA 2PVVA 5JQ4A 3B8GA 3FEDA 1YW4A 3S6GA 3JTKA 5F46A 1CM0A 1L0CA 4KVOE 3DSBA 4A31A 2IQ6A 2FE7A 1VHOA 2IL4A 2VI7A 3H8GA 1LAPA 2ZEEA 4ONUA 4IK2A 4QC6A 4RI1A 5D8NA 3RAMA 2I3CA 2CF4A 4DNCA 1Y7EA 4TNUA 4GS4A 1BO4A 2PQ8A 2V8GA 1IGBA 3PB8X 4MCSA 1M44A 1FNOA 2V8HA 4L89A 2B58A 2FL4A 3IJ3A 1AUGA 1RXTA 2AE6A 1R43A 3D67A 3FYNA 3DLJA 4P4DA 4PV6A 4WWVA 2YNDA 4WJBA 2Q04A 4P4JA 2VZZA 2CNSA 4C2ZA 4DUKA 1ON0A 1Y9WA 3S9NA 2VZYA 2CIJA 1KUVA 2I00A 2KCWA 3CDXA 2D4PA 3IWWA 4FUUA 3PBBA 4B5PA 1Q2CA 4M6GA 3GIUA 1QSNA 2JBKA 3D66A 3G8WA 1X12A 2P6GA 4AXVA 5HMNA 2CTCA 2WSAA 1IYKA 1LFWA 2Q44A 3TE4A 5KTDA 3IWGA 1LANA 1YQEA 4UBRA 4ONWA 4KOYA 1XBUA 4P44A 1YW6A 3FH4A 3LMSA 3NH4A 4NXYA 4ORFA 4E0AA 2R1IA 5F49A 1B6BA 1VGYA 4ZBGA 4F9VA 5LYFA 2RC4A 3LODA 3TT2A 4X8IA 4F0YA 5A27A 2ZEFA 5K8NA 3CXQA 5AG6A 5E96A 4P4BA 3P2FA 4RN7A 4AG7A 4EVYA 5HXDA 1MK4A 1YVOA 3I3GA 3RZAA 4KSIA 1Z2LA 4J3GA 4Y49B 5F47A 1ZO0A 2B4DB 1LAMA 5G21A 4XPLA 4CYPA 4KLVA 4K3NA 1AYEA 2ZEPA 2Z11A 2QJ8A 4CGOA 5K8OA 4XPKA 4F0XA 1MJ9A 2JEWA 2OU2A 4JWPA 3MN8A 2GIVA 3BLNA 3IFEA 3PBEA 2J8NA 4PK2A 3R96A 4AVCA 2C6GA 2Q7BA 1VKCA 3B35A 3ISXA 1S7LA 4FD4A 2B3UA 5LRJA 2ZOGA 4CPAA 1S5KA 2PJ9A 5AG4A 5F09A 1Z8XA 2EVNA 3TFYA 1M4GA 2NMTA 2B4DA 4R7MA 3FEEA 2J8RA 1CPXA 1Z8TA 2PJ1A 1GHEA 2PJAA 4UCMA 4W9YA 1Z8LA 4F6AA 3A9LA 4EMEA 3TOAA 5I0CA 1YR0A 3WABA 1XJOA 1IOFA 4F9UA 2OR4A 2EUIA 2EK9A 2NSMA 5FVJA 5K8MA 4KOVA 5KTAA 2ARHA 4MHZA 1LOKA 3D7FA 5IB0A 4IHMA 4OC1A 1NSLA 4X3RA 1TKHA 2OZHA 1Q2DA 4OMEA 3T8WA 1IICA 1XIXA 1YREA 4MHNA 2XEJA 3CXSA 2YNCC 4PPZA 4UEEA 3I9SA 4MCRA 1RTQA 2PC1A 3C26A 1TKFA 1K4JA 3TOBA 4X2TA 1IOIA 1PUAA 4A95A 2Q4ZA 2G3TA 2VQYA 3B3CA 3K9UA 3KQXA 3QAYA 4BINA 3WC5A 4KOWA 2VBQA 1XRYA 2DF5A 2FXFA 2JDDA 3VWEA 3B7IA 4B14A 4EFDA 3GB0A 4MY0A 3CPAA 4M6IA 4F8ZA 2PR8A 3H8FA 4XNHC 3L2NA 4UEZA 2DXQA 5A28A 2ZEOA 2ZEMA 2H5MA 4KOTA 1YGHA 2Z3MA 3KQZA 3GY9A 3PB9X 2YGWA 2REFA 3CT9A 2Z3LA 4KSFA 4CAVA 3H8EA 3NH5A 2QMLA 4JZ0A 5AG5A 4HKFA 2PDOA 4ZYQA 2PJ0A 4C2XA 2RFHA 3EC4A 2J8MA 3R1KA 2CTBA 4FBEA 5LRKA 2HUZA 5HVFA 2PRBA 4NCZA 5C88A 1RO5A 4KS9A 4MCQA 1BLLE 1TXRA 4AB7A 1JWQA 5JM6A 1QSMA 3S6FA 4UWJA 4NF1A 1ZG7A 3KR5A 3NE7A 5JPHA 4YRHA 4UWIA 3TO7A 1ARLA 4L8AA 3PFEA 2ZELA 1J4JA 2VXKA 3SHPA 1F2PA 4C68A 2I79A 1LRZA 2C6CA 3HUVA 5HH1A 3SJEA 3RNZA 3G3SA 1Z4EA 4A2ZA 4C7HA 3V38A 1SQHA 1YLOA 2PIZA 4ZI6A 3D7DA 3GLJA 3KL9A 4C2YA 2IJZA 2BEIA 3FVLA 2JLMA 1DTDA 2F7VA 4KLWA 4PQAA 1VHSA 3MGDA 2GREA 5G20A 2R7HA 4A37A 4LQ6A 2G0BA 3NA6A 3SJGA 1NE9A 1ZLIA 4JD6A 4OIDA 3SI2A 2Q7SA 3I1UA 2GU2A 4P6YA 2RB7A 4QBJA 2Z0ZA 2ZW7A 4TWEA 4B12A 2Z3NA 3IC1A 4Q36A 3PP9A 2Q0YA 4M85A 3TCVA 1QSRA 1FT7A 2FIAA 4NJQA 4PK3A 4U9YA 5J8FA 3W6SA 4R87A 3BJ7A 2PJ6A 3CPXA 3D3SA 2PSWA 2VEZA 4GM5A 4ZY1A 3RO0A 1HEEA 1VIXA 2GLFA 2ZEGA 2ZEHA 2F5IA 3D2MA 3FNCA 5H86A 3TX8A 2O4HA 4H89A 3PB7X 4JXQA 4KUAA 3W91A 3JRUA 4GXHA 7CPAA 1ARMA 3E0KA 4UA3A 3ZZIA 1XMTA 3QB8A 2VL1A 3T90A 2OZUA 3F0AA 4NGPA 1NMTA 1OBRA 5HVHA 3V7ZA 3NE8A 2XEGA 1IIDA 1CX8A 1Y0RA 3HLPA 2DEAA 2PJ8A 4C7IA 2BCOA 3JVNA 4ZY2A 1Y9KA 3PZJA 3EY5A 2C27A 3SJXA 4NGNA 1F2OA 2Q4YA 3BHXA 1QMUA 3CXPA 4CYNA 2ODFA 3UY5A 4MMOA 4FWUA 4B13A 3WT4A 1GYTA 3PFOA 2WPXA 1NSAA 3IEHA 4PXBA 1S7NA 4MXUA 1S3ZA 4Y49C 4UIAA 4BBHA 1S7FA 4CAEA 4NGRA 4MI4A 4X5KA 1I21A 1Q2YA 3PGPA 1PU9A 8CPAA 2HC9A 3D68A 3OWCA 3FBUA 3H4QA 4KSAA 3LD2A 1TKJA 5AG7A 4LQGA 4DYOA 4PXEA 3KZWA 4KOXA 1M4LA 3N5FA 1M1DA 4HPSA 2B3VA 2PR1A 4H6UA 3N7ZA 1TF9A 3FRMA 2PJCA 1Z4RA 1Y7RA 4A94A 2AFSA 1CPSA 1PCAA 4ZX9A 2Z3PA 3B2YA 3SI1A 2POKA 4U5YA 5LRGA 1Z9UA 3VH9A 3GYAA 2Z3KA 3RYOA 1LCPA 1M4IA 3IIBA 2OB0A 3DGVA 4B11A 2AFOA 4PXDA 3R95A 1B87A 2ATRA 2PCUA 4R6TA 1IYLA 2FS5A 3B3WA 1KWMA 3LACA 4B5OA 2DPSA 2Q4VA 1P0HA 1VHEA 4ZX8A 2YNEA 4B5PB 3SXNA 4P45A 3FF3A 3RBUA 3IO1A 2R98A 1XF8A 4UEFA 1AMPA 4KVME 3DDDA 1H8LA 2D4OA 2C1CA 1V0CA 2BUEA 4AVAA 4MRIA 3S6HA 4KORA 5DS0A 2PJ2A 4O23A 4NJRA 3DR8A 5IV0A 3K2KA 4MFZA 1R57A 4UFXA 2JEVA 2WUUA 4NEXA 1CP6A 1QQ9A 5IX3A 4A33A 3P2HA 1YK3A 3BI1A 5CBMA 4FD5A 2ZEDA 1X10A 1BAVA 2QIRA 5CPAA 5H84A 5AGEA 2CXAA 3H5ZA 4YGOA 1XOVA 1F57A 1S7KA 4I49A 4P4IA 4XNHB 4OIWA 4CYQA 4OC5A 3KASA 2IMOA 2ZPAA 4MHYA 4QUSA 3JUWA 3FB3A 1XFOA 2O53A 4XPDB 2C6PA 2EO8A 3B3SA 4JYWA 3IGRA 4IAVA 3EXNA 1IU8A 3B3TA 2PJBA 3IWEA 5CNPA 4Q7AA 4PXCA 3SJFA 4FAIA 4MHPA 2X7BA 5IB9A 3ZJ0A 2V8DA 3S9MA 2FSRA 4MFKA 3FIXA 1WK4A 3NH8A 3EFAA 4UCPA 1M4DA 4UF4A 1U6MA 2J9AA 2EK8A 1IB1E 4PSWA 3KGQA 2B4BA 4A38A 2AFWA 3VWDA 2CNMA 4YU9A 3B3VA 4IUSA 4A30A 1KZFA 4QVTA 2WPWA 4NFRA 2GE3A 4NGTA 3DNSA 4FD6A 2F8HA 5JH9A 3CZXA 4OC3A 1CBXA 4R9MA 2FVGA 4MFLA 4MCPA 5ISVA 3ISZA 5J8CA 4BD9A 4NGQA 1A2ZA 5F48A 1Q7LA 4QB9A 1DE4C 1BOBA 4ZY0A 1ELMP 4M6HA 4R3LA 5EC4A 3TO9A 5KTCA 2ABZA 3R9EA 1TF8A 3S6KA 1XMBA 1XEBA 3FXTA 4HNYB 5J1QA 5LYDA 3LWUA 2REEA 2A4NA 2BO9A 3FMCA 2GANA 4JXRA 2PJ5A 4K30A 4KOUA 4R8FA 4A32A 1MJAA 2AFXA 1KUYA 2O28A 5EBVA 4EWTA 1UWYA 1N71A 2PE3A 1ZG9A 4A39A 5JGFA 4RS2A 4E8OA 3K9TA 2YNCA 1CG2A 2Q51A 2FCKA 4KZTA 5G22A 2PRQA 3PB6X 3TO6A 5HVGA 2XEIA 2CNTA 1FY7A 1ZG8A 4Z65A 4IF5A 4MFJA 3QNVA 4U9ZA 4R76A 2HV2A 2PVWA 3F8KA 3BXMA 4HNWB 4CGNA 4JJXA 5DWMA 3SXOA 2XEFA 4P10A 2ZOFA 4P4EA 2GFQA 3VARA 1IY7A 3MRUA 5GCNA 2B5GA 2HQYA 2EWBA 2AFMA 3D8PA 4Q38A 1JQGA 4CRZB 1R3NA 2PJ7A 6CPAA 4B10A 5K8PA 4OADA 2V77A 2PIYA 3EO4A 1Z5RA 2G3AA 3BI0A 2ZXVA 2Z3OA 3GKRA 3SI0A 4LUAA 3S9LA 4RUHA 3KR4A 4CGPA 2AFUA 4OC4A 2V8VA 4MFPA 4CS0B 1PYTB 2AJ6A 4OC2A 5ELYA 1OZPA 4KOSA 3W6XA 4JLYA 5D29A 1XE4A 3PEIA 4CAFA 4CYOA 3FX6A 2K5TA 1CP7A 2ZW5A 1S60A 4CGMA 5C82A 1YVKA 2FIWA 3V8IA 3BJ8A 1ELLP 2CY2A 3TTHA 3NFZA 3WC6A 4FD7A 1I1DA 2WYRA 1ZLHA 5G1ZA 2OOTA 2P0WA 1HDUA 2Q43A 3PRTA 4OP4A 4OLLA 3D2PA 4MHDA 4CAXA 1Y0YA 2G9DA 3D7GA 4II9A 3IU1A 1P4NA 2OZGA 4HNXB 1KUXA 4NGSA 1Z8WA 4UFWA 1YMEA 1I12A 1BPMA
chains in the Genus database with same CATH topology
1Z8XA 1A2ZA 4HPSA 3LACA 1IOFA 1X10A 4GXHA 2DF5A 2EO8A 3GIUA 1IOIA 1AUGA 1Z8TA 1X12A 3RO0A 1Z8WA 1IU8A 2EBJA 3RNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z8X A;  1A2Z A;  4HPS A;  3LAC A;  1IOF A;  1X10 A;  4GXH A;  2DF5 A;  2EO8 A;  3GIU A;  1IOI A;  1AUG A;  1Z8T A;  1X12 A;  3RO0 A;  1Z8W A;  1IU8 A;  2EBJ A;  3RNZ A; 
#chains in the Genus database with same CATH topology
 1BPN A;  2AFZ A;  2P6E A;  1HDQ A;  5THW A;  2B5G B;  3WC7 A;  3KHZ A;  3TC8 A;  4P4F A;  2ZEN A;  2JDC A;  4G1P A;  1CJW A;  4NSQ A;  4H2K A;  4M3S A;  4R57 A;  3PB4 X;  2QYV A;  2FT0 A;  4UFV A;  2EBJ A;  1YLE A;  2ANP A;  3KI9 A;  4MBU A;  3R9F A;  2HB6 A;  4BMH A;  4MY3 A;  2JBJ A;  2OH1 A;  2PJ4 A;  4LX9 A;  4XPD C;  5EMI A;  4YWY A;  5BWA B;  3WR7 A;  4YFJ A;  1YX0 A;  4ZGY B;  2GLJ A;  4MJ8 A;  4E2A A;  2R8V A;  3GUX A;  2Y0M A;  4UCN A;  3T9Y A;  2DPT A;  3D7H A;  3KHX A;  3VAT A;  4CRY B;  5I4M A;  2BOA A;  3FJU A;  2NYQ A;  4NGM A;  3IU2 A;  4OKO A;  4UIB A;  2QVP A;  2P6F A;  4CGL A;  1UFH A;  4OAE A;  2BSW A;  5LYL A;  4MFQ A;  1QSO A;  2ZW4 A;  3FEC A;  3D4U A;  3KKW A;  1EE3 P;  4B6Z A;  1MJB A;  2Z10 A;  4PSX A;  2ZW6 A;  3F5B A;  3R9G A;  4OC0 A;  5DWN A;  4CAW A;  2BL1 A;  1WWZ A;  2PJ3 A;  4H6Z A;  5LYI A;  4DJL A;  4AG9 A;  4KVX A;  2WZN A;  3DR6 A;  4AVB A;  2QEC A;  1YSJ A;  4R3K A;  1TIQ A;  1QST A;  3QAH A;  4KUB A;  2PVV A;  5JQ4 A;  3B8G A;  3FED A;  1YW4 A;  3S6G A;  3JTK A;  5F46 A;  1CM0 A;  1L0C A;  4KVO E;  3DSB A;  4A31 A;  2IQ6 A;  2FE7 A;  1VHO A;  2IL4 A;  2VI7 A;  3H8G A;  1LAP A;  2ZEE A;  4ONU A;  4IK2 A;  4QC6 A;  4RI1 A;  5D8N A;  3RAM A;  2I3C A;  2CF4 A;  4DNC A;  1Y7E A;  4TNU A;  4GS4 A;  1BO4 A;  2PQ8 A;  2V8G A;  1IGB A;  3PB8 X;  4MCS A;  1M44 A;  1FNO A;  2V8H A;  4L89 A;  2B58 A;  2FL4 A;  3IJ3 A;  1AUG A;  1RXT A;  2AE6 A;  1R43 A;  3D67 A;  3FYN A;  3DLJ A;  4P4D A;  4PV6 A;  4WWV A;  2YND A;  4WJB A;  2Q04 A;  4P4J A;  2VZZ A;  2CNS A;  4C2Z A;  4DUK A;  1ON0 A;  1Y9W A;  3S9N A;  2VZY A;  2CIJ A;  1KUV A;  2I00 A;  2KCW A;  3CDX A;  2D4P A;  3IWW A;  4FUU A;  3PBB A;  4B5P A;  1Q2C A;  4M6G A;  3GIU A;  1QSN A;  2JBK A;  3D66 A;  3G8W A;  1X12 A;  2P6G A;  4AXV A;  5HMN A;  2CTC A;  2WSA A;  1IYK A;  1LFW A;  2Q44 A;  3TE4 A;  5KTD A;  3IWG A;  1LAN A;  1YQE A;  4UBR A;  4ONW A;  4KOY A;  1XBU A;  4P44 A;  1YW6 A;  3FH4 A;  3LMS A;  3NH4 A;  4NXY A;  4ORF A;  4E0A A;  2R1I A;  5F49 A;  1B6B A;  1VGY A;  4ZBG A;  4F9V A;  5LYF A;  2RC4 A;  3LOD A;  3TT2 A;  4X8I A;  4F0Y A;  5A27 A;  2ZEF A;  5K8N A;  3CXQ A;  5AG6 A;  5E96 A;  4P4B A;  3P2F A;  4RN7 A;  4AG7 A;  4EVY A;  5HXD A;  1MK4 A;  1YVO A;  3I3G A;  3RZA A;  4KSI A;  1Z2L A;  4J3G A;  4Y49 B;  5F47 A;  1ZO0 A;  2B4D B;  1LAM A;  5G21 A;  4XPL A;  4CYP A;  4KLV A;  4K3N A;  1AYE A;  2ZEP A;  2Z11 A;  2QJ8 A;  4CGO A;  5K8O A;  4XPK A;  4F0X A;  1MJ9 A;  2JEW A;  2OU2 A;  4JWP A;  3MN8 A;  2GIV A;  3BLN A;  3IFE A;  3PBE A;  2J8N A;  4PK2 A;  3R96 A;  4AVC A;  2C6G A;  2Q7B A;  1VKC A;  3B35 A;  3ISX A;  1S7L A;  4FD4 A;  2B3U A;  5LRJ A;  2ZOG A;  4CPA A;  1S5K A;  2PJ9 A;  5AG4 A;  5F09 A;  1Z8X A;  2EVN A;  3TFY A;  1M4G A;  2NMT A;  2B4D A;  4R7M A;  3FEE A;  2J8R A;  1CPX A;  1Z8T A;  2PJ1 A;  1GHE A;  2PJA A;  4UCM A;  4W9Y A;  1Z8L A;  4F6A A;  3A9L A;  4EME A;  3TOA A;  5I0C A;  1YR0 A;  3WAB A;  1XJO A;  1IOF A;  4F9U A;  2OR4 A;  2EUI A;  2EK9 A;  2NSM A;  5FVJ A;  5K8M A;  4KOV A;  5KTA A;  2ARH A;  4MHZ A;  1LOK A;  3D7F A;  5IB0 A;  4IHM A;  4OC1 A;  1NSL A;  4X3R A;  1TKH A;  2OZH A;  1Q2D A;  4OME A;  3T8W A;  1IIC A;  1XIX A;  1YRE A;  4MHN A;  2XEJ A;  3CXS A;  2YNC C;  4PPZ A;  4UEE A;  3I9S A;  4MCR A;  1RTQ A;  2PC1 A;  3C26 A;  1TKF A;  1K4J A;  3TOB A;  4X2T A;  1IOI A;  1PUA A;  4A95 A;  2Q4Z A;  2G3T A;  2VQY A;  3B3C A;  3K9U A;  3KQX A;  3QAY A;  4BIN A;  3WC5 A;  4KOW A;  2VBQ A;  1XRY A;  2DF5 A;  2FXF A;  2JDD A;  3VWE A;  3B7I A;  4B14 A;  4EFD A;  3GB0 A;  4MY0 A;  3CPA A;  4M6I A;  4F8Z A;  2PR8 A;  3H8F A;  4XNH C;  3L2N A;  4UEZ A;  2DXQ A;  5A28 A;  2ZEO A;  2ZEM A;  2H5M A;  4KOT A;  1YGH A;  2Z3M A;  3KQZ A;  3GY9 A;  3PB9 X;  2YGW A;  2REF A;  3CT9 A;  2Z3L A;  4KSF A;  4CAV A;  3H8E A;  3NH5 A;  2QML A;  4JZ0 A;  5AG5 A;  4HKF A;  2PDO A;  4ZYQ A;  2PJ0 A;  4C2X A;  2RFH A;  3EC4 A;  2J8M A;  3R1K A;  2CTB A;  4FBE A;  5LRK A;  2HUZ A;  5HVF A;  2PRB A;  4NCZ A;  5C88 A;  1RO5 A;  4KS9 A;  4MCQ A;  1BLL E;  1TXR A;  4AB7 A;  1JWQ A;  5JM6 A;  1QSM A;  3S6F A;  4UWJ A;  4NF1 A;  1ZG7 A;  3KR5 A;  3NE7 A;  5JPH A;  4YRH A;  4UWI A;  3TO7 A;  1ARL A;  4L8A A;  3PFE A;  2ZEL A;  1J4J A;  2VXK A;  3SHP A;  1F2P A;  4C68 A;  2I79 A;  1LRZ A;  2C6C A;  3HUV A;  5HH1 A;  3SJE A;  3RNZ A;  3G3S A;  1Z4E A;  4A2Z A;  4C7H A;  3V38 A;  1SQH A;  1YLO A;  2PIZ A;  4ZI6 A;  3D7D A;  3GLJ A;  3KL9 A;  4C2Y A;  2IJZ A;  2BEI A;  3FVL A;  2JLM A;  1DTD A;  2F7V A;  4KLW A;  4PQA A;  1VHS A;  3MGD A;  2GRE A;  5G20 A;  2R7H A;  4A37 A;  4LQ6 A;  2G0B A;  3NA6 A;  3SJG A;  1NE9 A;  1ZLI A;  4JD6 A;  4OID A;  3SI2 A;  2Q7S A;  3I1U A;  2GU2 A;  4P6Y A;  2RB7 A;  4QBJ A;  2Z0Z A;  2ZW7 A;  4TWE A;  4B12 A;  2Z3N A;  3IC1 A;  4Q36 A;  3PP9 A;  2Q0Y A;  4M85 A;  3TCV A;  1QSR A;  1FT7 A;  2FIA A;  4NJQ A;  4PK3 A;  4U9Y A;  5J8F A;  3W6S A;  4R87 A;  3BJ7 A;  2PJ6 A;  3CPX A;  3D3S A;  2PSW A;  2VEZ A;  4GM5 A;  4ZY1 A;  3RO0 A;  1HEE A;  1VIX A;  2GLF A;  2ZEG A;  2ZEH A;  2F5I A;  3D2M A;  3FNC A;  5H86 A;  3TX8 A;  2O4H A;  4H89 A;  3PB7 X;  4JXQ A;  4KUA A;  3W91 A;  3JRU A;  4GXH A;  7CPA A;  1ARM A;  3E0K A;  4UA3 A;  3ZZI A;  1XMT A;  3QB8 A;  2VL1 A;  3T90 A;  2OZU A;  3F0A A;  4NGP A;  1NMT A;  1OBR A;  5HVH A;  3V7Z A;  3NE8 A;  2XEG A;  1IID A;  1CX8 A;  1Y0R A;  3HLP A;  2DEA A;  2PJ8 A;  4C7I A;  2BCO A;  3JVN A;  4ZY2 A;  1Y9K A;  3PZJ A;  3EY5 A;  2C27 A;  3SJX A;  4NGN A;  1F2O A;  2Q4Y A;  3BHX A;  1QMU A;  3CXP A;  4CYN A;  2ODF A;  3UY5 A;  4MMO A;  4FWU A;  4B13 A;  3WT4 A;  1GYT A;  3PFO A;  2WPX A;  1NSA A;  3IEH A;  4PXB A;  1S7N A;  4MXU A;  1S3Z A;  4Y49 C;  4UIA A;  4BBH A;  1S7F A;  4CAE A;  4NGR A;  4MI4 A;  4X5K A;  1I21 A;  1Q2Y A;  3PGP A;  1PU9 A;  8CPA A;  2HC9 A;  3D68 A;  3OWC A;  3FBU A;  3H4Q A;  4KSA A;  3LD2 A;  1TKJ A;  5AG7 A;  4LQG A;  4DYO A;  4PXE A;  3KZW A;  4KOX A;  1M4L A;  3N5F A;  1M1D A;  4HPS A;  2B3V A;  2PR1 A;  4H6U A;  3N7Z A;  1TF9 A;  3FRM A;  2PJC A;  1Z4R A;  1Y7R A;  4A94 A;  2AFS A;  1CPS A;  1PCA A;  4ZX9 A;  2Z3P A;  3B2Y A;  3SI1 A;  2POK A;  4U5Y A;  5LRG A;  1Z9U A;  3VH9 A;  3GYA A;  2Z3K A;  3RYO A;  1LCP A;  1M4I A;  3IIB A;  2OB0 A;  3DGV A;  4B11 A;  2AFO A;  4PXD A;  3R95 A;  1B87 A;  2ATR A;  2PCU A;  4R6T A;  1IYL A;  2FS5 A;  3B3W A;  1KWM A;  3LAC A;  4B5O A;  2DPS A;  2Q4V A;  1P0H A;  1VHE A;  4ZX8 A;  2YNE A;  4B5P B;  3SXN A;  4P45 A;  3FF3 A;  3RBU A;  3IO1 A;  2R98 A;  1XF8 A;  4UEF A;  1AMP A;  4KVM E;  3DDD A;  1H8L A;  2D4O A;  2C1C A;  1V0C A;  2BUE A;  4AVA A;  4MRI A;  3S6H A;  4KOR A;  5DS0 A;  2PJ2 A;  4O23 A;  4NJR A;  3DR8 A;  5IV0 A;  3K2K A;  4MFZ A;  1R57 A;  4UFX A;  2JEV A;  2WUU A;  4NEX A;  1CP6 A;  1QQ9 A;  5IX3 A;  4A33 A;  3P2H A;  1YK3 A;  3BI1 A;  5CBM A;  4FD5 A;  2ZED A;  1X10 A;  1BAV A;  2QIR A;  5CPA A;  5H84 A;  5AGE A;  2CXA A;  3H5Z A;  4YGO A;  1XOV A;  1F57 A;  1S7K A;  4I49 A;  4P4I A;  4XNH B;  4OIW A;  4CYQ A;  4OC5 A;  3KAS A;  2IMO A;  2ZPA A;  4MHY A;  4QUS A;  3JUW A;  3FB3 A;  1XFO A;  2O53 A;  4XPD B;  2C6P A;  2EO8 A;  3B3S A;  4JYW A;  3IGR A;  4IAV A;  3EXN A;  1IU8 A;  3B3T A;  2PJB A;  3IWE A;  5CNP A;  4Q7A A;  4PXC A;  3SJF A;  4FAI A;  4MHP A;  2X7B A;  5IB9 A;  3ZJ0 A;  2V8D A;  3S9M A;  2FSR A;  4MFK A;  3FIX A;  1WK4 A;  3NH8 A;  3EFA A;  4UCP A;  1M4D A;  4UF4 A;  1U6M A;  2J9A A;  2EK8 A;  1IB1 E;  4PSW A;  3KGQ A;  2B4B A;  4A38 A;  2AFW A;  3VWD A;  2CNM A;  4YU9 A;  3B3V A;  4IUS A;  4A30 A;  1KZF A;  4QVT A;  2WPW A;  4NFR A;  2GE3 A;  4NGT A;  3DNS A;  4FD6 A;  2F8H A;  5JH9 A;  3CZX A;  4OC3 A;  1CBX A;  4R9M A;  2FVG A;  4MFL A;  4MCP A;  5ISV A;  3ISZ A;  5J8C A;  4BD9 A;  4NGQ A;  1A2Z A;  5F48 A;  1Q7L A;  4QB9 A;  1DE4 C;  1BOB A;  4ZY0 A;  1ELM P;  4M6H A;  4R3L A;  5EC4 A;  3TO9 A;  5KTC A;  2ABZ A;  3R9E A;  1TF8 A;  3S6K A;  1XMB A;  1XEB A;  3FXT A;  4HNY B;  5J1Q A;  5LYD A;  3LWU A;  2REE A;  2A4N A;  2BO9 A;  3FMC A;  2GAN A;  4JXR A;  2PJ5 A;  4K30 A;  4KOU A;  4R8F A;  4A32 A;  1MJA A;  2AFX A;  1KUY A;  2O28 A;  5EBV A;  4EWT A;  1UWY A;  1N71 A;  2PE3 A;  1ZG9 A;  4A39 A;  5JGF A;  4RS2 A;  4E8O A;  3K9T A;  2YNC A;  1CG2 A;  2Q51 A;  2FCK A;  4KZT A;  5G22 A;  2PRQ A;  3PB6 X;  3TO6 A;  5HVG A;  2XEI A;  2CNT A;  1FY7 A;  1ZG8 A;  4Z65 A;  4IF5 A;  4MFJ A;  3QNV A;  4U9Z A;  4R76 A;  2HV2 A;  2PVW A;  3F8K A;  3BXM A;  4HNW B;  4CGN A;  4JJX A;  5DWM A;  3SXO A;  2XEF A;  4P10 A;  2ZOF A;  4P4E A;  2GFQ A;  3VAR A;  1IY7 A;  3MRU A;  5GCN A;  2B5G A;  2HQY A;  2EWB A;  2AFM A;  3D8P A;  4Q38 A;  1JQG A;  4CRZ B;  1R3N A;  2PJ7 A;  6CPA A;  4B10 A;  5K8P A;  4OAD A;  2V77 A;  2PIY A;  3EO4 A;  1Z5R A;  2G3A A;  3BI0 A;  2ZXV A;  2Z3O A;  3GKR A;  3SI0 A;  4LUA A;  3S9L A;  4RUH A;  3KR4 A;  4CGP A;  2AFU A;  4OC4 A;  2V8V A;  4MFP A;  4CS0 B;  1PYT B;  2AJ6 A;  4OC2 A;  5ELY A;  1OZP A;  4KOS A;  3W6X A;  4JLY A;  5D29 A;  1XE4 A;  3PEI A;  4CAF A;  4CYO A;  3FX6 A;  2K5T A;  1CP7 A;  2ZW5 A;  1S60 A;  4CGM A;  5C82 A;  1YVK A;  2FIW A;  3V8I A;  3BJ8 A;  1ELL P;  2CY2 A;  3TTH A;  3NFZ A;  3WC6 A;  4FD7 A;  1I1D A;  2WYR A;  1ZLH A;  5G1Z A;  2OOT A;  2P0W A;  1HDU A;  2Q43 A;  3PRT A;  4OP4 A;  4OLL A;  3D2P A;  4MHD A;  4CAX A;  1Y0Y A;  2G9D A;  3D7G A;  4II9 A;  3IU1 A;  1P4N A;  2OZG A;  4HNX B;  1KUX A;  4NGS A;  1Z8W A;  4UFW A;  1YME A;  1I12 A;  1BPM A; 
#chains in the Genus database with same CATH homology
 1Z8X A;  1A2Z A;  4HPS A;  3LAC A;  1IOF A;  1X10 A;  4GXH A;  2DF5 A;  2EO8 A;  3GIU A;  1IOI A;  1AUG A;  1Z8T A;  1X12 A;  3RO0 A;  1Z8W A;  1IU8 A;  2EBJ A;  3RNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...