1IOUA

Solution structure of ykt6p (1-140)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
140
structure length
140
Chain Sequence
MRIYYIGVFRSGGEKALELSEVKDLSQFGFFERSSVGQFMTFFAETVASRTGAGERQSIEEGNYIGHVYARSEGICGVLITDKQYPVRPAYTLLNKILDEYLVAHPKEEWADVTETNDALKMKQLDTYISKYQDPSQADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An autoinhibitory mechanism for nonsyntaxin SNARE proteins revealed by the structure of Ykt6p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
molecule keywords YKT6P
total genus 28
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2001-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1iouA00
2NUTC 4AFIA 3EGXC 3EGDC 2VX8A 3KYQA 1IFQA 2DMWA 2NUPC 4B93A 1IOUA 3BW6A 1H8MA
chains in the Genus database with same CATH superfamily
1MWSA 3CJMA 3MJQA 4CLCC 3T50A 4EESA 2Q0OA 3U2AA 3ZQ5A 1L0DA 3N8RA 4JLFA 3IX8A 1CEFA 3S7NA 2A2LA 3UPOA 3PBTA 2OAQ1 1FCOA 4DE0A 2V1AA 5HW3A 4BLMA 2W27A 2ZMAA 5F68A 4IBRA 1EROA 1JWVA 1Q2QA 5DJTA 3LY4A 3H82A 3MZEA 2OWHA 5DTTA 4EBPA 1GA9A 3NDEA 1OTEA 4G3WA 3P09A 3ITBA 1K56A 4KZ7A 3KX0X 4HESA 2GJ3A 1KVMA 3LIAA 4K0XA 3PAEA 4GDBA 2W3HA 1WYCA 4R0QA 5HZHA 3RTYA 1L0EA 3MXQA 1XFQA 4N9KA 2A24A 4Z1WA 3WS5A 4E3JA 1E25A 1VQQA 4BJPA 1N9OA 1L2SA 2WUQA 3IF6C 4MLLA 4OQ0A 2J3TC 3WS2A 1W8YA 1WYBA 2M1CA 1UWPX 3IX4A 2L0WA 2WKPA 5FL3A 1I2SA 5DKKA 3F1NB 3G32A 3IXGA 4RX2A 2EX2A 4MN7A 4X69A 2HDQA 1CI8A 3UNWA 2PHYA 5CGXA 2ZQ8A 3G30A 3Q81A 4S2LA 4II7A 4UA6A 4LLOB 3AGFA 2X02A 2QPNA 1W79A 3EQVA 5EVIC 3ITAA 1SZVA 3WS4A 5DFYA 3CI6A 4QJGA 4LV0A 2JBFA 2DMWA 3PBSA 2Y2KA 4ETXA 4DKIA 1XJ6A 4PPRA 4QY6A 4QWOA 1ES5A 3HLEA 3BLMA 5JYPA 4HJ4A 1UWNX 3BWLA 1F2KA 1PNEA 3A3IA 3T4JA 5AQBA 4EQ1A 3PAGA 3SH9A 1BZAA 4IEDA 5CTNA 3MFXA 3UB6A 2Z6CA 3D72A 4WMCA 1STZA 1NWZA 4N9LA 3MMHA 1HVBA 3IXDA 3GQZA 4Q8IA 4DJ3A 3A3DA 4X53A 1YLYA 3NCKA 1ESUA 4GZBA 1KDSA 3R7WB 3IXHA 4IUHA 3QHYA 4P6ZS 3T1SA 1JNUA 1NZOA 2UV0E 3SS5A 3NI9A 3LCEA 3T1XA 2WGWB 3UE0A 3ULFA 5F5YA 2EA9A 1JTGA 5CX7A 2Y55A 4RQ9A 2EX6A 2W1TB 4P85A 3DW0A 2B18A 4RYEA 4R38A 4I5SA 3B3XA 5GHYA 3E98A 3Q7VB 4NXFA 3OPHA 4BL3A 4HP9A 4QD4A 2Z6DA 3P7NA 1SHVA 5J8XA 4WZ5A 3IBJA 1KGFA 3DTIA 3NY4A 3A3FA 2E8IA 4WBGA 3JVVA 3NOPC 4ZJ1A 1TDLA 4FH4A 3UE3A 2PYRA 3ZG5A 1JTDA 1KE0A 3N8LA 4DMZA 4S2KA 4U0TA 1FCNA 2XK1A 4KZ8A 2DCFA 4OKPA 2UWXA 1K57C 2H0YA 4Y0OA 4GNUA 3BQ8A 2PR6A 2EX8A 3K3CA 2XFTA 3ICYA 3A3EA 3FPVA 2CMNA 4E3MA 2QWSA 2W0NA 1NXYA 3KSGA 4I3JA 3NBLA 3DTEA 4ZRRA 1MZUA 2J7VA 2IA2A 4CLCB 3FKVA 2OAP1 1DRMA 4GS9A 4WYYA 3VOZA 3A0RA 2WKIA 4GKUA 4YNRA 5F6AA 1XXMA 3ZG8B 2V9AA 3IXBA 2O0YA 3FPWA 3V39A 2ZLYA 1NLZA 3LEQA 4Y15A 1ALQA 3HUMA 1GSXA 5M1AA 4DXCA 4NXGA 3CG5A 3JYIA 3N7WA 1OT9A 2KOIA 2VX8A 2ZOIA 1MWUA 2WGWA 4EEUA 4NEED 4R3JA 5A8BA 3MXRA 2D02A 2QJ7A 2JC7A 2Y4AA 3R7WA 2V8CA 3Q82A 2Y2HA 4GN2A 4U0XA 2CC1A 4YINA 3CMZA 4HQAA 3UE6A 2R78A 4S2JA 5TR7A 2WGIA 2J3TD 4UHUA 3IS2B 4WEJA 2GZAA 3SOIA 1XFNA 1KE3A 4CQHA 5EM0A 4R4RA 1N9BA 3G31A 3IH8A 4KZ3A 3BFCA 3C38A 3H7WA 4X56A 4HI4A 5J7EA 5U47A 4HJ3A 3CZDA 5AQ9A 4FUWA 2QJ5A 5TBMB 2HJEA 4OH0A 3BECA 1FQGA 1T18A 2Y2IA 2K7SA 3VFHA 2H0TA 2PR5A 4CJNA 4ARZA 1DP6A 4O8GA 3C2WA 3CWFA 3T4SA 4L9FA 2QYBA 2DRWA 1M6KA 2HPBA 1PIOA 4R3AA 3HLCA 1KVLA 3F1NA 3IH9A 4YOFA 3UB7A 5F82A 2H10A 2HDUA 1YMXA 2J9OA 4LV1A 2R9XA 3MQ0A 2VZWA 1ONHA 5D3OA 4BL2A 3HLBA 2ZMVA 1TS8A 4JBFA 1OJ5A 3QNBA 2XR0A 3C4PA 2HP9A 4LGWA 4M3KA 3PYPA 3NIAA 3TJZC 1D1JA 4IHQA 2C6WB 1XX2A 4GD8A 4GOGA 4I39A 1RGYA 2JN7A 3D3OA 4NKPA 4OLDA 1K6SA 4WMCD 1P9RA 2O9CA 3E4PA 3L9KA 2VGLS 4FD8A 5FAPA 4LRYC 4M4XA 3MQQA 4NXEA 1PW1A 5EFWA 1NYYA 2VEAA 4X25A 3MXSA 2E8JA 5JYOA 1JVJA 5FQQA 5I5LA 3I7JA 2XA7S 3CPTB 3TG9A 4N1HA 3O5YA 1BTLA 3HL9A 5FAOA 3W4QA 2VJWA 2IWCA 2V2FF 4I3AA 1G6OA 5FA7A 2HDRA 2XH9A 2PU2A 2OOLA 1MKIA 1YPRA 4R4SA 4X55A 1MY8A 1KGEA 4JGQA 2PBYA 3NDGA 2J3WA 1H8MA 2OWJA 1ONGA 1C3BA 2ZC7A 4JXGA 3PBQA 1K57A 1CJFA 4Z9QA 3PHYA 3K3DA 5FI7A 1PRQA 3UB5P 3W2ZA 1H8ZA 4NETA 4NXBA 4UEYA 4JGOA 2FFFB 3LIFA 1K56D 5TJJA 5J4EA 3MSHA 5EVIA 4O0PA 1TDGA 2KDKA 5TFQA 2HDSA 4KENB 4L9GA 4Y0TA 1T1AA 4EWFA 4OVDA 3KSFA 3BYDA 3AGDA 3OLOA 3WRZA 3NOTC 4K91A 2AVXA 4B88A 4EBNA 1BYWA 1SKOB 2OLUA 3LFVA 2OLVA 3GR2A 1N4OA 3W4OA 4L9EA 5GLBA 5CGSA 5AJGA 1BULA 2ZQCA 2ZQ9A 4HHDA 5HFOA 2B02A 1GA0A 3G2ZA 3PBRA 1U60A 2M7VA 1VETB 3PBNA 2P08A 4FSFA 5E2FA 4MBHA 2G2WA 3M2JA 3H9WA 3SW1A 2K2NA 3IHBA 3IF6B 5TGFA 5FQIA 1VB6A 3HCYA 2EXAA 3IQAA 1G5UA 5CXWA 1ZC2A 3QP1A 3Q07A 3EEAA 2Y2PA 1PZOA 4S2PA 3VP3A 2VV6A 3WS0A 1Y28A 5DTKA 4YWZA 1CF0A 1MWRA 1CI9A 3T12B 1N9LA 3UDFA 1NRFA 4F3LB 2Y59A 1L3LA 2HP5A 4GD6A 1QMFA 3ZVTA 3KSHA 2P04A 4X6TA 1NJ4A 1LSWA 3UB8A 3RXWA 3E4QA 3VSKA 2EFUA 2WK0A 1IKGA 1T1CA 1IYSA 3TE8A 1BLPA 3BEBA 2A3UA 2HV1A 2ZC6B 4XT2A 5HDCA 1MKMA 4WF0A 5HL6A 3UDIA 2B95A 2P9VB 2XF3A 5FQJA 3O86A 2PBDP 4R3BA 3FC7A 1I5QA 1XJ4A 1GHPA 5FDSA 1CK3A 1NZUA 1IYPA 2GX5A 4WEKA 4R70A 4G3KA 3BFEA 5HARA 2GNXA 3IWOA 5HWVA 1VEUA 2H5SA 5DF7A 1SCWA 1DP8A 1A0KA 3BFDA 1XPBA 1ZHHB 2V8FA 1K0KA 4LV2A 2HJ9C 3LY3A 1O07A 3PBOA 2K31A 1S4RA 3ZNTA 5IS1A 1QMEA 4E6XA 1IFQA 4HBTA 3BW6A 3A0SA 2EWWA 4ME4A 3SZTA 3E4OA 2QKPA 4LCMA 4KUOA 3UMEA 1VM1A 2Y2GA 3HLWA 3H7WB 3IF5A 2Q9MA 3BFFA 1S66L 3KYZA 3TOIA 3V67A 4HOIA 1TS0A 1E3UA 3PR6A 5FSRA 4HNBA 4Y5FA 3PXPA 1LT0A 1BSGA 3BJNA 5EOEA 4R1GA 5DKLA 2Y2LA 3WRTA 3OBFA 3UN7A 3JVUA 4CPKA 1HD8A 3B33A 4Y2FA 2XFSA 4R6LA 4IUKA 1YSPA 2LB9A 2PD8A 3HLDA 4HH2A 4MN5A 1Y4OA 3GRJA 2VV7A 4OPQA 1DJAA 3BY8A 4B9OA 2ACGA 2EWVA 3W8KA 4BBVA 5L09A 4P87A 5DJUA 3S4XA 3VSLA 5F69A 4B4XA 5HL1A 5C5KA 2HF6A 4EUVA 5FI2A 3N4IA 3MR0A 4P6ZM 4Q0JA 5EV0A 4JF6A 4KZ4A 4JF4A 4ZJ2A 4H6JB 1F98A 1J9MA 4KUKA 5EVLA 3HBRA 5HSQA 4OLGA 5FQKA 4E3NA 1L0FA 1LL5A 2OSUA 1IOUA 2WAEA 3QP4A 3GVBA 4QHCA 1MC0A 4YFMA 3P01A 2ZD8A 1PI5A 3LR0A 3V3SA 4MDZA 3C8CA 3CUEC 1HTZA 2ZQAA 1TS6A 5AQ7A 1TF1A 3KYQA 3DWKA 4HBUA 3VV4A 2IWBA 3LYXA 3LI8A 2W3EA 4DE2A 2V1ZA 3RXXA 4LV3A 1T19A 1KE4A 3T4OA 2VLGA 4GW9A 3ZVWA 1H8YA 5HDDA 3OOVA 2L1MA 5FEGA 3GECA 3GTCA 4JXSA 3CITA 4IVIA 3BFGA 4I3IA 3F1PB 1RGZA 1HLUP 2JKFA 2ZOHA 4E04A 2XLNA 1Z6FA 4HJ6A 5DF8A 5CERA 2Z2LB 1YT4A 1OTBA 3BLSA 2EX9A 4O7DA 1CEGA 3RH8B 4P0MA 3Q7VA 3BQAA 3MBZA 4EUZA 3RJUA 1S1ZA 4OOMA 2HZ5A 3A0VA 2W1TA 3KO6A 3MS6A 3NC8A 2XSSA 1EI5A 2JHEA 3UPNA 4HY8A 4I38A 3LIDA 1YSQA 3F1OA 4KQDA 1DP9A 3VP2A 5L10A 4PKYG 1OMEA 2JKTI 5E2EA 2I9VA 2ZM8A 1XJ2A 3M6BA 3CHWP 3O87A 4MBFA 1G28A 5F1GA 1P0ZA 3UB9A 3QP6A 2PYPA 2G2UA 2PU4A 4UQIM 4WZ5C 2GDNA 3VE4A 4N1XA 3ZG0A 2X71A 2V1BA 3G34A 4S2OA 5HAPA 2VGLM 3S7OA 3MZDA 4G3VA 1MXOA 4WM9A 5EUAA 3B47A 3IT9A 3QP8A 5EE8A 3C7VA 5CHMA 5J3WA 2HP6A 2XGNA 4FH2A 1PZPA 5HD3A 1K55A 1DJCA 4PKYA 5FDHA 3V5MA 1YAXA 2BLSA 3N8SA 5GHZA 2H28A 1K25A 3IX3A 2V0WA 1X0OA 4Y13A 1W63Q 5HWWA 4JXVA 4Y7PA 3G4PA 1BLSA 1DJBA 3MQOA 3BM6A 5DF9A 1T1BA 5I94A 4GCZA 4X68A 3IWQA 4UA9A 3N6IA 3VOLA 5F1FA 3DWZA 3KYEA 5M19A 2O9BA 3SH8A 4DJ2A 3UDXA 1FSWA 1LI0A 4BQMA 1Q2PA 3EQUA 4RX3A 4DDSA 4DXBA 1TS7A 1FILA 3MKFA 4LENA 1FSYA 3LICA 1BT5A 2Y2NA 1CQAA 4CLCD 4C6YA 5L8MA 4XUZA 1LSVA 3MFDA 1K6RA 1F5MA 1V9YA 1W5DA 4AFIA 4WELA 1NY0A 3EGDC 1E4DA 4KZ5A 4MMNA 2OV5A 1G68A 4LPZA 2FH5A 4S2NA 5CHUA 1V9ZA 2J80A 2QMIA 2YKHA 4KZ6A 3ZFZA 4E3IA 3SS3A 2XQZA 1PW8A 3VFFA 1ZKJA 3NOUC 3C4OA 3T4LA 3F1OB 1SKFA 5F83A 2IWDA 3H82B 4GDNA 4E3KA 5KZHA 4OONA 4IBXA 3IHAA 4O01A 1GHMA 3Q7ZA 2ZBBA 4EU0A 3GDIA 3U4LP 4RVAA 1HZOA 2WKEA 5K5BA 5FQMA 4D2OA 3LR4A 3D4FA 1P97A 4BENA 4Y0UA 4BMWA 3HLGA 3LIEA 3HLFA 1BLCA 2G7UA 1UGUA 2L4RA 3LUQA 3V3RA 3P98A 4BBUA 1OT6A 4A5RA 4EERA 2I72A 5KMWA 2RL3A 3LGOA 5A90A 4OP8A 2MJ6A 1MPLA 1ERQA 1JWZA 3F1PA 2KX6A 4L0LA 3ZNYA 2A49A 2ZL1B 1WA9A 2XRNA 3B42A 3SS4A 2QHKA 2W3FA 2WKRA 1FR1A 4PM5A 2JKGA 1S67L 1F9IA 3FKWA 2VK3A 3Q1FA 4JXWA 4OOLA 4KQQA 4GLQA 1XKZA 1H3QA 4HEFA 1FIKA 2Y91A 5DTSA 5FATA 2EXBA 4DE3A 4P6BA 2P9VA 5E2HA 2VV8A 5CRFA 2W1RA 3OCNA 4OPRA 2W3GA 4KG5A 1LSXA 3NECA 2WKQA 4E6WA 3QP2A 1PWCA 1IEMA 1S1YA 4EV4A 1ZG6A 3S7PA 2D01A 4HP4A 1FOFA 5HWTA 1ESIA 1GSVA 2BG1A 2Y2QA 1K54C 3VE3A 2ZC4B 2O99A 3L7HA 4DN0A 2O9AA 1EW0A 1L0GA 3CAXA 2QZ6A 4NG2A 2PT7A 4GHIA 1SDEA 3DTMA 1NRJA 2XD5A 5FAQA 4LRXC 5E43A 1OJGA 3DAVA 1MBLA 4D60A 5HPFA 4R23A 4EETB 3RFBA 1JWPA 3JPUA 4JGRA 5KSHA 3DBAA 5IT5A 1XJ3A 4OOYA 1RP5A 5FQ9A 5IHVA 3ZGAB 2JE5A 4Y3IA 3BY9A 2NUPC 4WZ4A 4BBTA 1AWIA 2LB5A 3GMWA 4ZAMA 3T1RA 1LL9A 1GHIA 1ZG4A 4S2NC 4MN6A 4WN5A 1VETA 3OPLA 2JKTM 2FFYA 1IYOA 3T4KA 2W3DA 4QU3A 2C5WB 2XDMA 3VMAA 1PYYA 2ZJ9A 4BD0A 4GHIB 4QB8A 5DVAA 5L07A 2Y79A 1EWZA 5L2FA 4K08A 3ISGA 5EECA 4DF6A 4XUXA 1XGJA 1W7FA 1GCEA 3UY6A 1O7EA 3QNCA 2V0UA 1ERMA 4LCLA 4WUJA 3K2NA 4H8RA 4MEZA 5FASA 2ZC5B 5A92A 5CGWA 3HUNA 1ODVA 2VA0A 4KZ9A 3IBRA 3NHQA 2P7JA 3W4PA 2Q9NA 4IVKA 4KQOA 4U3TA 3OPPA 5M18A 4DE1A 1KDWA 5E2GA 2XD1A 3MKEA 5HD5A 4OQGA 3G2YA 1YLJA 5HPIA 1NYMA 1VEUB 2PDRA 5CEDA 1NLYA 2B5RA 1D7EA 2R9WA 2ZM0A 3CUEA 4KG6A 4E3LA 4EBLA 3ZYTA 1IYQA 4LRZE 3D9YA 1W63M 4C75A 4JPMA 1YMSA 1LLBA 4FCFA 2A24B 3T4QA 4X1LA 2PD7A 4XT2B 1YLWA 3E2KA 1OTAA 4X1MA 4XXRA 1TVFA 3O3VA 4PM6A 3E0YA 1LHYA 2XEPA 1PFLA 4OPYA 4ZDXA 2JCHA 1ES3A 3S7QA 3ZDJA 2WADA 1IKIA 2FZ0A 2WGVA 4QY5A 2WKHA 1W8QA 2JKRM 3FV7A 3M6HA 1OPXA 5EM1A 4S2MA 5CTMA 2WZZA 2ZC3B 1K55C 4PMAA 5G18A 1ES4A 1AXBA 1H0MA 4WL9A 2Y2JA 5IU1A 4EEPA 5CEBA 1D06A 4OPZA 3TW8A 3IF6A 4PM7A 4JGPA 1FCMA 5CECA 1YQSA 3T4TA 1I2WA 4GS9B 5EVID 3O88A 2ZQDA 3EGXC 1PWGA 3KSIA 3LR3A 3OPRA 3HVFA 2Z2MB 5MC7A 3MZFA 1RCJA 5BOHA 3S1YA 4EQIA 5A93A 5HDSA 1YLPA 1Z09A 5GLCA 1MWTA 3HREA 3T1QB 2RCXA 1XA1A 3ZCZA 3UMDA 4ESPA 3AGEA 1N9NA 3BRMA 4N92A 5GL9A 2Y8HA 1BUEA 4B93A 3LEZA 4E3OA 2Y2MA 3FZCA 1P9WA 5TBMA 3TRCA 3G6OA 1SDNA 5AQAA 4PHTA 5GHXA 5EPHA 1S4SA 2XA7M 4KZBA 4WLAA 5AVEA 2V20A 1K38A 4JKTA 2YKFA 1S0WA 2WYXA 5EVIB 3C30A 4B4ZA 1FR6A 3IS2A 3ZG7B 3FWLA 4CLCE 4DRTA 1YKDA 2INWA 1ZTUA 3LI9A 2PRFA 3GSGA 1XP4A 4IJGA 2BTFP 5G4YA 4BD1A 3DTKA 4UQIS 1KOUA 2EFXA 4QPRA 4KG2A 5EOOA 3EEHA 4NK3A 4ZTKA 5CHJA 4BWIA 3NULA 1XA7A 2HGVA 3VP1A 4F3LA 5A91A 1S6RA 4HIAA 4MBKA 4OQHA 3QP5A 4HH3A 1M40A 1ACFA 3C5AA 1KGGA 4C3QA 2M7UA 3V50A 1H5XA 3PTEA 3CPTA 4MCWA 1XGIA 2KLIA 5G4ZA 3UE1A 2ZMFA 4UAAA 4K0WA 2VKSA 4Q0IA 4ETZA 1PI4A 3MF0A 4OP5A 3VP0A 2XROA 3GV9A 1OTDA 3A3JA 3CLOA 2ZQ7A 3M2KA 4Q0HA 4PM8A 1LL8A 5HAQA 5GLAA 4CLCA 3TSGA 1OTIA 4GB7A 2PAVP 3ZG9B 2J8YA 4EXOA 4ZJ3A 2BASA 2JKRI 1PWDA 3E2LA 3LIBA 3OCLA 4RA7A 2P74A 3HJIA 3WS1A 4Y17A 3WWXA 1VHMA 4LFUA 5FEFA 1K4EA 4JF5A 1SKOA 3IWIA 5AVFA 1J3WA 3S22A 1K54A 4ID4A 4DDYA 5EVEA 4PAUA 4UA7A 3VOYA 2Y2OA 5FI6A 3EWKA 1E3UD 4KQRA 3UO9A 2ZM2A 2NUTC 1BLHA 2VGJA 3LR5A 4OQIA 3FYZA 1TEMA 3LO7A 3HJKA 4KZAA 2DNSA 3EOIA 2WZXA 4GJ4A 1ES2A 5HX9A 1LI9A 3OC2A 3FG8A 4F94A 3VP4A 1DY6A 5HAIA 1GSWA 1K4FA 1TD5A 4ARZB 4PM9A 3NJAA 1YM1A 2WAFA 5LBRA 4S2IA 3G35A 2ZL1A 5KIZA 3OZHA 1IELA 3R4KA 4FOFA 5KSCA 4EW7A 2X01A 3ZHHA 4MNRA 3HUOA 1Y54A 1G6AA 4ZBEA 1WE4A 4FTXA 4H6JA 5DFXA 3UPPA 2VGKA 3SH7A 1YLZA 1YLTA 2J9PA 5GLDA 3C7UA
chains in the Genus database with same CATH topology
3F1NA 3MJQA 4YOFA 4MN6A 4CLCC 4WN5A 3T50A 4EESA 3UB7A 1MC0A 3U2AA 3ZQ5A 2JKTM 3P01A 3T4KA 2W3DA 3S7NA 2A2LA 3LR0A 3MQ0A 4MDZA 3C8CA 2VZWA 3PBTA 2OAQ1 3CUEC 4GHIB 2V1AA 1TS6A 2W27A 1TF1A 5F68A 2ZMVA 2Y79A 3KYQA 1TS8A 3VV4A 4K08A 1OJ5A 3LYXA 5DJTA 3LI8A 2W3EA 3H82A 2OWHA 3PYPA 1T19A 3TJZC 4IHQA 1OTEA 4G3WA 2V0UA 3T4OA 3KX0X 2VLGA 4I39A 2GJ3A 3K2NA 4WUJA 2JN7A 4GW9A 3LIAA 3D3OA 2W3HA 4NKPA 5HZHA 5HDDA 3OOVA 2L1MA 3RTYA 3GECA 1P9RA 2O9CA 3E4PA 1XFQA 3CITA 3MXQA 1ODVA 2VA0A 2VGLS 4LRYC 2A24A 3IBRA 4Z1WA 3NHQA 4M4XA 2P7JA 3MQQA 4NXEA 4I3IA 5EFWA 3F1PB 4KQOA 4BJPA 2ZOHA 2VEAA 1N9OA 2J3TC 5I5LA 4E04A 4HJ6A 5HD5A 2M1CA 1UWPX 5HPIA 2XA7S 2L0WA 2WKPA 3O5YA 5FL3A 5DKKA 2PDRA 2VJWA 1OTBA 3F1NB 4I3AA 1G6OA 1NLYA 4MN7A 3RH8B 1D7EA 2OOLA 3CUEA 3BQAA 1S1ZA 4OOMA 2PHYA 4LRZE 3ZYTA 1W63M 3A0VA 4JGQA 2J3WA 2W1TA 3KO6A 1H8MA 4II7A 2XSSA 2A24B 4LLOB 3T4QA 2OWJA 2JHEA 4HY8A 3EQVA 4I38A 3PBQA 2PD7A 3LIDA 1YSQA 3F1OA 4XT2B 4KQDA 1DP9A 5DFYA 3PHYA 1OTAA 3CI6A 3K3DA 4PKYG 2JKTI 2I9VA 2DMWA 3PBSA 3W2ZA 4ETXA 3E0YA 4NXBA 1XJ2A 1XJ6A 4UEYA 4JGOA 3LIFA 1G28A 3S7QA 1P0ZA 3UB9A 5TJJA 5J4EA 2PYPA 2FZ0A 4O0PA 4UQIM 4HJ4A 3VE4A 1UWNX 3BWLA 2KDKA 2JKRM 4L9GA 2V1BA 1OPXA 1T1AA 3T4JA 4EQ1A 3KSFA 3MFXA 2VGLM 3UB6A 2Z6CA 3S7OA 3D72A 4G3VA 1STZA 1NWZA 3B47A 3OLOA 3MMHA 3NOTC 5J3WA 4WL9A 4DJ3A 1BYWA 3LFVA 4L9EA 5HD3A 4PKYA 3R7WB 5IU1A 4IUHA 4EEPA 5AJGA 4P6ZS 1D06A 1JNUA 1YAXA 3TW8A 4HHDA 4JGPA 2B02A 2H28A 3ULFA 3T4TA 4GS9B 3PBRA 2V0WA 1X0OA 5F5YA 2M7VA 1W63Q 3EGXC 3KSIA 5HWWA 3LR3A 3PBNA 2EA9A 2P08A 5CX7A 5MC7A 4FSFA 4RQ9A 2W1TB 3MQOA 5HDSA 3H9WA 3SW1A 5DF9A 2K2NA 1T1BA 2B18A 4GCZA 4R38A 4I5SA 3VOLA 1VB6A 3E98A 3UMDA 4NXFA 3HCYA 2O9BA 4DJ2A 1N9NA 4HP9A 3EEAA 3EQUA 2Y8HA 2Z6DA 4B93A 1TS7A 3P7NA 2VV6A 1P9WA 1Y28A 5TBMA 3IBJA 4YWZA 3TRCA 3G6OA 3LICA 3JVVA 3NOPC 1N9LA 4PHTA 4F3LB 4CLCD 1S4SA 2XA7M 5L8MA 3UE3A 4WLAA 2PYRA 5AVEA 1LSVA 1F5MA 1V9YA 3KSHA 4DMZA 4AFIA 4WELA 2YKFA 3EGDC 4MMNA 2P04A 4LPZA 1LSWA 3UB8A 2FH5A 1V9ZA 3C30A 3E4QA 2J80A 3IS2A 1T1CA 2YKHA 3TE8A 4CLCE 1YKDA 2INWA 1ZTUA 3LI9A 4IJGA 2HV1A 3NOUC 5G4YA 4UQIS 3T4LA 3F1OB 4XT2A 1KOUA 5HDCA 4QPRA 1MKMA 4WF0A 5HL6A 3H82B 3BQ8A 3EEHA 3FC7A 1XJ4A 2PR6A 4O01A 4BWIA 2ZBBA 4EU0A 3K3CA 3ICYA 3GDIA 3FPVA 2CMNA 2QWSA 2W0NA 2GX5A 4WEKA 2HGVA 4F3LA 5K5BA 4R70A 4G3KA 3KSGA 4HIAA 4I3JA 3LR4A 2GNXA 1P97A 4HH3A 4BMWA 4ZRRA 1MZUA 3LIEA 5HWVA 2M7UA 2IA2A 2G7UA 4CLCB 4MCWA 1UGUA 2L4RA 2OAP1 1DP8A 2KLIA 3LUQA 1DRMA 4GS9A 4BBUA 1OT6A 5G4ZA 2ZMFA 3A0RA 4EERA 2VKSA 4Q0IA 4YNRA 4ETZA 3MF0A 2XROA 5F6AA 1ZHHB 2V9AA 2MJ6A 1OTDA 2O0YA 3FPWA 3CLOA 2HJ9C 1NLZA 3PBOA 4Q0HA 2K31A 1LL8A 1S4RA 2KX6A 3F1PA 4L0LA 1GSXA 5IS1A 4CLCA 4NXGA 1OTIA 1IFQA 1WA9A 2XRNA 3B42A 3A0SA 3BW6A 1OT9A 2KOIA 2EWWA 2VX8A 2QHKA 2W3FA 2WKRA 4ME4A 2ZOIA 3E4OA 4EXOA 1S67L 2QKPA 1F9IA 4OOLA 2BASA 4GLQA 4KUOA 2JKRI 4EEUA 4NEED 3UMEA 1H3QA 3LIBA 5A8BA 3OCLA 3HJIA 3H7WB 2D02A 2QJ7A 3R7WA 1S66L 1VHMA 3KYZA 3V67A 4HOIA 1TS0A 3PR6A 2VV8A 2W1RA 4HNBA 3OCNA 5AVFA 4Y5FA 2W3GA 3PXPA 1LT0A 1LSXA 4PAUA 3BJNA 2WKQA 4HQAA 5DKLA 3UE6A 2R78A 1S1YA 3EWKA 3OBFA 3S7PA 2D01A 4HP4A 3JVUA 2J3TD 5HWTA 3B33A 1GSVA 2NUTC 4Y2FA 3IS2B 4R6LA 3LR5A 4IUKA 1YSPA 3VE3A 2LB9A 4WEJA 2O99A 2PD8A 2GZAA 4DN0A 1XFNA 3HJKA 4HH2A 2O9AA 4CQHA 1EW0A 4MN5A 3EOIA 3CAXA 4GJ4A 2VV7A 3BY8A 4B9OA 2PT7A 3C38A 3H7WA 4GHIA 2EWVA 3OC2A 1NRJA 3FG8A 4BBVA 4HI4A 5DJUA 4LRXC 5J7EA 1GSWA 1TD5A 4HJ3A 4ARZB 1OJGA 5F69A 3NJAA 5C5KA 5LBRA 2QJ5A 5HPFA 2HF6A 4EETB 5TBMB 2HJEA 3RFBA 4EUVA 3MR0A 1T18A 4JGRA 4P6ZM 5KIZA 2K7SA 5KSHA 4Q0JA 3DBAA 5IT5A 2PR5A 1XJ3A 3R4KA 4FOFA 4ARZA 4H6JB 1DP6A 4EW7A 4Y3IA 3BY9A 4O8GA 1F98A 5HSQA 4KUKA 3C2WA 2NUPC 4BBTA 3CWFA 3T4SA 2LB5A 4L9FA 4H6JA 2QYBA 5DFXA 1IOUA 4R3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUT C;  4AFI A;  3EGX C;  3EGD C;  2VX8 A;  3KYQ A;  1IFQ A;  2DMW A;  2NUP C;  4B93 A;  1IOU A;  3BW6 A;  1H8M A; 
#chains in the Genus database with same CATH topology
 1MWS A;  3CJM A;  3MJQ A;  4CLC C;  3T50 A;  4EES A;  2Q0O A;  3U2A A;  3ZQ5 A;  1L0D A;  3N8R A;  4JLF A;  3IX8 A;  1CEF A;  3S7N A;  2A2L A;  3UPO A;  3PBT A;  2OAQ 1;  1FCO A;  4DE0 A;  2V1A A;  5HW3 A;  4BLM A;  2W27 A;  2ZMA A;  5F68 A;  4IBR A;  1ERO A;  1JWV A;  1Q2Q A;  5DJT A;  3LY4 A;  3H82 A;  3MZE A;  2OWH A;  5DTT A;  4EBP A;  1GA9 A;  3NDE A;  1OTE A;  4G3W A;  3P09 A;  3ITB A;  1K56 A;  4KZ7 A;  3KX0 X;  4HES A;  2GJ3 A;  1KVM A;  3LIA A;  4K0X A;  3PAE A;  4GDB A;  2W3H A;  1WYC A;  4R0Q A;  5HZH A;  3RTY A;  1L0E A;  3MXQ A;  1XFQ A;  4N9K A;  2A24 A;  4Z1W A;  3WS5 A;  4E3J A;  1E25 A;  1VQQ A;  4BJP A;  1N9O A;  1L2S A;  2WUQ A;  3IF6 C;  4MLL A;  4OQ0 A;  2J3T C;  3WS2 A;  1W8Y A;  1WYB A;  2M1C A;  1UWP X;  3IX4 A;  2L0W A;  2WKP A;  5FL3 A;  1I2S A;  5DKK A;  3F1N B;  3G32 A;  3IXG A;  4RX2 A;  2EX2 A;  4MN7 A;  4X69 A;  2HDQ A;  1CI8 A;  3UNW A;  2PHY A;  5CGX A;  2ZQ8 A;  3G30 A;  3Q81 A;  4S2L A;  4II7 A;  4UA6 A;  4LLO B;  3AGF A;  2X02 A;  2QPN A;  1W79 A;  3EQV A;  5EVI C;  3ITA A;  1SZV A;  3WS4 A;  5DFY A;  3CI6 A;  4QJG A;  4LV0 A;  2JBF A;  2DMW A;  3PBS A;  2Y2K A;  4ETX A;  4DKI A;  1XJ6 A;  4PPR A;  4QY6 A;  4QWO A;  1ES5 A;  3HLE A;  3BLM A;  5JYP A;  4HJ4 A;  1UWN X;  3BWL A;  1F2K A;  1PNE A;  3A3I A;  3T4J A;  5AQB A;  4EQ1 A;  3PAG A;  3SH9 A;  1BZA A;  4IED A;  5CTN A;  3MFX A;  3UB6 A;  2Z6C A;  3D72 A;  4WMC A;  1STZ A;  1NWZ A;  4N9L A;  3MMH A;  1HVB A;  3IXD A;  3GQZ A;  4Q8I A;  4DJ3 A;  3A3D A;  4X53 A;  1YLY A;  3NCK A;  1ESU A;  4GZB A;  1KDS A;  3R7W B;  3IXH A;  4IUH A;  3QHY A;  4P6Z S;  3T1S A;  1JNU A;  1NZO A;  2UV0 E;  3SS5 A;  3NI9 A;  3LCE A;  3T1X A;  2WGW B;  3UE0 A;  3ULF A;  5F5Y A;  2EA9 A;  1JTG A;  5CX7 A;  2Y55 A;  4RQ9 A;  2EX6 A;  2W1T B;  4P85 A;  3DW0 A;  2B18 A;  4RYE A;  4R38 A;  4I5S A;  3B3X A;  5GHY A;  3E98 A;  3Q7V B;  4NXF A;  3OPH A;  4BL3 A;  4HP9 A;  4QD4 A;  2Z6D A;  3P7N A;  1SHV A;  5J8X A;  4WZ5 A;  3IBJ A;  1KGF A;  3DTI A;  3NY4 A;  3A3F A;  2E8I A;  4WBG A;  3JVV A;  3NOP C;  4ZJ1 A;  1TDL A;  4FH4 A;  3UE3 A;  2PYR A;  3ZG5 A;  1JTD A;  1KE0 A;  3N8L A;  4DMZ A;  4S2K A;  4U0T A;  1FCN A;  2XK1 A;  4KZ8 A;  2DCF A;  4OKP A;  2UWX A;  1K57 C;  2H0Y A;  4Y0O A;  4GNU A;  3BQ8 A;  2PR6 A;  2EX8 A;  3K3C A;  2XFT A;  3ICY A;  3A3E A;  3FPV A;  2CMN A;  4E3M A;  2QWS A;  2W0N A;  1NXY A;  3KSG A;  4I3J A;  3NBL A;  3DTE A;  4ZRR A;  1MZU A;  2J7V A;  2IA2 A;  4CLC B;  3FKV A;  2OAP 1;  1DRM A;  4GS9 A;  4WYY A;  3VOZ A;  3A0R A;  2WKI A;  4GKU A;  4YNR A;  5F6A A;  1XXM A;  3ZG8 B;  2V9A A;  3IXB A;  2O0Y A;  3FPW A;  3V39 A;  2ZLY A;  1NLZ A;  3LEQ A;  4Y15 A;  1ALQ A;  3HUM A;  1GSX A;  5M1A A;  4DXC A;  4NXG A;  3CG5 A;  3JYI A;  3N7W A;  1OT9 A;  2KOI A;  2VX8 A;  2ZOI A;  1MWU A;  2WGW A;  4EEU A;  4NEE D;  4R3J A;  5A8B A;  3MXR A;  2D02 A;  2QJ7 A;  2JC7 A;  2Y4A A;  3R7W A;  2V8C A;  3Q82 A;  2Y2H A;  4GN2 A;  4U0X A;  2CC1 A;  4YIN A;  3CMZ A;  4HQA A;  3UE6 A;  2R78 A;  4S2J A;  5TR7 A;  2WGI A;  2J3T D;  4UHU A;  3IS2 B;  4WEJ A;  2GZA A;  3SOI A;  1XFN A;  1KE3 A;  4CQH A;  5EM0 A;  4R4R A;  1N9B A;  3G31 A;  3IH8 A;  4KZ3 A;  3BFC A;  3C38 A;  3H7W A;  4X56 A;  4HI4 A;  5J7E A;  5U47 A;  4HJ3 A;  3CZD A;  5AQ9 A;  4FUW A;  2QJ5 A;  5TBM B;  2HJE A;  4OH0 A;  3BEC A;  1FQG A;  1T18 A;  2Y2I A;  2K7S A;  3VFH A;  2H0T A;  2PR5 A;  4CJN A;  4ARZ A;  1DP6 A;  4O8G A;  3C2W A;  3CWF A;  3T4S A;  4L9F A;  2QYB A;  2DRW A;  1M6K A;  2HPB A;  1PIO A;  4R3A A;  3HLC A;  1KVL A;  3F1N A;  3IH9 A;  4YOF A;  3UB7 A;  5F82 A;  2H10 A;  2HDU A;  1YMX A;  2J9O A;  4LV1 A;  2R9X A;  3MQ0 A;  2VZW A;  1ONH A;  5D3O A;  4BL2 A;  3HLB A;  2ZMV A;  1TS8 A;  4JBF A;  1OJ5 A;  3QNB A;  2XR0 A;  3C4P A;  2HP9 A;  4LGW A;  4M3K A;  3PYP A;  3NIA A;  3TJZ C;  1D1J A;  4IHQ A;  2C6W B;  1XX2 A;  4GD8 A;  4GOG A;  4I39 A;  1RGY A;  2JN7 A;  3D3O A;  4NKP A;  4OLD A;  1K6S A;  4WMC D;  1P9R A;  2O9C A;  3E4P A;  3L9K A;  2VGL S;  4FD8 A;  5FAP A;  4LRY C;  4M4X A;  3MQQ A;  4NXE A;  1PW1 A;  5EFW A;  1NYY A;  2VEA A;  4X25 A;  3MXS A;  2E8J A;  5JYO A;  1JVJ A;  5FQQ A;  5I5L A;  3I7J A;  2XA7 S;  3CPT B;  3TG9 A;  4N1H A;  3O5Y A;  1BTL A;  3HL9 A;  5FAO A;  3W4Q A;  2VJW A;  2IWC A;  2V2F F;  4I3A A;  1G6O A;  5FA7 A;  2HDR A;  2XH9 A;  2PU2 A;  2OOL A;  1MKI A;  1YPR A;  4R4S A;  4X55 A;  1MY8 A;  1KGE A;  4JGQ A;  2PBY A;  3NDG A;  2J3W A;  1H8M A;  2OWJ A;  1ONG A;  1C3B A;  2ZC7 A;  4JXG A;  3PBQ A;  1K57 A;  1CJF A;  4Z9Q A;  3PHY A;  3K3D A;  5FI7 A;  1PRQ A;  3UB5 P;  3W2Z A;  1H8Z A;  4NET A;  4NXB A;  4UEY A;  4JGO A;  2FFF B;  3LIF A;  1K56 D;  5TJJ A;  5J4E A;  3MSH A;  5EVI A;  4O0P A;  1TDG A;  2KDK A;  5TFQ A;  2HDS A;  4KEN B;  4L9G A;  4Y0T A;  1T1A A;  4EWF A;  4OVD A;  3KSF A;  3BYD A;  3AGD A;  3OLO A;  3WRZ A;  3NOT C;  4K91 A;  2AVX A;  4B88 A;  4EBN A;  1BYW A;  1SKO B;  2OLU A;  3LFV A;  2OLV A;  3GR2 A;  1N4O A;  3W4O A;  4L9E A;  5GLB A;  5CGS A;  5AJG A;  1BUL A;  2ZQC A;  2ZQ9 A;  4HHD A;  5HFO A;  2B02 A;  1GA0 A;  3G2Z A;  3PBR A;  1U60 A;  2M7V A;  1VET B;  3PBN A;  2P08 A;  4FSF A;  5E2F A;  4MBH A;  2G2W A;  3M2J A;  3H9W A;  3SW1 A;  2K2N A;  3IHB A;  3IF6 B;  5TGF A;  5FQI A;  1VB6 A;  3HCY A;  2EXA A;  3IQA A;  1G5U A;  5CXW A;  1ZC2 A;  3QP1 A;  3Q07 A;  3EEA A;  2Y2P A;  1PZO A;  4S2P A;  3VP3 A;  2VV6 A;  3WS0 A;  1Y28 A;  5DTK A;  4YWZ A;  1CF0 A;  1MWR A;  1CI9 A;  3T12 B;  1N9L A;  3UDF A;  1NRF A;  4F3L B;  2Y59 A;  1L3L A;  2HP5 A;  4GD6 A;  1QMF A;  3ZVT A;  3KSH A;  2P04 A;  4X6T A;  1NJ4 A;  1LSW A;  3UB8 A;  3RXW A;  3E4Q A;  3VSK A;  2EFU A;  2WK0 A;  1IKG A;  1T1C A;  1IYS A;  3TE8 A;  1BLP A;  3BEB A;  2A3U A;  2HV1 A;  2ZC6 B;  4XT2 A;  5HDC A;  1MKM A;  4WF0 A;  5HL6 A;  3UDI A;  2B95 A;  2P9V B;  2XF3 A;  5FQJ A;  3O86 A;  2PBD P;  4R3B A;  3FC7 A;  1I5Q A;  1XJ4 A;  1GHP A;  5FDS A;  1CK3 A;  1NZU A;  1IYP A;  2GX5 A;  4WEK A;  4R70 A;  4G3K A;  3BFE A;  5HAR A;  2GNX A;  3IWO A;  5HWV A;  1VEU A;  2H5S A;  5DF7 A;  1SCW A;  1DP8 A;  1A0K A;  3BFD A;  1XPB A;  1ZHH B;  2V8F A;  1K0K A;  4LV2 A;  2HJ9 C;  3LY3 A;  1O07 A;  3PBO A;  2K31 A;  1S4R A;  3ZNT A;  5IS1 A;  1QME A;  4E6X A;  1IFQ A;  4HBT A;  3BW6 A;  3A0S A;  2EWW A;  4ME4 A;  3SZT A;  3E4O A;  2QKP A;  4LCM A;  4KUO A;  3UME A;  1VM1 A;  2Y2G A;  3HLW A;  3H7W B;  3IF5 A;  2Q9M A;  3BFF A;  1S66 L;  3KYZ A;  3TOI A;  3V67 A;  4HOI A;  1TS0 A;  1E3U A;  3PR6 A;  5FSR A;  4HNB A;  4Y5F A;  3PXP A;  1LT0 A;  1BSG A;  3BJN A;  5EOE A;  4R1G A;  5DKL A;  2Y2L A;  3WRT A;  3OBF A;  3UN7 A;  3JVU A;  4CPK A;  1HD8 A;  3B33 A;  4Y2F A;  2XFS A;  4R6L A;  4IUK A;  1YSP A;  2LB9 A;  2PD8 A;  3HLD A;  4HH2 A;  4MN5 A;  1Y4O A;  3GRJ A;  2VV7 A;  4OPQ A;  1DJA A;  3BY8 A;  4B9O A;  2ACG A;  2EWV A;  3W8K A;  4BBV A;  5L09 A;  4P87 A;  5DJU A;  3S4X A;  3VSL A;  5F69 A;  4B4X A;  5HL1 A;  5C5K A;  2HF6 A;  4EUV A;  5FI2 A;  3N4I A;  3MR0 A;  4P6Z M;  4Q0J A;  5EV0 A;  4JF6 A;  4KZ4 A;  4JF4 A;  4ZJ2 A;  4H6J B;  1F98 A;  1J9M A;  4KUK A;  5EVL A;  3HBR A;  5HSQ A;  4OLG A;  5FQK A;  4E3N A;  1L0F A;  1LL5 A;  2OSU A;  1IOU A;  2WAE A;  3QP4 A;  3GVB A;  4QHC A;  1MC0 A;  4YFM A;  3P01 A;  2ZD8 A;  1PI5 A;  3LR0 A;  3V3S A;  4MDZ A;  3C8C A;  3CUE C;  1HTZ A;  2ZQA A;  1TS6 A;  5AQ7 A;  1TF1 A;  3KYQ A;  3DWK A;  4HBU A;  3VV4 A;  2IWB A;  3LYX A;  3LI8 A;  2W3E A;  4DE2 A;  2V1Z A;  3RXX A;  4LV3 A;  1T19 A;  1KE4 A;  3T4O A;  2VLG A;  4GW9 A;  3ZVW A;  1H8Y A;  5HDD A;  3OOV A;  2L1M A;  5FEG A;  3GEC A;  3GTC A;  4JXS A;  3CIT A;  4IVI A;  3BFG A;  4I3I A;  3F1P B;  1RGZ A;  1HLU P;  2JKF A;  2ZOH A;  4E04 A;  2XLN A;  1Z6F A;  4HJ6 A;  5DF8 A;  5CER A;  2Z2L B;  1YT4 A;  1OTB A;  3BLS A;  2EX9 A;  4O7D A;  1CEG A;  3RH8 B;  4P0M A;  3Q7V A;  3BQA A;  3MBZ A;  4EUZ A;  3RJU A;  1S1Z A;  4OOM A;  2HZ5 A;  3A0V A;  2W1T A;  3KO6 A;  3MS6 A;  3NC8 A;  2XSS A;  1EI5 A;  2JHE A;  3UPN A;  4HY8 A;  4I38 A;  3LID A;  1YSQ A;  3F1O A;  4KQD A;  1DP9 A;  3VP2 A;  5L10 A;  4PKY G;  1OME A;  2JKT I;  5E2E A;  2I9V A;  2ZM8 A;  1XJ2 A;  3M6B A;  3CHW P;  3O87 A;  4MBF A;  1G28 A;  5F1G A;  1P0Z A;  3UB9 A;  3QP6 A;  2PYP A;  2G2U A;  2PU4 A;  4UQI M;  4WZ5 C;  2GDN A;  3VE4 A;  4N1X A;  3ZG0 A;  2X71 A;  2V1B A;  3G34 A;  4S2O A;  5HAP A;  2VGL M;  3S7O A;  3MZD A;  4G3V A;  1MXO A;  4WM9 A;  5EUA A;  3B47 A;  3IT9 A;  3QP8 A;  5EE8 A;  3C7V A;  5CHM A;  5J3W A;  2HP6 A;  2XGN A;  4FH2 A;  1PZP A;  5HD3 A;  1K55 A;  1DJC A;  4PKY A;  5FDH A;  3V5M A;  1YAX A;  2BLS A;  3N8S A;  5GHZ A;  2H28 A;  1K25 A;  3IX3 A;  2V0W A;  1X0O A;  4Y13 A;  1W63 Q;  5HWW A;  4JXV A;  4Y7P A;  3G4P A;  1BLS A;  1DJB A;  3MQO A;  3BM6 A;  5DF9 A;  1T1B A;  5I94 A;  4GCZ A;  4X68 A;  3IWQ A;  4UA9 A;  3N6I A;  3VOL A;  5F1F A;  3DWZ A;  3KYE A;  5M19 A;  2O9B A;  3SH8 A;  4DJ2 A;  3UDX A;  1FSW A;  1LI0 A;  4BQM A;  1Q2P A;  3EQU A;  4RX3 A;  4DDS A;  4DXB A;  1TS7 A;  1FIL A;  3MKF A;  4LEN A;  1FSY A;  3LIC A;  1BT5 A;  2Y2N A;  1CQA A;  4CLC D;  4C6Y A;  5L8M A;  4XUZ A;  1LSV A;  3MFD A;  1K6R A;  1F5M A;  1V9Y A;  1W5D A;  4AFI A;  4WEL A;  1NY0 A;  3EGD C;  1E4D A;  4KZ5 A;  4MMN A;  2OV5 A;  1G68 A;  4LPZ A;  2FH5 A;  4S2N A;  5CHU A;  1V9Z A;  2J80 A;  2QMI A;  2YKH A;  4KZ6 A;  3ZFZ A;  4E3I A;  3SS3 A;  2XQZ A;  1PW8 A;  3VFF A;  1ZKJ A;  3NOU C;  3C4O A;  3T4L A;  3F1O B;  1SKF A;  5F83 A;  2IWD A;  3H82 B;  4GDN A;  4E3K A;  5KZH A;  4OON A;  4IBX A;  3IHA A;  4O01 A;  1GHM A;  3Q7Z A;  2ZBB A;  4EU0 A;  3GDI A;  3U4L P;  4RVA A;  1HZO A;  2WKE A;  5K5B A;  5FQM A;  4D2O A;  3LR4 A;  3D4F A;  1P97 A;  4BEN A;  4Y0U A;  4BMW A;  3HLG A;  3LIE A;  3HLF A;  1BLC A;  2G7U A;  1UGU A;  2L4R A;  3LUQ A;  3V3R A;  3P98 A;  4BBU A;  1OT6 A;  4A5R A;  4EER A;  2I72 A;  5KMW A;  2RL3 A;  3LGO A;  5A90 A;  4OP8 A;  2MJ6 A;  1MPL A;  1ERQ A;  1JWZ A;  3F1P A;  2KX6 A;  4L0L A;  3ZNY A;  2A49 A;  2ZL1 B;  1WA9 A;  2XRN A;  3B42 A;  3SS4 A;  2QHK A;  2W3F A;  2WKR A;  1FR1 A;  4PM5 A;  2JKG A;  1S67 L;  1F9I A;  3FKW A;  2VK3 A;  3Q1F A;  4JXW A;  4OOL A;  4KQQ A;  4GLQ A;  1XKZ A;  1H3Q A;  4HEF A;  1FIK A;  2Y91 A;  5DTS A;  5FAT A;  2EXB A;  4DE3 A;  4P6B A;  2P9V A;  5E2H A;  2VV8 A;  5CRF A;  2W1R A;  3OCN A;  4OPR A;  2W3G A;  4KG5 A;  1LSX A;  3NEC A;  2WKQ A;  4E6W A;  3QP2 A;  1PWC A;  1IEM A;  1S1Y A;  4EV4 A;  1ZG6 A;  3S7P A;  2D01 A;  4HP4 A;  1FOF A;  5HWT A;  1ESI A;  1GSV A;  2BG1 A;  2Y2Q A;  1K54 C;  3VE3 A;  2ZC4 B;  2O99 A;  3L7H A;  4DN0 A;  2O9A A;  1EW0 A;  1L0G A;  3CAX A;  2QZ6 A;  4NG2 A;  2PT7 A;  4GHI A;  1SDE A;  3DTM A;  1NRJ A;  2XD5 A;  5FAQ A;  4LRX C;  5E43 A;  1OJG A;  3DAV A;  1MBL A;  4D60 A;  5HPF A;  4R23 A;  4EET B;  3RFB A;  1JWP A;  3JPU A;  4JGR A;  5KSH A;  3DBA A;  5IT5 A;  1XJ3 A;  4OOY A;  1RP5 A;  5FQ9 A;  5IHV A;  3ZGA B;  2JE5 A;  4Y3I A;  3BY9 A;  2NUP C;  4WZ4 A;  4BBT A;  1AWI A;  2LB5 A;  3GMW A;  4ZAM A;  3T1R A;  1LL9 A;  1GHI A;  1ZG4 A;  4S2N C;  4MN6 A;  4WN5 A;  1VET A;  3OPL A;  2JKT M;  2FFY A;  1IYO A;  3T4K A;  2W3D A;  4QU3 A;  2C5W B;  2XDM A;  3VMA A;  1PYY A;  2ZJ9 A;  4BD0 A;  4GHI B;  4QB8 A;  5DVA A;  5L07 A;  2Y79 A;  1EWZ A;  5L2F A;  4K08 A;  3ISG A;  5EEC A;  4DF6 A;  4XUX A;  1XGJ A;  1W7F A;  1GCE A;  3UY6 A;  1O7E A;  3QNC A;  2V0U A;  1ERM A;  4LCL A;  4WUJ A;  3K2N A;  4H8R A;  4MEZ A;  5FAS A;  2ZC5 B;  5A92 A;  5CGW A;  3HUN A;  1ODV A;  2VA0 A;  4KZ9 A;  3IBR A;  3NHQ A;  2P7J A;  3W4P A;  2Q9N A;  4IVK A;  4KQO A;  4U3T A;  3OPP A;  5M18 A;  4DE1 A;  1KDW A;  5E2G A;  2XD1 A;  3MKE A;  5HD5 A;  4OQG A;  3G2Y A;  1YLJ A;  5HPI A;  1NYM A;  1VEU B;  2PDR A;  5CED A;  1NLY A;  2B5R A;  1D7E A;  2R9W A;  2ZM0 A;  3CUE A;  4KG6 A;  4E3L A;  4EBL A;  3ZYT A;  1IYQ A;  4LRZ E;  3D9Y A;  1W63 M;  4C75 A;  4JPM A;  1YMS A;  1LLB A;  4FCF A;  2A24 B;  3T4Q A;  4X1L A;  2PD7 A;  4XT2 B;  1YLW A;  3E2K A;  1OTA A;  4X1M A;  4XXR A;  1TVF A;  3O3V A;  4PM6 A;  3E0Y A;  1LHY A;  2XEP A;  1PFL A;  4OPY A;  4ZDX A;  2JCH A;  1ES3 A;  3S7Q A;  3ZDJ A;  2WAD A;  1IKI A;  2FZ0 A;  2WGV A;  4QY5 A;  2WKH A;  1W8Q A;  2JKR M;  3FV7 A;  3M6H A;  1OPX A;  5EM1 A;  4S2M A;  5CTM A;  2WZZ A;  2ZC3 B;  1K55 C;  4PMA A;  5G18 A;  1ES4 A;  1AXB A;  1H0M A;  4WL9 A;  2Y2J A;  5IU1 A;  4EEP A;  5CEB A;  1D06 A;  4OPZ A;  3TW8 A;  3IF6 A;  4PM7 A;  4JGP A;  1FCM A;  5CEC A;  1YQS A;  3T4T A;  1I2W A;  4GS9 B;  5EVI D;  3O88 A;  2ZQD A;  3EGX C;  1PWG A;  3KSI A;  3LR3 A;  3OPR A;  3HVF A;  2Z2M B;  5MC7 A;  3MZF A;  1RCJ A;  5BOH A;  3S1Y A;  4EQI A;  5A93 A;  5HDS A;  1YLP A;  1Z09 A;  5GLC A;  1MWT A;  3HRE A;  3T1Q B;  2RCX A;  1XA1 A;  3ZCZ A;  3UMD A;  4ESP A;  3AGE A;  1N9N A;  3BRM A;  4N92 A;  5GL9 A;  2Y8H A;  1BUE A;  4B93 A;  3LEZ A;  4E3O A;  2Y2M A;  3FZC A;  1P9W A;  5TBM A;  3TRC A;  3G6O A;  1SDN A;  5AQA A;  4PHT A;  5GHX A;  5EPH A;  1S4S A;  2XA7 M;  4KZB A;  4WLA A;  5AVE A;  2V20 A;  1K38 A;  4JKT A;  2YKF A;  1S0W A;  2WYX A;  5EVI B;  3C30 A;  4B4Z A;  1FR6 A;  3IS2 A;  3ZG7 B;  3FWL A;  4CLC E;  4DRT A;  1YKD A;  2INW A;  1ZTU A;  3LI9 A;  2PRF A;  3GSG A;  1XP4 A;  4IJG A;  2BTF P;  5G4Y A;  4BD1 A;  3DTK A;  4UQI S;  1KOU A;  2EFX A;  4QPR A;  4KG2 A;  5EOO A;  3EEH A;  4NK3 A;  4ZTK A;  5CHJ A;  4BWI A;  3NUL A;  1XA7 A;  2HGV A;  3VP1 A;  4F3L A;  5A91 A;  1S6R A;  4HIA A;  4MBK A;  4OQH A;  3QP5 A;  4HH3 A;  1M40 A;  1ACF A;  3C5A A;  1KGG A;  4C3Q A;  2M7U A;  3V50 A;  1H5X A;  3PTE A;  3CPT A;  4MCW A;  1XGI A;  2KLI A;  5G4Z A;  3UE1 A;  2ZMF A;  4UAA A;  4K0W A;  2VKS A;  4Q0I A;  4ETZ A;  1PI4 A;  3MF0 A;  4OP5 A;  3VP0 A;  2XRO A;  3GV9 A;  1OTD A;  3A3J A;  3CLO A;  2ZQ7 A;  3M2K A;  4Q0H A;  4PM8 A;  1LL8 A;  5HAQ A;  5GLA A;  4CLC A;  3TSG A;  1OTI A;  4GB7 A;  2PAV P;  3ZG9 B;  2J8Y A;  4EXO A;  4ZJ3 A;  2BAS A;  2JKR I;  1PWD A;  3E2L A;  3LIB A;  3OCL A;  4RA7 A;  2P74 A;  3HJI A;  3WS1 A;  4Y17 A;  3WWX A;  1VHM A;  4LFU A;  5FEF A;  1K4E A;  4JF5 A;  1SKO A;  3IWI A;  5AVF A;  1J3W A;  3S22 A;  1K54 A;  4ID4 A;  4DDY A;  5EVE A;  4PAU A;  4UA7 A;  3VOY A;  2Y2O A;  5FI6 A;  3EWK A;  1E3U D;  4KQR A;  3UO9 A;  2ZM2 A;  2NUT C;  1BLH A;  2VGJ A;  3LR5 A;  4OQI A;  3FYZ A;  1TEM A;  3LO7 A;  3HJK A;  4KZA A;  2DNS A;  3EOI A;  2WZX A;  4GJ4 A;  1ES2 A;  5HX9 A;  1LI9 A;  3OC2 A;  3FG8 A;  4F94 A;  3VP4 A;  1DY6 A;  5HAI A;  1GSW A;  1K4F A;  1TD5 A;  4ARZ B;  4PM9 A;  3NJA A;  1YM1 A;  2WAF A;  5LBR A;  4S2I A;  3G35 A;  2ZL1 A;  5KIZ A;  3OZH A;  1IEL A;  3R4K A;  4FOF A;  5KSC A;  4EW7 A;  2X01 A;  3ZHH A;  4MNR A;  3HUO A;  1Y54 A;  1G6A A;  4ZBE A;  1WE4 A;  4FTX A;  4H6J A;  5DFX A;  3UPP A;  2VGK A;  3SH7 A;  1YLZ A;  1YLT A;  2J9P A;  5GLD A;  3C7U A; 
#chains in the Genus database with same CATH homology
 3F1N A;  3MJQ A;  4YOF A;  4MN6 A;  4CLC C;  4WN5 A;  3T50 A;  4EES A;  3UB7 A;  1MC0 A;  3U2A A;  3ZQ5 A;  2JKT M;  3P01 A;  3T4K A;  2W3D A;  3S7N A;  2A2L A;  3LR0 A;  3MQ0 A;  4MDZ A;  3C8C A;  2VZW A;  3PBT A;  2OAQ 1;  3CUE C;  4GHI B;  2V1A A;  1TS6 A;  2W27 A;  1TF1 A;  5F68 A;  2ZMV A;  2Y79 A;  3KYQ A;  1TS8 A;  3VV4 A;  4K08 A;  1OJ5 A;  3LYX A;  5DJT A;  3LI8 A;  2W3E A;  3H82 A;  2OWH A;  3PYP A;  1T19 A;  3TJZ C;  4IHQ A;  1OTE A;  4G3W A;  2V0U A;  3T4O A;  3KX0 X;  2VLG A;  4I39 A;  2GJ3 A;  3K2N A;  4WUJ A;  2JN7 A;  4GW9 A;  3LIA A;  3D3O A;  2W3H A;  4NKP A;  5HZH A;  5HDD A;  3OOV A;  2L1M A;  3RTY A;  3GEC A;  1P9R A;  2O9C A;  3E4P A;  1XFQ A;  3CIT A;  3MXQ A;  1ODV A;  2VA0 A;  2VGL S;  4LRY C;  2A24 A;  3IBR A;  4Z1W A;  3NHQ A;  4M4X A;  2P7J A;  3MQQ A;  4NXE A;  4I3I A;  5EFW A;  3F1P B;  4KQO A;  4BJP A;  2ZOH A;  2VEA A;  1N9O A;  2J3T C;  5I5L A;  4E04 A;  4HJ6 A;  5HD5 A;  2M1C A;  1UWP X;  5HPI A;  2XA7 S;  2L0W A;  2WKP A;  3O5Y A;  5FL3 A;  5DKK A;  2PDR A;  2VJW A;  1OTB A;  3F1N B;  4I3A A;  1G6O A;  1NLY A;  4MN7 A;  3RH8 B;  1D7E A;  2OOL A;  3CUE A;  3BQA A;  1S1Z A;  4OOM A;  2PHY A;  4LRZ E;  3ZYT A;  1W63 M;  3A0V A;  4JGQ A;  2J3W A;  2W1T A;  3KO6 A;  1H8M A;  4II7 A;  2XSS A;  2A24 B;  4LLO B;  3T4Q A;  2OWJ A;  2JHE A;  4HY8 A;  3EQV A;  4I38 A;  3PBQ A;  2PD7 A;  3LID A;  1YSQ A;  3F1O A;  4XT2 B;  4KQD A;  1DP9 A;  5DFY A;  3PHY A;  1OTA A;  3CI6 A;  3K3D A;  4PKY G;  2JKT I;  2I9V A;  2DMW A;  3PBS A;  3W2Z A;  4ETX A;  3E0Y A;  4NXB A;  1XJ2 A;  1XJ6 A;  4UEY A;  4JGO A;  3LIF A;  1G28 A;  3S7Q A;  1P0Z A;  3UB9 A;  5TJJ A;  5J4E A;  2PYP A;  2FZ0 A;  4O0P A;  4UQI M;  4HJ4 A;  3VE4 A;  1UWN X;  3BWL A;  2KDK A;  2JKR M;  4L9G A;  2V1B A;  1OPX A;  1T1A A;  3T4J A;  4EQ1 A;  3KSF A;  3MFX A;  2VGL M;  3UB6 A;  2Z6C A;  3S7O A;  3D72 A;  4G3V A;  1STZ A;  1NWZ A;  3B47 A;  3OLO A;  3MMH A;  3NOT C;  5J3W A;  4WL9 A;  4DJ3 A;  1BYW A;  3LFV A;  4L9E A;  5HD3 A;  4PKY A;  3R7W B;  5IU1 A;  4IUH A;  4EEP A;  5AJG A;  4P6Z S;  1D06 A;  1JNU A;  1YAX A;  3TW8 A;  4HHD A;  4JGP A;  2B02 A;  2H28 A;  3ULF A;  3T4T A;  4GS9 B;  3PBR A;  2V0W A;  1X0O A;  5F5Y A;  2M7V A;  1W63 Q;  3EGX C;  3KSI A;  5HWW A;  3LR3 A;  3PBN A;  2EA9 A;  2P08 A;  5CX7 A;  5MC7 A;  4FSF A;  4RQ9 A;  2W1T B;  3MQO A;  5HDS A;  3H9W A;  3SW1 A;  5DF9 A;  2K2N A;  1T1B A;  2B18 A;  4GCZ A;  4R38 A;  4I5S A;  3VOL A;  1VB6 A;  3E98 A;  3UMD A;  4NXF A;  3HCY A;  2O9B A;  4DJ2 A;  1N9N A;  4HP9 A;  3EEA A;  3EQU A;  2Y8H A;  2Z6D A;  4B93 A;  1TS7 A;  3P7N A;  2VV6 A;  1P9W A;  1Y28 A;  5TBM A;  3IBJ A;  4YWZ A;  3TRC A;  3G6O A;  3LIC A;  3JVV A;  3NOP C;  1N9L A;  4PHT A;  4F3L B;  4CLC D;  1S4S A;  2XA7 M;  5L8M A;  3UE3 A;  4WLA A;  2PYR A;  5AVE A;  1LSV A;  1F5M A;  1V9Y A;  3KSH A;  4DMZ A;  4AFI A;  4WEL A;  2YKF A;  3EGD C;  4MMN A;  2P04 A;  4LPZ A;  1LSW A;  3UB8 A;  2FH5 A;  1V9Z A;  3C30 A;  3E4Q A;  2J80 A;  3IS2 A;  1T1C A;  2YKH A;  3TE8 A;  4CLC E;  1YKD A;  2INW A;  1ZTU A;  3LI9 A;  4IJG A;  2HV1 A;  3NOU C;  5G4Y A;  4UQI S;  3T4L A;  3F1O B;  4XT2 A;  1KOU A;  5HDC A;  4QPR A;  1MKM A;  4WF0 A;  5HL6 A;  3H82 B;  3BQ8 A;  3EEH A;  3FC7 A;  1XJ4 A;  2PR6 A;  4O01 A;  4BWI A;  2ZBB A;  4EU0 A;  3K3C A;  3ICY A;  3GDI A;  3FPV A;  2CMN A;  2QWS A;  2W0N A;  2GX5 A;  4WEK A;  2HGV A;  4F3L A;  5K5B A;  4R70 A;  4G3K A;  3KSG A;  4HIA A;  4I3J A;  3LR4 A;  2GNX A;  1P97 A;  4HH3 A;  4BMW A;  4ZRR A;  1MZU A;  3LIE A;  5HWV A;  2M7U A;  2IA2 A;  2G7U A;  4CLC B;  4MCW A;  1UGU A;  2L4R A;  2OAP 1;  1DP8 A;  2KLI A;  3LUQ A;  1DRM A;  4GS9 A;  4BBU A;  1OT6 A;  5G4Z A;  2ZMF A;  3A0R A;  4EER A;  2VKS A;  4Q0I A;  4YNR A;  4ETZ A;  3MF0 A;  2XRO A;  5F6A A;  1ZHH B;  2V9A A;  2MJ6 A;  1OTD A;  2O0Y A;  3FPW A;  3CLO A;  2HJ9 C;  1NLZ A;  3PBO A;  4Q0H A;  2K31 A;  1LL8 A;  1S4R A;  2KX6 A;  3F1P A;  4L0L A;  1GSX A;  5IS1 A;  4CLC A;  4NXG A;  1OTI A;  1IFQ A;  1WA9 A;  2XRN A;  3B42 A;  3A0S A;  3BW6 A;  1OT9 A;  2KOI A;  2EWW A;  2VX8 A;  2QHK A;  2W3F A;  2WKR A;  4ME4 A;  2ZOI A;  3E4O A;  4EXO A;  1S67 L;  2QKP A;  1F9I A;  4OOL A;  2BAS A;  4GLQ A;  4KUO A;  2JKR I;  4EEU A;  4NEE D;  3UME A;  1H3Q A;  3LIB A;  5A8B A;  3OCL A;  3HJI A;  3H7W B;  2D02 A;  2QJ7 A;  3R7W A;  1S66 L;  1VHM A;  3KYZ A;  3V67 A;  4HOI A;  1TS0 A;  3PR6 A;  2VV8 A;  2W1R A;  4HNB A;  3OCN A;  5AVF A;  4Y5F A;  2W3G A;  3PXP A;  1LT0 A;  1LSX A;  4PAU A;  3BJN A;  2WKQ A;  4HQA A;  5DKL A;  3UE6 A;  2R78 A;  1S1Y A;  3EWK A;  3OBF A;  3S7P A;  2D01 A;  4HP4 A;  3JVU A;  2J3T D;  5HWT A;  3B33 A;  1GSV A;  2NUT C;  4Y2F A;  3IS2 B;  4R6L A;  3LR5 A;  4IUK A;  1YSP A;  3VE3 A;  2LB9 A;  4WEJ A;  2O99 A;  2PD8 A;  2GZA A;  4DN0 A;  1XFN A;  3HJK A;  4HH2 A;  2O9A A;  4CQH A;  1EW0 A;  4MN5 A;  3EOI A;  3CAX A;  4GJ4 A;  2VV7 A;  3BY8 A;  4B9O A;  2PT7 A;  3C38 A;  3H7W A;  4GHI A;  2EWV A;  3OC2 A;  1NRJ A;  3FG8 A;  4BBV A;  4HI4 A;  5DJU A;  4LRX C;  5J7E A;  1GSW A;  1TD5 A;  4HJ3 A;  4ARZ B;  1OJG A;  5F69 A;  3NJA A;  5C5K A;  5LBR A;  2QJ5 A;  5HPF A;  2HF6 A;  4EET B;  5TBM B;  2HJE A;  3RFB A;  4EUV A;  3MR0 A;  1T18 A;  4JGR A;  4P6Z M;  5KIZ A;  2K7S A;  5KSH A;  4Q0J A;  3DBA A;  5IT5 A;  2PR5 A;  1XJ3 A;  3R4K A;  4FOF A;  4ARZ A;  4H6J B;  1DP6 A;  4EW7 A;  4Y3I A;  3BY9 A;  4O8G A;  1F98 A;  5HSQ A;  4KUK A;  3C2W A;  2NUP C;  4BBT A;  3CWF A;  3T4S A;  2LB5 A;  4L9F A;  4H6J A;  2QYB A;  5DFX A;  1IOU A;  4R3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...