1IOUA

Solution structure of ykt6p (1-140)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
140
structure length
140
Chain Sequence
MRIYYIGVFRSGGEKALELSEVKDLSQFGFFERSSVGQFMTFFAETVASRTGAGERQSIEEGNYIGHVYARSEGICGVLITDKQYPVRPAYTLLNKILDEYLVAHPKEEWADVTETNDALKMKQLDTYISKYQDPSQADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YKT6P
publication title An autoinhibitory mechanism for nonsyntaxin SNARE proteins revealed by the structure of Ykt6p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 28
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2001-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1iouA00
3BW6A 2NUPC 1H8MA 2VX8A 3EGXC 1IFQA 4AFIA 2DMWA 3KYQA 1IOUA 3EGDC 4B93A 2NUTC
chains in the Genus database with same CATH superfamily
4HJ6A 2BTFP 3E0YA 4FSFA 1OTIA 4P85A 4LV3A 4BJPA 3GTCA 5CTMA 3DTIA 1M6KA 2Y2KA 4II7A 1W8YA 2GZAA 4YWZA 3IWQA 3GDIA 4IVKA 5A91A 4KQOA 4NXGA 3WRZA 2PAVP 1LL5A 2G2WA 3PTEA 4E3MA 2V0WA 4MN5A 1K57C 3LIEA 4EU0A 3QP5A 1GHIA 5HW3A 2MJ6A 1OT9A 1W63M 3LO7A 4HH3A 2D01A 5G4YA 1XKZA 1PZPA 5CGWA 1CI9A 3UPPA 2Q9MA 3G32A 5EE8A 3DWKA 1F9IA 3KSFA 4BBUA 3NC8A 2VK3A 4ZRRA 1SKOB 4EERA 1YLJA 5KIZA 3IBRA 1T18A 3CG5A 3CUEA 4B9OA 3T4OA 5CGSA 3MXSA 4CLCE 4GJ4A 1KOUA 2ZQ9A 3BJNA 3LICA 1NRFA 3HLFA 4X68A 1FCNA 1P9WA 3S22A 4LGWA 4IUKA 3CZDA 1F98A 3WRTA 4GS9B 4NEED 5CECA 3UE6A 3ZDJA 1MWTA 3M2JA 5FQQA 3A3IA 2V2FF 5A90A 3OCNA 3NECA 5C5KA 4PHTA 1IYPA 1V9YA 1EI5A 3KSHA 3UN7A 3ISGA 4D2OA 4NETA 3BLSA 2QJ5A 3BEBA 1E25A 2X02A 5HX9A 1BZAA 3O88A 4K0WA 3SS3A 2P74A 4QD4A 4KZ7A 4HJ4A 1CQAA 1KGEA 2XDMA 2W3EA 4ZJ3A 4OQIA 4JF4A 4K91A 4JXGA 2PBYA 2VA0A 2J9OA 2XF3A 4RQ9A 1L2SA 1XFQA 2L0WA 1NY0A 3ZVWA 1IKIA 4KZ9A 4MLLA 4GOGA 4E3JA 5JYPA 4KZAA 4N9KA 1W5DA 3MMHA 5I94A 3E4OA 1LI0A 3HLDA 3MFDA 4OH0A 4D60A 4XUXA 2FFYA 2KOIA 4HIAA 1TS6A 1OJGA 2WGWB 4Q0JA 3D4FA 1VB6A 4S2IA 3HCYA 3LCEA 1CEFA 2H5SA 3CAXA 5TJJA 5AQ7A 2VEAA 1MKIA 2OWHA 2QYBA 1S66L 1T19A 4DDSA 1NLZA 2XA7S 5GHZA 1SDEA 4WF0A 1O07A 2PYPA 4B88A 1STZA 1T1AA 4UA9A 2G2UA 4OPQA 3A3FA 3Q7ZA 4QHCA 3IQAA 3A0SA 2V8FA 3QP1A 3GRJA 1JNUA 4S2MA 3G30A 3UPNA 1QMFA 5TBMA 4K0XA 4BWIA 1MKMA 1ACFA 3CUEC 2O9AA 2EFUA 3DW0A 3HLWA 3G6OA 3Q7VA 4R3AA 1DP6A 1XJ2A 4GD6A 2K31A 2A24B 2JN7A 4M4XA 2XK1A 3DTKA 4LRXC 4KQDA 3UE3A 2RCXA 5DVAA 5FEFA 3E98A 3PHYA 1YLPA 1GSVA 3EWKA 3N8SA 3IF6A 1WYBA 2IWCA 2QZ6A 3C38A 2WKHA 3UB6A 3NULA 4R0QA 3S1YA 2ZBBA 1HD8A 1H8MA 2IWDA 2BASA 1M40A 3S7QA 3CLOA 5HWVA 1UGUA 3BLMA 4ZAMA 4IUHA 4GDBA 4NG2A 4JGOA 1E4DA 3HL9A 4FH4A 5EVIA 1VETB 4GD8A 3MZEA 1MPLA 4RA7A 3T4SA 2O99A 2PBDP 5IT5A 3MSHA 4UA6A 4XT2B 3FZCA 4B93A 1PWGA 2ZQ7A 3RH8B 2J7VA 4HESA 4OPRA 3U2AA 2EWVA 2QHKA 2VV7A 4RVAA 4GHIB 1XA7A 2M7VA 1MZUA 5FQ9A 3UB7A 3KYEA 4BQMA 2V1BA 4OP5A 5CRFA 1FILA 2M1CA 3LFVA 4X69A 3VSLA 2W27A 2EX9A 4ZJ1A 5HAQA 2WKQA 4N92A 1E3UA 4F94A 4I38A 4GB7A 4HH2A 3DAVA 4PM9A 1MBLA 5LBRA 1K56A 4I5SA 2Z2MB 1I2SA 3IX3A 4S2OA 2Y91A 3F1OB 1Q2QA 4GZBA 1RCJA 1YSQA 1SKFA 5CEBA 4LCLA 3W4PA 3EOIA 3GVBA 1JTGA 4OLDA 4JF6A 3EGXC 4HP9A 3ZNYA 4UEYA 2WYXA 3OCLA 2JKTI 2QKPA 5FI6A 3UE1A 1J3WA 3IF6C 3SH8A 4CQHA 5AQAA 4HBUA 2X01A 1FQGA 1FSYA 1BLSA 3VP3A 2NUTC 1K4EA 4DE0A 2B02A 1K4FA 3PBTA 1IYQA 3IT9A 4QWOA 4LRZE 3VSKA 3VP2A 4R70A 4KENB 2HDSA 4QJGA 2CC1A 2G7UA 4KUKA 5DKLA 3BFCA 2XRNA 2ZD8A 5EVIC 2XR0A 2Y2IA 4QU3A 4R38A 1F2KA 4HY8A 3UB9A 1IEMA 3VOZA 3GQZA 5F82A 3IF5A 1P0ZA 3EEAA 5K5BA 1ES4A 5EV0A 4OPZA 4OP8A 4JKTA 3B33A 2V1AA 4Q8IA 1X0OA 1MWSA 5HDCA 2ZMFA 5I5LA 3T12B 1ONHA 4DDYA 1BLPA 3ZG5A 3IWIA 1N9OA 3A3EA 3IBJA 3MQQA 3O3VA 1PWCA 5EVID 3C4PA 4EQIA 3SH9A 1I2WA 3K3DA 3UO9A 2GJ3A 3F1NB 1EWZA 5HARA 1ONGA 4L9GA 5E2EA 5HWTA 1FIKA 4B4ZA 2Y2QA 3FWLA 2PD8A 3HJKA 4L0LA 3DTMA 1D7EA 3DBAA 1XJ3A 4LCMA 2QMIA 1ERQA 2YKHA 4GN2A 2PR5A 4MDZA 1AWIA 2O9CA 5HAPA 2W3HA 3GV9A 3OLOA 5DF8A 3N6IA 1TF1A 3FPWA 1W7FA 4E04A 1BYWA 2XROA 1CF0A 5M19A 1L0EA 3IXBA 1T1BA 2XSSA 1IYOA 4MN6A 2JKRI 3UDXA 2EA9A 3WS1A 1DJCA 5TGFA 2PU4A 3V39A 2ZC4B 4YFMA 4P87A 3W2ZA 3K3CA 3NOPC 2P9VB 2HP5A 4Q0HA 1JVJA 2V8CA 5CHMA 4IEDA 3CJMA 5E43A 3P7NA 1TD5A 4H6JA 3UMEA 2L4RA 4X25A 1OTBA 3R7WA 4LFUA 4S2NA 3VFFA 3SW1A 1FSWA 4MNRA 2Q0OA 1LSWA 1IYSA 2V9AA 2EX6A 1PW1A 2QWSA 1PI5A 3BYDA 4E3KA 2PHYA 3Q07A 3BWLA 1LL9A 1NLYA 1NZUA 4UQIS 4ESPA 1PWDA 2W3FA 4MEZA 1K6SA 3IX4A 2ZC6B 5IS1A 3JPUA 1VEUB 2NUPC 4OPYA 4P6ZS 2Y2HA 2XEPA 4XXRA 4U0TA 2Q9NA 1ZG4A 3T4QA 3OOVA 1W63Q 2VGLS 3AGDA 2JKTM 3CITA 4HJ3A 4N1HA 3FC7A 1BSGA 1L0GA 3ZQ5A 2KLIA 3V5MA 3LI9A 2ZQ8A 4GW9A 3TOIA 2ZOIA 5AVEA 2UV0E 2WGVA 1GSXA 4EBPA 2C5WB 2ZM8A 1ES2A 3KYQA 4IHQA 4JPMA 1XPBA 3ICYA 5EOEA 2W0NA 5GHXA 1KE4A 1P9RA 1HVBA 1H3QA 3HUOA 4HP4A 3IH9A 1KE3A 1TEMA 2JBFA 5CGXA 2JE5A 1TVFA 1VETA 1MY8A 3ZG7B 4M3KA 5F83A 3TG9A 2J3TC 4KG5A 1K0KA 5FA7A 1PRQA 2PD7A 1G68A 5CEDA 4R3BA 5A8BA 2GDNA 2XD1A 3NDGA 4F3LB 5AQ9A 2Z6DA 2J3WA 5KMWA 4PKYG 4JGRA 1OJ5A 3V3RA 4R23A 3BFEA 2EXBA 4R1GA 3WS2A 1WE4A 3L7HA 4FCFA 4O01A 4FUWA 5CTNA 3G35A 3ZGAB 2VV8A 3VP1A 4S2NC 4EQ1A 2PYRA 4E3IA 3IXGA 2WUQA 1HLUP 4EEUA 3BY9A 4O7DA 2R9WA 5EUAA 4ZDXA 1BUEA 3PBQA 3H82A 1Z09A 2V0UA 3HLEA 4L9EA 5TR7A 1ES3A 1YSPA 5DFYA 2YKFA 1BLHA 3G31A 5GLCA 1K38A 4G3WA 2Y2GA 2WKRA 2EFXA 5KSCA 5EM0A 3BFDA 1FR6A 3EQUA 4E6WA 3NJAA 4WMCA 4BD1A 1YM1A 4OOLA 1GHPA 4XUZA 4IJGA 2ZC7A 5L10A 1MWUA 5GLDA 3O86A 2WK0A 3LIFA 2JKRM 2HZ5A 4LV1A 2W1TA 2QJ7A 3V50A 4CLCA 4WBGA 5HL6A 1CI8A 2H0TA 4UHUA 5FQIA 1JWZA 1LI9A 4DKIA 4R6LA 4LV0A 5DJUA 3H7WB 2Y59A 5DJTA 3U4LP 3PAEA 1Y28A 4OQGA 2HV1A 4GNUA 3A0RA 4KZ5A 3S7PA 1DY6A 4NKPA 3SS4A 1H5XA 1YLTA 4Y5FA 2IWBA 4C3QA 1JTDA 4E3LA 2C6WB 3PBOA 3RXWA 3B47A 2EX8A 4GKUA 1ESUA 2XD5A 3G2ZA 3ZHHA 1CK3A 4EEPA 5EVEA 1SHVA 3MFXA 4QPRA 3HLCA 4ARZA 1YLZA 3G34A 5FAPA 1BULA 3KYZA 3LEQA 1EW0A 4JGPA 3H9WA 1L0DA 3LUQA 2Y8HA 5D3OA 3T4JA 2D02A 3HUNA 4N1XA 1GA9A 3CPTA 5GL9A 3T1RA 5FQKA 3BFGA 3S7OA 1IELA 1ZKJA 3GR2A 4CPKA 2FZ0A 3AGEA 2JC7A 4GLQA 2PU2A 4O0PA 5FSRA 3VE3A 5GLAA 4EW7A 4QY5A 3N8RA 1A0KA 4PMAA 2HJEA 2HJ9C 1PW8A 4QY6A 4CJNA 5HPIA 3UB8A 3D9YA 5F68A 2EWWA 5HL1A 5FDHA 4CLCC 1KDWA 3P01A 3ITAA 1ODVA 3GMWA 3E4PA 2E8IA 3AGFA 2ZL1B 1J9MA 3HREA 5FQMA 3UY6A 1YLWA 2K7SA 4GDNA 1KVMA 3JVVA 2R9XA 3BQ8A 4A5RA 3GECA 1S4RA 3UMDA 4KZ6A 3KSGA 1S1ZA 1S67L 2WKIA 4R4RA 2JKFA 3SOIA 4KG6A 2OOLA 3G4PA 3RJUA 4E3NA 2L1MA 4PM8A 4ETZA 1NXYA 1BTLA 2Y79A 4ZBEA 5TBMB 1RGYA 3P09A 3UNWA 4IBRA 1YT4A 4Y0OA 5EFWA 4R3JA 2Y2MA 4PPRA 4KQQA 4U0XA 1LL8A 1PFLA 3Q7VB 5DTTA 1Y54A 1SKOA 5DFXA 3MQ0A 5E2HA 4NXBA 1IKGA 3ZG8B 2ZQAA 4BBVA 1ZTUA 4K08A 3VV4A 1OT6A 5J8XA 4UQIM 3IXHA 4S2JA 1WA9A 2VLGA 4ZTKA 3NBLA 3NIAA 5CX7A 4O8GA 4DN0A 3E4QA 3VOLA 4GS9A 1D06A 3IX8A 4LRYC 2ZQDA 4JBFA 2ZM0A 4YINA 1LHYA 3D72A 4IVIA 1PI4A 5IHVA 2VGLM 3C7VA 3G2YA 3HLBA 2QPNA 5CHUA 3GSGA 5HD5A 4DF6A 1C3BA 1N9BA 1KE0A 5EVIB 5HPFA 4RX2A 4KQRA 3UDFA 1YMSA 3PBSA 3CHWP 2ZC3B 1K54A 4HQAA 3MR0A 3MZFA 1N9LA 1YKDA 3HVFA 1H8ZA 5J4EA 1FR1A 1JWVA 3W4OA 3ZFZA 3C2WA 3T1XA 3NY4A 3IHAA 3K2NA 1G6OA 3ZG0A 4WM9A 4FOFA 3IH8A 3Q82A 4EESA 4EUVA 4GCZA 3FYZA 1E3UD 3LIBA 3ZVTA 4MCWA 1W8QA 3TSGA 3IHBA 5FEGA 1S6RA 2ZMAA 3M6BA 3LIDA 5EOOA 4JXWA 1K56D 3C7UA 3DWZA 2PT7A 2WGWA 4RX3A 2LB9A 1OTEA 2WADA 3T1QB 3C30A 2O0YA 5DF9A 1WYCA 3MF0A 3V3SA 4HBTA 3ULFA 1LSXA 4JF5A 1OTAA 3HUMA 5HD3A 2WZZA 2X71A 3EQVA 2A3UA 5DTSA 1K25A 1O7EA 3N8LA 2VZWA 4BBTA 2H10A 2HP6A 3SZTA 3KO6A 4OLGA 3L9KA 2JHEA 1GA0A 4KZ3A 3BFFA 3VOYA 1L0FA 2I72A 1AXBA 3F1PB 3KSIA 3SH7A 5FDSA 5HDSA 2W3GA 2PR6A 3MZDA 5M18A 2H0YA 2KDKA 3LR3A 4C75A 2A2LA 4HNBA 3FKVA 5M1AA 1UWNX 5U47A 4DXCA 3CWFA 2GNXA 4OKPA 5L8MA 2J80A 3OZHA 2W3DA 2HDRA 2WZXA 2DMWA 4MBHA 1Z6FA 1SDNA 2A24A 3PYPA 4OQHA 1BT5A 5DTKA 2GX5A 3H7WA 3UB5P 4X53A 5L09A 2ACGA 3HJIA 4MMNA 3TRCA 1K6RA 2XA7M 4ZJ2A 1CEGA 1S1YA 2OAP1 2V1ZA 1U60A 1XGIA 2IA2A 3VP4A 3MXRA 3MKEA 3T50A 3MXQA 1H0MA 5AJGA 1GHMA 3NOUC 2HP9A 1GCEA 1QMEA 1DJBA 2ZOHA 1OPXA 1D1JA 1K54C 5GHYA 4DJ2A 5FI2A 3BRMA 4MBKA 3LR5A 1FOFA 3HBRA 4YNRA 1DP8A 5J3WA 1NWZA 2Y2NA 3VFHA 2VGKA 4WZ5A 4XT2A 1N9NA 3MQOA 3LYXA 1P97A 5HAIA 3DTEA 4HI4A 4GHIA 5EPHA 3LI8A 1HZOA 3LR4A 3C8CA 4G3VA 1OTDA 1TS0A 1TS8A 3NI9A 4X56A 3MJQA 3B3XA 4WELA 1PZOA 4FD8A 3BY8A 4JLFA 2WAFA 1KGFA 1YMXA 2V20A 1MWRA 3BW6A 2ZLYA 5F1GA 4HEFA 2J3TD 3VE4A 3NOTC 3O87A 2INWA 4S2LA 1PYYA 4QB8A 4Y0UA 3W4QA 1IOUA 3JYIA 3QP6A 1ESIA 3T4LA 1RGZA 2HPBA 4KZ8A 3F1OA 4DMZA 2FFFB 2AVXA 1F5MA 3QP8A 1G28A 2J8YA 2HDUA 4HOIA 3UDIA 1XFNA 2ZL1A 1G6AA 4WN5A 1XA1A 3BQAA 2A49A 2WAEA 3OPHA 5KSHA 1YAXA 3B42A 2HF6A 4X55A 3BM6A 3N4IA 4LENA 4EV4A 3HLGA 4AFIA 4BL3A 4E6XA 4WL9A 1PNEA 1PIOA 3IS2B 4H6JB 1TS7A 2P08A 4IBXA 4YOFA 3A3JA 3R7WB 5KZHA 5FI7A 4Y13A 2HDQA 3ZG9B 1Q2PA 2B95A 4NXEA 1RP5A 3FPVA 1XXMA 5AQBA 3S4XA 2CMNA 5MC7A 2W1RA 3OPPA 4LPZA 3VMAA 2BG1A 5EM1A 4WZ5C 2Z2LB 4KG2A 3E2KA 1XJ4A 1N4OA 4DE2A 3BECA 3FG8A 3T4TA 1MC0A 1NYYA 2BLSA 3M2KA 4WLAA 5BOHA 3OPLA 3E2LA 1YPRA 4WEJA 3ZNTA 4JXVA 3QNCA 2K2NA 4P6BA 5G18A 2XFSA 4I3IA 2ZM2A 3MKFA 4BMWA 1YLYA 3RFBA 3TW8A 1SCWA 1BLCA 5TFQA 5A93A 1JWPA 3SS5A 2ZQCA 3OBFA 5J7EA 2WKEA 2VKSA 3PR6A 1HTZA 1H8YA 3RTYA 1XGJA 3F1NA 1ZC2A 1FCOA 1SZVA 2OSUA 3ZCZA 2XQZA 2DCFA 2WKPA 1XJ6A 1TDLA 4BENA 3LR0A 2UWXA 5FAOA 3CMZA 2EXAA 3QP2A 2XFTA 3WS5A 3C4OA 1K55A 2OAQ1 3CI6A 4HHDA 4BLMA 5L2FA 2EX2A 2VV6A 4Y7PA 4P0MA 4MN7A 4OOYA 2Y2LA 1LLBA 1XP4A 1NRJA 1I5QA 2R78A 2JCHA 1T1CA 4EUZA 4BD0A 4UAAA 5EECA 3MS6A 3NDEA 4PM7A 1LSVA 2XLNA 5GLBA 4C6YA 5DF7A 1VQQA 4Y15A 3PBNA 2Y2OA 1L3LA 2P9VA 4MBFA 4JGQA 2Y2JA 4OOMA 4DE1A 4N9LA 3T1SA 3UPOA 3I7JA 4G3KA 1NJ4A 1NYMA 4LLOB 2B5RA 1ES5A 2P7JA 4Z1WA 3EEHA 3Q81A 4WMCD 3H82B 3F1PA 3OPRA 1W79A 3LGOA 3M6HA 4PKYA 4WUJA 3T4KA 1KVLA 4PM5A 4U3TA 1EROA 4LV2A 2Z6CA 2KX6A 3WS4A 3LEZA 4Y3IA 4Z9QA 3KX0X 5G4ZA 2FH5A 4ME4A 1Y4OA 1CJFA 1DP9A 4BL2A 4UA7A 2WGIA 1VEUA 2I9VA 4KUOA 3W8KA 1MXOA 4CLCD 2OWJA 3OC2A 5CHJA 4H8RA 3TJZC 4KZBA 4FH2A 4OQ0A 4S2PA 2RL3A 2HGVA 2JKGA 2ZJ9A 5HFOA 2OLVA 4B4XA 4WEKA 5E2FA 2W1TB 5A92A 5CXWA 3O5YA 2DRWA 3ITBA 4CLCB 5F5YA 5JYOA 3PBRA 4I3JA 4WYYA 2B18A 3R4KA 2OV5A 4DRTA 1FCMA 5HWWA 2M7UA 1K55C 2Y4AA 1DRMA 5L07A 1ERMA 1VM1A 1ALQA 3EGDC 4X1LA 1GSWA 1ZHHB 1LT0A 2ZMVA 3WS0A 5AVFA 3IF6B 4JXSA 3UE0A 4EXOA 4R4SA 2H28A 4NXFA 4ETXA 4I39A 4OONA 4P6ZM 3V67A 4EBNA 5FL3A 1KGGA 3NCKA 5FASA 1UWPX 2DNSA 4ID4A 1V9ZA 1K57A 4F3LA 4Y17A 1G5UA 3NHQA 5F1FA 1S4SA 5FAQA 4Y2FA 1ZG6A 1DJAA 1NZOA 5FQJA 3QNBA 4EBLA 3A0VA 2PRFA 3D3OA 2Y55A 2LB5A 5IU1A 5CERA 4ARZB 3RXXA 3JVUA 5F6AA 3PAGA 4Q0IA 4X6TA 1YQSA 5E2GA 4S2KA 4X1MA 1IFQA 4KZ4A 3N7WA 1KDSA 2VJWA 2E8JA 3ZYTA 2P04A 2OLUA 4WZ4A 3IXDA 2XGNA 3LY3A 2O9BA 2VX8A 5FATA 3MBZA 3CPTB 3LY4A 5F69A 4EWFA 1TDGA 4EETB 2VGJA 4DJ3A 3QHYA 2J9PA 5DKKA 4PAUA 3S7NA 2XH9A 1S0WA 5HZHA 4RYEA 4E3OA 4FTXA 4NK3A 3WWXA 3LIAA 4DE3A 5HDDA 4L9FA 4PM6A 3TE8A 3PXPA 1VHMA 2PDRA 1XX2A 3QP4A 5EVLA 1OMEA 4DXBA 4Y0TA 3C5AA 3P98A 3FV7A 2ZC5B 5HSQA 3A3DA 3FKWA 3Q1FA 3IWOA 3VP0A 4I3AA 3IS2A 4OVDA 2Y2PA
chains in the Genus database with same CATH topology
4HJ6A 1P0ZA 3E0YA 4FSFA 3T4LA 3F1OA 3EEAA 3KYZA 4DMZA 1OTIA 5K5BA 1EW0A 4JGPA 4BJPA 1F5MA 3H9WA 3LUQA 1G28A 2Y8HA 3B33A 2V1AA 1X0OA 4HOIA 4II7A 2ZMFA 5HDCA 5I5LA 4YWZA 2GZAA 3T4JA 3GDIA 2D02A 4KQOA 4NXGA 1XFNA 2V0WA 4WN5A 3BQAA 4MN5A 1N9OA 3S7OA 3LIEA 4EU0A 2FZ0A 3IBJA 3MQQA 4GLQA 5KSHA 2MJ6A 1YAXA 1OT9A 1W63M 3B42A 4HH3A 4O0PA 3K3DA 2HF6A 2GJ3A 3F1NB 3VE3A 4EW7A 4AFIA 2D01A 4WL9A 5G4YA 2HJEA 2HJ9C 4L9GA 3IS2B 4H6JB 1TS7A 2P08A 4YOFA 5HWTA 3R7WB 5HPIA 3UB8A 2PD8A 5F68A 1F9IA 3KSFA 3HJKA 2EWWA 4BBUA 4NXEA 3FPVA 4L0LA 4CLCC 3P01A 1D7EA 4ZRRA 4EERA 3DBAA 1XJ3A 5KIZA 2CMNA 1ODVA 5MC7A 3E4PA 3IBRA 1T18A 2YKHA 2W1RA 3CUEA 4B9OA 2PR5A 4MDZA 3T4OA 4CLCE 2O9CA 4GJ4A 1KOUA 4LPZA 3BJNA 3LICA 2W3HA 3OLOA 2K7SA 1XJ4A 1TF1A 3FPWA 3JVVA 4E04A 1BYWA 1P9WA 2XROA 4IUKA 3FG8A 3T4TA 1MC0A 1F98A 4WLAA 4GS9B 3BQ8A 4NEED 4WEJA 3UE6A 3GECA 1T1BA 2XSSA 2K2NA 4MN6A 1S4RA 2JKRI 3UMDA 2EA9A 4I3IA 4BMWA 3OCNA 3RFBA 3TW8A 3KSGA 1S1ZA 1S67L 5C5KA 4PHTA 1V9YA 3KSHA 3OBFA 5J7EA 3W2ZA 2OOLA 2VKSA 3K3CA 3NOPC 2QJ5A 3PR6A 3RTYA 4Q0HA 3F1NA 2L1MA 4HJ4A 3P7NA 1TD5A 4ETZA 2Y79A 5TBMB 4H6JA 3UMEA 2L4RA 2W3EA 1OTBA 3R7WA 3SW1A 2WKPA 1XJ6A 2VA0A 5EFWA 3LR0A 4RQ9A 1XFQA 2L0WA 1LSWA 1LL8A 2OAQ1 2V9AA 3CI6A 5DFXA 3MQ0A 4HHDA 4NXBA 2QWSA 4BBVA 2VV6A 2PHYA 3MMHA 1ZTUA 3BWLA 4K08A 3VV4A 1NLYA 1OT6A 4MN7A 4UQIS 3E4OA 2W3FA 4UQIM 2KOIA 5IS1A 4HIAA 1TS6A 1WA9A 1OJGA 1NRJA 2VLGA 4Q0JA 2NUPC 4P6ZS 1VB6A 3HCYA 5TJJA 3CAXA 5CX7A 4O8GA 2R78A 4DN0A 1T1CA 2VEAA 2OWHA 2QYBA 3E4QA 3VOLA 3T4QA 4GS9A 3OOVA 1W63Q 1S66L 1D06A 1T19A 4LRYC 1NLZA 2VGLS 2XA7S 3D72A 1LSVA 2JKTM 3CITA 4HJ3A 4WF0A 2VGLM 3FC7A 2PYPA 3ZQ5A 1STZA 2KLIA 1T1AA 3LI9A 5HD5A 4GW9A 3PBNA 2ZOIA 5HPFA 5AVEA 3A0SA 3PBSA 4JGQA 4OOMA 1JNUA 1GSXA 4HQAA 4G3KA 3MR0A 3KYQA 1N9LA 1YKDA 4IHQA 5TBMA 3ICYA 4LLOB 5J4EA 4BWIA 2W0NA 3C2WA 1MKMA 1P9RA 3CUEC 2P7JA 1H3QA 2O9AA 4Z1WA 4HP4A 3K2NA 3EEHA 1G6OA 3H82B 3F1PA 4FOFA 4PKYA 4WUJA 3G6OA 3T4KA 4R3AA 4EESA 4EUVA 4GCZA 1DP6A 2J3TC 1XJ2A 2K31A 3LIBA 2PD7A 2A24B 2JN7A 4MCWA 4M4XA 2Z6CA 2KX6A 4LRXC 4KQDA 4Y3IA 3UE3A 3KX0X 5A8BA 5G4ZA 2FH5A 3LIDA 4ME4A 3E98A 4F3LB 3PHYA 1GSVA 1DP9A 3EWKA 2Z6DA 2J3WA 2PT7A 4PKYG 2I9VA 2LB9A 4KUOA 3C38A 4JGRA 1OJ5A 1OTEA 3UB6A 4CLCD 3C30A 2O0YA 2OWJA 3OC2A 5DF9A 2ZBBA 3MF0A 1H8MA 3ULFA 2BASA 1LSXA 1OTAA 3S7QA 5HD3A 3TJZC 3CLOA 3EQVA 5HWVA 2HGVA 4O01A 4BBTA 2VZWA 1UGUA 4WEKA 4IUHA 2VV8A 2W1TB 4JGOA 3KO6A 3O5YA 2JHEA 4CLCB 5F5YA 4EQ1A 3PBRA 2PYRA 3F1PB 3KSIA 4I3JA 2B18A 3R4KA 5HDSA 2W3GA 2PR6A 5HWWA 4EEUA 2KDKA 3T4SA 2O99A 2M7UA 3LR3A 2A2LA 4HNBA 1DRMA 3BY9A 5IT5A 3EGDC 1GSWA 1UWNX 4XT2B 1ZHHB 4B93A 3CWFA 3RH8B 2GNXA 1LT0A 5L8MA 2ZMVA 3U2AA 5AVFA 2EWVA 2QHKA 3PBQA 2VV7A 2J80A 4GHIB 3H82A 4EXOA 2W3DA 2V0UA 2H28A 4NXFA 4L9EA 4ETXA 2DMWA 2M7VA 4I39A 1YSPA 5DFYA 2YKFA 4P6ZM 3V67A 5FL3A 1MZUA 2A24A 3PYPA 3UB7A 2GX5A 3H7WA 1UWPX 4G3WA 2V1BA 1V9ZA 2WKRA 3HJIA 4MMNA 3TRCA 2XA7M 4F3LA 1S1YA 3NHQA 2M1CA 3EQUA 3LFVA 3NJAA 2OAP1 2W27A 4OOLA 1S4SA 4Y2FA 2IA2A 2WKQA 4IJGA 3T50A 3MXQA 4I38A 5AJGA 3A0VA 3NOUC 3D3OA 3LIFA 2JKRM 2LB5A 4HH2A 5IU1A 5LBRA 4ARZB 2ZOHA 3JVUA 1OPXA 5F6AA 4DJ2A 4Q0IA 4I5SA 2W1TA 3LR5A 2QJ7A 3F1OB 4YNRA 4CLCA 1DP8A 1IFQA 1YSQA 5J3WA 5HL6A 1NWZA 2VJWA 4R6LA 2P04A 3ZYTA 3EOIA 5DJUA 2O9BA 3H7WB 5DJTA 2VX8A 3EGXC 1Y28A 4HP9A 4XT2A 1N9NA 2HV1A 4UEYA 3OCLA 2JKTI 2QKPA 5F69A 3MQOA 3LYXA 1P97A 4HI4A 4GHIA 3A0RA 3LI8A 4EETB 3LR4A 3C8CA 4DJ3A 4G3VA 1OTDA 3S7PA 4CQHA 4NKPA 1TS0A 1TS8A 5DKKA 4PAUA 4Y5FA 3MJQA 3S7NA 2NUTC 2B02A 5HZHA 4WELA 3PBTA 3LIAA 4LRZE 3PBOA 5HDDA 4L9FA 3BY8A 4R70A 3TE8A 3PXPA 2G7UA 1VHMA 3BW6A 3B47A 2PDRA 2J3TD 4KUKA 5DKLA 3VE4A 2XRNA 3NOTC 4EEPA 3MFXA 4R38A 2INWA 4HY8A 5HSQA 3UB9A 4QPRA 4ARZA 1IOUA 4I3AA 3IS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BW6 A;  2NUP C;  1H8M A;  2VX8 A;  3EGX C;  1IFQ A;  4AFI A;  2DMW A;  3KYQ A;  1IOU A;  3EGD C;  4B93 A;  2NUT C; 
#chains in the Genus database with same CATH topology
 4HJ6 A;  2BTF P;  3E0Y A;  4FSF A;  1OTI A;  4P85 A;  4LV3 A;  4BJP A;  3GTC A;  5CTM A;  3DTI A;  1M6K A;  2Y2K A;  4II7 A;  1W8Y A;  2GZA A;  4YWZ A;  3IWQ A;  3GDI A;  4IVK A;  5A91 A;  4KQO A;  4NXG A;  3WRZ A;  2PAV P;  1LL5 A;  2G2W A;  3PTE A;  4E3M A;  2V0W A;  4MN5 A;  1K57 C;  3LIE A;  4EU0 A;  3QP5 A;  1GHI A;  5HW3 A;  2MJ6 A;  1OT9 A;  1W63 M;  3LO7 A;  4HH3 A;  2D01 A;  5G4Y A;  1XKZ A;  1PZP A;  5CGW A;  1CI9 A;  3UPP A;  2Q9M A;  3G32 A;  5EE8 A;  3DWK A;  1F9I A;  3KSF A;  4BBU A;  3NC8 A;  2VK3 A;  4ZRR A;  1SKO B;  4EER A;  1YLJ A;  5KIZ A;  3IBR A;  1T18 A;  3CG5 A;  3CUE A;  4B9O A;  3T4O A;  5CGS A;  3MXS A;  4CLC E;  4GJ4 A;  1KOU A;  2ZQ9 A;  3BJN A;  3LIC A;  1NRF A;  3HLF A;  4X68 A;  1FCN A;  1P9W A;  3S22 A;  4LGW A;  4IUK A;  3CZD A;  1F98 A;  3WRT A;  4GS9 B;  4NEE D;  5CEC A;  3UE6 A;  3ZDJ A;  1MWT A;  3M2J A;  5FQQ A;  3A3I A;  2V2F F;  5A90 A;  3OCN A;  3NEC A;  5C5K A;  4PHT A;  1IYP A;  1V9Y A;  1EI5 A;  3KSH A;  3UN7 A;  3ISG A;  4D2O A;  4NET A;  3BLS A;  2QJ5 A;  3BEB A;  1E25 A;  2X02 A;  5HX9 A;  1BZA A;  3O88 A;  4K0W A;  3SS3 A;  2P74 A;  4QD4 A;  4KZ7 A;  4HJ4 A;  1CQA A;  1KGE A;  2XDM A;  2W3E A;  4ZJ3 A;  4OQI A;  4JF4 A;  4K91 A;  4JXG A;  2PBY A;  2VA0 A;  2J9O A;  2XF3 A;  4RQ9 A;  1L2S A;  1XFQ A;  2L0W A;  1NY0 A;  3ZVW A;  1IKI A;  4KZ9 A;  4MLL A;  4GOG A;  4E3J A;  5JYP A;  4KZA A;  4N9K A;  1W5D A;  3MMH A;  5I94 A;  3E4O A;  1LI0 A;  3HLD A;  3MFD A;  4OH0 A;  4D60 A;  4XUX A;  2FFY A;  2KOI A;  4HIA A;  1TS6 A;  1OJG A;  2WGW B;  4Q0J A;  3D4F A;  1VB6 A;  4S2I A;  3HCY A;  3LCE A;  1CEF A;  2H5S A;  3CAX A;  5TJJ A;  5AQ7 A;  2VEA A;  1MKI A;  2OWH A;  2QYB A;  1S66 L;  1T19 A;  4DDS A;  1NLZ A;  2XA7 S;  5GHZ A;  1SDE A;  4WF0 A;  1O07 A;  2PYP A;  4B88 A;  1STZ A;  1T1A A;  4UA9 A;  2G2U A;  4OPQ A;  3A3F A;  3Q7Z A;  4QHC A;  3IQA A;  3A0S A;  2V8F A;  3QP1 A;  3GRJ A;  1JNU A;  4S2M A;  3G30 A;  3UPN A;  1QMF A;  5TBM A;  4K0X A;  4BWI A;  1MKM A;  1ACF A;  3CUE C;  2O9A A;  2EFU A;  3DW0 A;  3HLW A;  3G6O A;  3Q7V A;  4R3A A;  1DP6 A;  1XJ2 A;  4GD6 A;  2K31 A;  2A24 B;  2JN7 A;  4M4X A;  2XK1 A;  3DTK A;  4LRX C;  4KQD A;  3UE3 A;  2RCX A;  5DVA A;  5FEF A;  3E98 A;  3PHY A;  1YLP A;  1GSV A;  3EWK A;  3N8S A;  3IF6 A;  1WYB A;  2IWC A;  2QZ6 A;  3C38 A;  2WKH A;  3UB6 A;  3NUL A;  4R0Q A;  3S1Y A;  2ZBB A;  1HD8 A;  1H8M A;  2IWD A;  2BAS A;  1M40 A;  3S7Q A;  3CLO A;  5HWV A;  1UGU A;  3BLM A;  4ZAM A;  4IUH A;  4GDB A;  4NG2 A;  4JGO A;  1E4D A;  3HL9 A;  4FH4 A;  5EVI A;  1VET B;  4GD8 A;  3MZE A;  1MPL A;  4RA7 A;  3T4S A;  2O99 A;  2PBD P;  5IT5 A;  3MSH A;  4UA6 A;  4XT2 B;  3FZC A;  4B93 A;  1PWG A;  2ZQ7 A;  3RH8 B;  2J7V A;  4HES A;  4OPR A;  3U2A A;  2EWV A;  2QHK A;  2VV7 A;  4RVA A;  4GHI B;  1XA7 A;  2M7V A;  1MZU A;  5FQ9 A;  3UB7 A;  3KYE A;  4BQM A;  2V1B A;  4OP5 A;  5CRF A;  1FIL A;  2M1C A;  3LFV A;  4X69 A;  3VSL A;  2W27 A;  2EX9 A;  4ZJ1 A;  5HAQ A;  2WKQ A;  4N92 A;  1E3U A;  4F94 A;  4I38 A;  4GB7 A;  4HH2 A;  3DAV A;  4PM9 A;  1MBL A;  5LBR A;  1K56 A;  4I5S A;  2Z2M B;  1I2S A;  3IX3 A;  4S2O A;  2Y91 A;  3F1O B;  1Q2Q A;  4GZB A;  1RCJ A;  1YSQ A;  1SKF A;  5CEB A;  4LCL A;  3W4P A;  3EOI A;  3GVB A;  1JTG A;  4OLD A;  4JF6 A;  3EGX C;  4HP9 A;  3ZNY A;  4UEY A;  2WYX A;  3OCL A;  2JKT I;  2QKP A;  5FI6 A;  3UE1 A;  1J3W A;  3IF6 C;  3SH8 A;  4CQH A;  5AQA A;  4HBU A;  2X01 A;  1FQG A;  1FSY A;  1BLS A;  3VP3 A;  2NUT C;  1K4E A;  4DE0 A;  2B02 A;  1K4F A;  3PBT A;  1IYQ A;  3IT9 A;  4QWO A;  4LRZ E;  3VSK A;  3VP2 A;  4R70 A;  4KEN B;  2HDS A;  4QJG A;  2CC1 A;  2G7U A;  4KUK A;  5DKL A;  3BFC A;  2XRN A;  2ZD8 A;  5EVI C;  2XR0 A;  2Y2I A;  4QU3 A;  4R38 A;  1F2K A;  4HY8 A;  3UB9 A;  1IEM A;  3VOZ A;  3GQZ A;  5F82 A;  3IF5 A;  1P0Z A;  3EEA A;  5K5B A;  1ES4 A;  5EV0 A;  4OPZ A;  4OP8 A;  4JKT A;  3B33 A;  2V1A A;  4Q8I A;  1X0O A;  1MWS A;  5HDC A;  2ZMF A;  5I5L A;  3T12 B;  1ONH A;  4DDY A;  1BLP A;  3ZG5 A;  3IWI A;  1N9O A;  3A3E A;  3IBJ A;  3MQQ A;  3O3V A;  1PWC A;  5EVI D;  3C4P A;  4EQI A;  3SH9 A;  1I2W A;  3K3D A;  3UO9 A;  2GJ3 A;  3F1N B;  1EWZ A;  5HAR A;  1ONG A;  4L9G A;  5E2E A;  5HWT A;  1FIK A;  4B4Z A;  2Y2Q A;  3FWL A;  2PD8 A;  3HJK A;  4L0L A;  3DTM A;  1D7E A;  3DBA A;  1XJ3 A;  4LCM A;  2QMI A;  1ERQ A;  2YKH A;  4GN2 A;  2PR5 A;  4MDZ A;  1AWI A;  2O9C A;  5HAP A;  2W3H A;  3GV9 A;  3OLO A;  5DF8 A;  3N6I A;  1TF1 A;  3FPW A;  1W7F A;  4E04 A;  1BYW A;  2XRO A;  1CF0 A;  5M19 A;  1L0E A;  3IXB A;  1T1B A;  2XSS A;  1IYO A;  4MN6 A;  2JKR I;  3UDX A;  2EA9 A;  3WS1 A;  1DJC A;  5TGF A;  2PU4 A;  3V39 A;  2ZC4 B;  4YFM A;  4P87 A;  3W2Z A;  3K3C A;  3NOP C;  2P9V B;  2HP5 A;  4Q0H A;  1JVJ A;  2V8C A;  5CHM A;  4IED A;  3CJM A;  5E43 A;  3P7N A;  1TD5 A;  4H6J A;  3UME A;  2L4R A;  4X25 A;  1OTB A;  3R7W A;  4LFU A;  4S2N A;  3VFF A;  3SW1 A;  1FSW A;  4MNR A;  2Q0O A;  1LSW A;  1IYS A;  2V9A A;  2EX6 A;  1PW1 A;  2QWS A;  1PI5 A;  3BYD A;  4E3K A;  2PHY A;  3Q07 A;  3BWL A;  1LL9 A;  1NLY A;  1NZU A;  4UQI S;  4ESP A;  1PWD A;  2W3F A;  4MEZ A;  1K6S A;  3IX4 A;  2ZC6 B;  5IS1 A;  3JPU A;  1VEU B;  2NUP C;  4OPY A;  4P6Z S;  2Y2H A;  2XEP A;  4XXR A;  4U0T A;  2Q9N A;  1ZG4 A;  3T4Q A;  3OOV A;  1W63 Q;  2VGL S;  3AGD A;  2JKT M;  3CIT A;  4HJ3 A;  4N1H A;  3FC7 A;  1BSG A;  1L0G A;  3ZQ5 A;  2KLI A;  3V5M A;  3LI9 A;  2ZQ8 A;  4GW9 A;  3TOI A;  2ZOI A;  5AVE A;  2UV0 E;  2WGV A;  1GSX A;  4EBP A;  2C5W B;  2ZM8 A;  1ES2 A;  3KYQ A;  4IHQ A;  4JPM A;  1XPB A;  3ICY A;  5EOE A;  2W0N A;  5GHX A;  1KE4 A;  1P9R A;  1HVB A;  1H3Q A;  3HUO A;  4HP4 A;  3IH9 A;  1KE3 A;  1TEM A;  2JBF A;  5CGX A;  2JE5 A;  1TVF A;  1VET A;  1MY8 A;  3ZG7 B;  4M3K A;  5F83 A;  3TG9 A;  2J3T C;  4KG5 A;  1K0K A;  5FA7 A;  1PRQ A;  2PD7 A;  1G68 A;  5CED A;  4R3B A;  5A8B A;  2GDN A;  2XD1 A;  3NDG A;  4F3L B;  5AQ9 A;  2Z6D A;  2J3W A;  5KMW A;  4PKY G;  4JGR A;  1OJ5 A;  3V3R A;  4R23 A;  3BFE A;  2EXB A;  4R1G A;  3WS2 A;  1WE4 A;  3L7H A;  4FCF A;  4O01 A;  4FUW A;  5CTN A;  3G35 A;  3ZGA B;  2VV8 A;  3VP1 A;  4S2N C;  4EQ1 A;  2PYR A;  4E3I A;  3IXG A;  2WUQ A;  1HLU P;  4EEU A;  3BY9 A;  4O7D A;  2R9W A;  5EUA A;  4ZDX A;  1BUE A;  3PBQ A;  3H82 A;  1Z09 A;  2V0U A;  3HLE A;  4L9E A;  5TR7 A;  1ES3 A;  1YSP A;  5DFY A;  2YKF A;  1BLH A;  3G31 A;  5GLC A;  1K38 A;  4G3W A;  2Y2G A;  2WKR A;  2EFX A;  5KSC A;  5EM0 A;  3BFD A;  1FR6 A;  3EQU A;  4E6W A;  3NJA A;  4WMC A;  4BD1 A;  1YM1 A;  4OOL A;  1GHP A;  4XUZ A;  4IJG A;  2ZC7 A;  5L10 A;  1MWU A;  5GLD A;  3O86 A;  2WK0 A;  3LIF A;  2JKR M;  2HZ5 A;  4LV1 A;  2W1T A;  2QJ7 A;  3V50 A;  4CLC A;  4WBG A;  5HL6 A;  1CI8 A;  2H0T A;  4UHU A;  5FQI A;  1JWZ A;  1LI9 A;  4DKI A;  4R6L A;  4LV0 A;  5DJU A;  3H7W B;  2Y59 A;  5DJT A;  3U4L P;  3PAE A;  1Y28 A;  4OQG A;  2HV1 A;  4GNU A;  3A0R A;  4KZ5 A;  3S7P A;  1DY6 A;  4NKP A;  3SS4 A;  1H5X A;  1YLT A;  4Y5F A;  2IWB A;  4C3Q A;  1JTD A;  4E3L A;  2C6W B;  3PBO A;  3RXW A;  3B47 A;  2EX8 A;  4GKU A;  1ESU A;  2XD5 A;  3G2Z A;  3ZHH A;  1CK3 A;  4EEP A;  5EVE A;  1SHV A;  3MFX A;  4QPR A;  3HLC A;  4ARZ A;  1YLZ A;  3G34 A;  5FAP A;  1BUL A;  3KYZ A;  3LEQ A;  1EW0 A;  4JGP A;  3H9W A;  1L0D A;  3LUQ A;  2Y8H A;  5D3O A;  3T4J A;  2D02 A;  3HUN A;  4N1X A;  1GA9 A;  3CPT A;  5GL9 A;  3T1R A;  5FQK A;  3BFG A;  3S7O A;  1IEL A;  1ZKJ A;  3GR2 A;  4CPK A;  2FZ0 A;  3AGE A;  2JC7 A;  4GLQ A;  2PU2 A;  4O0P A;  5FSR A;  3VE3 A;  5GLA A;  4EW7 A;  4QY5 A;  3N8R A;  1A0K A;  4PMA A;  2HJE A;  2HJ9 C;  1PW8 A;  4QY6 A;  4CJN A;  5HPI A;  3UB8 A;  3D9Y A;  5F68 A;  2EWW A;  5HL1 A;  5FDH A;  4CLC C;  1KDW A;  3P01 A;  3ITA A;  1ODV A;  3GMW A;  3E4P A;  2E8I A;  3AGF A;  2ZL1 B;  1J9M A;  3HRE A;  5FQM A;  3UY6 A;  1YLW A;  2K7S A;  4GDN A;  1KVM A;  3JVV A;  2R9X A;  3BQ8 A;  4A5R A;  3GEC A;  1S4R A;  3UMD A;  4KZ6 A;  3KSG A;  1S1Z A;  1S67 L;  2WKI A;  4R4R A;  2JKF A;  3SOI A;  4KG6 A;  2OOL A;  3G4P A;  3RJU A;  4E3N A;  2L1M A;  4PM8 A;  4ETZ A;  1NXY A;  1BTL A;  2Y79 A;  4ZBE A;  5TBM B;  1RGY A;  3P09 A;  3UNW A;  4IBR A;  1YT4 A;  4Y0O A;  5EFW A;  4R3J A;  2Y2M A;  4PPR A;  4KQQ A;  4U0X A;  1LL8 A;  1PFL A;  3Q7V B;  5DTT A;  1Y54 A;  1SKO A;  5DFX A;  3MQ0 A;  5E2H A;  4NXB A;  1IKG A;  3ZG8 B;  2ZQA A;  4BBV A;  1ZTU A;  4K08 A;  3VV4 A;  1OT6 A;  5J8X A;  4UQI M;  3IXH A;  4S2J A;  1WA9 A;  2VLG A;  4ZTK A;  3NBL A;  3NIA A;  5CX7 A;  4O8G A;  4DN0 A;  3E4Q A;  3VOL A;  4GS9 A;  1D06 A;  3IX8 A;  4LRY C;  2ZQD A;  4JBF A;  2ZM0 A;  4YIN A;  1LHY A;  3D72 A;  4IVI A;  1PI4 A;  5IHV A;  2VGL M;  3C7V A;  3G2Y A;  3HLB A;  2QPN A;  5CHU A;  3GSG A;  5HD5 A;  4DF6 A;  1C3B A;  1N9B A;  1KE0 A;  5EVI B;  5HPF A;  4RX2 A;  4KQR A;  3UDF A;  1YMS A;  3PBS A;  3CHW P;  2ZC3 B;  1K54 A;  4HQA A;  3MR0 A;  3MZF A;  1N9L A;  1YKD A;  3HVF A;  1H8Z A;  5J4E A;  1FR1 A;  1JWV A;  3W4O A;  3ZFZ A;  3C2W A;  3T1X A;  3NY4 A;  3IHA A;  3K2N A;  1G6O A;  3ZG0 A;  4WM9 A;  4FOF A;  3IH8 A;  3Q82 A;  4EES A;  4EUV A;  4GCZ A;  3FYZ A;  1E3U D;  3LIB A;  3ZVT A;  4MCW A;  1W8Q A;  3TSG A;  3IHB A;  5FEG A;  1S6R A;  2ZMA A;  3M6B A;  3LID A;  5EOO A;  4JXW A;  1K56 D;  3C7U A;  3DWZ A;  2PT7 A;  2WGW A;  4RX3 A;  2LB9 A;  1OTE A;  2WAD A;  3T1Q B;  3C30 A;  2O0Y A;  5DF9 A;  1WYC A;  3MF0 A;  3V3S A;  4HBT A;  3ULF A;  1LSX A;  4JF5 A;  1OTA A;  3HUM A;  5HD3 A;  2WZZ A;  2X71 A;  3EQV A;  2A3U A;  5DTS A;  1K25 A;  1O7E A;  3N8L A;  2VZW A;  4BBT A;  2H10 A;  2HP6 A;  3SZT A;  3KO6 A;  4OLG A;  3L9K A;  2JHE A;  1GA0 A;  4KZ3 A;  3BFF A;  3VOY A;  1L0F A;  2I72 A;  1AXB A;  3F1P B;  3KSI A;  3SH7 A;  5FDS A;  5HDS A;  2W3G A;  2PR6 A;  3MZD A;  5M18 A;  2H0Y A;  2KDK A;  3LR3 A;  4C75 A;  2A2L A;  4HNB A;  3FKV A;  5M1A A;  1UWN X;  5U47 A;  4DXC A;  3CWF A;  2GNX A;  4OKP A;  5L8M A;  2J80 A;  3OZH A;  2W3D A;  2HDR A;  2WZX A;  2DMW A;  4MBH A;  1Z6F A;  1SDN A;  2A24 A;  3PYP A;  4OQH A;  1BT5 A;  5DTK A;  2GX5 A;  3H7W A;  3UB5 P;  4X53 A;  5L09 A;  2ACG A;  3HJI A;  4MMN A;  3TRC A;  1K6R A;  2XA7 M;  4ZJ2 A;  1CEG A;  1S1Y A;  2OAP 1;  2V1Z A;  1U60 A;  1XGI A;  2IA2 A;  3VP4 A;  3MXR A;  3MKE A;  3T50 A;  3MXQ A;  1H0M A;  5AJG A;  1GHM A;  3NOU C;  2HP9 A;  1GCE A;  1QME A;  1DJB A;  2ZOH A;  1OPX A;  1D1J A;  1K54 C;  5GHY A;  4DJ2 A;  5FI2 A;  3BRM A;  4MBK A;  3LR5 A;  1FOF A;  3HBR A;  4YNR A;  1DP8 A;  5J3W A;  1NWZ A;  2Y2N A;  3VFH A;  2VGK A;  4WZ5 A;  4XT2 A;  1N9N A;  3MQO A;  3LYX A;  1P97 A;  5HAI A;  3DTE A;  4HI4 A;  4GHI A;  5EPH A;  3LI8 A;  1HZO A;  3LR4 A;  3C8C A;  4G3V A;  1OTD A;  1TS0 A;  1TS8 A;  3NI9 A;  4X56 A;  3MJQ A;  3B3X A;  4WEL A;  1PZO A;  4FD8 A;  3BY8 A;  4JLF A;  2WAF A;  1KGF A;  1YMX A;  2V20 A;  1MWR A;  3BW6 A;  2ZLY A;  5F1G A;  4HEF A;  2J3T D;  3VE4 A;  3NOT C;  3O87 A;  2INW A;  4S2L A;  1PYY A;  4QB8 A;  4Y0U A;  3W4Q A;  1IOU A;  3JYI A;  3QP6 A;  1ESI A;  3T4L A;  1RGZ A;  2HPB A;  4KZ8 A;  3F1O A;  4DMZ A;  2FFF B;  2AVX A;  1F5M A;  3QP8 A;  1G28 A;  2J8Y A;  2HDU A;  4HOI A;  3UDI A;  1XFN A;  2ZL1 A;  1G6A A;  4WN5 A;  1XA1 A;  3BQA A;  2A49 A;  2WAE A;  3OPH A;  5KSH A;  1YAX A;  3B42 A;  2HF6 A;  4X55 A;  3BM6 A;  3N4I A;  4LEN A;  4EV4 A;  3HLG A;  4AFI A;  4BL3 A;  4E6X A;  4WL9 A;  1PNE A;  1PIO A;  3IS2 B;  4H6J B;  1TS7 A;  2P08 A;  4IBX A;  4YOF A;  3A3J A;  3R7W B;  5KZH A;  5FI7 A;  4Y13 A;  2HDQ A;  3ZG9 B;  1Q2P A;  2B95 A;  4NXE A;  1RP5 A;  3FPV A;  1XXM A;  5AQB A;  3S4X A;  2CMN A;  5MC7 A;  2W1R A;  3OPP A;  4LPZ A;  3VMA A;  2BG1 A;  5EM1 A;  4WZ5 C;  2Z2L B;  4KG2 A;  3E2K A;  1XJ4 A;  1N4O A;  4DE2 A;  3BEC A;  3FG8 A;  3T4T A;  1MC0 A;  1NYY A;  2BLS A;  3M2K A;  4WLA A;  5BOH A;  3OPL A;  3E2L A;  1YPR A;  4WEJ A;  3ZNT A;  4JXV A;  3QNC A;  2K2N A;  4P6B A;  5G18 A;  2XFS A;  4I3I A;  2ZM2 A;  3MKF A;  4BMW A;  1YLY A;  3RFB A;  3TW8 A;  1SCW A;  1BLC A;  5TFQ A;  5A93 A;  1JWP A;  3SS5 A;  2ZQC A;  3OBF A;  5J7E A;  2WKE A;  2VKS A;  3PR6 A;  1HTZ A;  1H8Y A;  3RTY A;  1XGJ A;  3F1N A;  1ZC2 A;  1FCO A;  1SZV A;  2OSU A;  3ZCZ A;  2XQZ A;  2DCF A;  2WKP A;  1XJ6 A;  1TDL A;  4BEN A;  3LR0 A;  2UWX A;  5FAO A;  3CMZ A;  2EXA A;  3QP2 A;  2XFT A;  3WS5 A;  3C4O A;  1K55 A;  2OAQ 1;  3CI6 A;  4HHD A;  4BLM A;  5L2F A;  2EX2 A;  2VV6 A;  4Y7P A;  4P0M A;  4MN7 A;  4OOY A;  2Y2L A;  1LLB A;  1XP4 A;  1NRJ A;  1I5Q A;  2R78 A;  2JCH A;  1T1C A;  4EUZ A;  4BD0 A;  4UAA A;  5EEC A;  3MS6 A;  3NDE A;  4PM7 A;  1LSV A;  2XLN A;  5GLB A;  4C6Y A;  5DF7 A;  1VQQ A;  4Y15 A;  3PBN A;  2Y2O A;  1L3L A;  2P9V A;  4MBF A;  4JGQ A;  2Y2J A;  4OOM A;  4DE1 A;  4N9L A;  3T1S A;  3UPO A;  3I7J A;  4G3K A;  1NJ4 A;  1NYM A;  4LLO B;  2B5R A;  1ES5 A;  2P7J A;  4Z1W A;  3EEH A;  3Q81 A;  4WMC D;  3H82 B;  3F1P A;  3OPR A;  1W79 A;  3LGO A;  3M6H A;  4PKY A;  4WUJ A;  3T4K A;  1KVL A;  4PM5 A;  4U3T A;  1ERO A;  4LV2 A;  2Z6C A;  2KX6 A;  3WS4 A;  3LEZ A;  4Y3I A;  4Z9Q A;  3KX0 X;  5G4Z A;  2FH5 A;  4ME4 A;  1Y4O A;  1CJF A;  1DP9 A;  4BL2 A;  4UA7 A;  2WGI A;  1VEU A;  2I9V A;  4KUO A;  3W8K A;  1MXO A;  4CLC D;  2OWJ A;  3OC2 A;  5CHJ A;  4H8R A;  3TJZ C;  4KZB A;  4FH2 A;  4OQ0 A;  4S2P A;  2RL3 A;  2HGV A;  2JKG A;  2ZJ9 A;  5HFO A;  2OLV A;  4B4X A;  4WEK A;  5E2F A;  2W1T B;  5A92 A;  5CXW A;  3O5Y A;  2DRW A;  3ITB A;  4CLC B;  5F5Y A;  5JYO A;  3PBR A;  4I3J A;  4WYY A;  2B18 A;  3R4K A;  2OV5 A;  4DRT A;  1FCM A;  5HWW A;  2M7U A;  1K55 C;  2Y4A A;  1DRM A;  5L07 A;  1ERM A;  1VM1 A;  1ALQ A;  3EGD C;  4X1L A;  1GSW A;  1ZHH B;  1LT0 A;  2ZMV A;  3WS0 A;  5AVF A;  3IF6 B;  4JXS A;  3UE0 A;  4EXO A;  4R4S A;  2H28 A;  4NXF A;  4ETX A;  4I39 A;  4OON A;  4P6Z M;  3V67 A;  4EBN A;  5FL3 A;  1KGG A;  3NCK A;  5FAS A;  1UWP X;  2DNS A;  4ID4 A;  1V9Z A;  1K57 A;  4F3L A;  4Y17 A;  1G5U A;  3NHQ A;  5F1F A;  1S4S A;  5FAQ A;  4Y2F A;  1ZG6 A;  1DJA A;  1NZO A;  5FQJ A;  3QNB A;  4EBL A;  3A0V A;  2PRF A;  3D3O A;  2Y55 A;  2LB5 A;  5IU1 A;  5CER A;  4ARZ B;  3RXX A;  3JVU A;  5F6A A;  3PAG A;  4Q0I A;  4X6T A;  1YQS A;  5E2G A;  4S2K A;  4X1M A;  1IFQ A;  4KZ4 A;  3N7W A;  1KDS A;  2VJW A;  2E8J A;  3ZYT A;  2P04 A;  2OLU A;  4WZ4 A;  3IXD A;  2XGN A;  3LY3 A;  2O9B A;  2VX8 A;  5FAT A;  3MBZ A;  3CPT B;  3LY4 A;  5F69 A;  4EWF A;  1TDG A;  4EET B;  2VGJ A;  4DJ3 A;  3QHY A;  2J9P A;  5DKK A;  4PAU A;  3S7N A;  2XH9 A;  1S0W A;  5HZH A;  4RYE A;  4E3O A;  4FTX A;  4NK3 A;  3WWX A;  3LIA A;  4DE3 A;  5HDD A;  4L9F A;  4PM6 A;  3TE8 A;  3PXP A;  1VHM A;  2PDR A;  1XX2 A;  3QP4 A;  5EVL A;  1OME A;  4DXB A;  4Y0T A;  3C5A A;  3P98 A;  3FV7 A;  2ZC5 B;  5HSQ A;  3A3D A;  3FKW A;  3Q1F A;  3IWO A;  3VP0 A;  4I3A A;  3IS2 A;  4OVD A;  2Y2P A; 
#chains in the Genus database with same CATH homology
 4HJ6 A;  1P0Z A;  3E0Y A;  4FSF A;  3T4L A;  3F1O A;  3EEA A;  3KYZ A;  4DMZ A;  1OTI A;  5K5B A;  1EW0 A;  4JGP A;  4BJP A;  1F5M A;  3H9W A;  3LUQ A;  1G28 A;  2Y8H A;  3B33 A;  2V1A A;  1X0O A;  4HOI A;  4II7 A;  2ZMF A;  5HDC A;  5I5L A;  4YWZ A;  2GZA A;  3T4J A;  3GDI A;  2D02 A;  4KQO A;  4NXG A;  1XFN A;  2V0W A;  4WN5 A;  3BQA A;  4MN5 A;  1N9O A;  3S7O A;  3LIE A;  4EU0 A;  2FZ0 A;  3IBJ A;  3MQQ A;  4GLQ A;  5KSH A;  2MJ6 A;  1YAX A;  1OT9 A;  1W63 M;  3B42 A;  4HH3 A;  4O0P A;  3K3D A;  2HF6 A;  2GJ3 A;  3F1N B;  3VE3 A;  4EW7 A;  4AFI A;  2D01 A;  4WL9 A;  5G4Y A;  2HJE A;  2HJ9 C;  4L9G A;  3IS2 B;  4H6J B;  1TS7 A;  2P08 A;  4YOF A;  5HWT A;  3R7W B;  5HPI A;  3UB8 A;  2PD8 A;  5F68 A;  1F9I A;  3KSF A;  3HJK A;  2EWW A;  4BBU A;  4NXE A;  3FPV A;  4L0L A;  4CLC C;  3P01 A;  1D7E A;  4ZRR A;  4EER A;  3DBA A;  1XJ3 A;  5KIZ A;  2CMN A;  1ODV A;  5MC7 A;  3E4P A;  3IBR A;  1T18 A;  2YKH A;  2W1R A;  3CUE A;  4B9O A;  2PR5 A;  4MDZ A;  3T4O A;  4CLC E;  2O9C A;  4GJ4 A;  1KOU A;  4LPZ A;  3BJN A;  3LIC A;  2W3H A;  3OLO A;  2K7S A;  1XJ4 A;  1TF1 A;  3FPW A;  3JVV A;  4E04 A;  1BYW A;  1P9W A;  2XRO A;  4IUK A;  3FG8 A;  3T4T A;  1MC0 A;  1F98 A;  4WLA A;  4GS9 B;  3BQ8 A;  4NEE D;  4WEJ A;  3UE6 A;  3GEC A;  1T1B A;  2XSS A;  2K2N A;  4MN6 A;  1S4R A;  2JKR I;  3UMD A;  2EA9 A;  4I3I A;  4BMW A;  3OCN A;  3RFB A;  3TW8 A;  3KSG A;  1S1Z A;  1S67 L;  5C5K A;  4PHT A;  1V9Y A;  3KSH A;  3OBF A;  5J7E A;  3W2Z A;  2OOL A;  2VKS A;  3K3C A;  3NOP C;  2QJ5 A;  3PR6 A;  3RTY A;  4Q0H A;  3F1N A;  2L1M A;  4HJ4 A;  3P7N A;  1TD5 A;  4ETZ A;  2Y79 A;  5TBM B;  4H6J A;  3UME A;  2L4R A;  2W3E A;  1OTB A;  3R7W A;  3SW1 A;  2WKP A;  1XJ6 A;  2VA0 A;  5EFW A;  3LR0 A;  4RQ9 A;  1XFQ A;  2L0W A;  1LSW A;  1LL8 A;  2OAQ 1;  2V9A A;  3CI6 A;  5DFX A;  3MQ0 A;  4HHD A;  4NXB A;  2QWS A;  4BBV A;  2VV6 A;  2PHY A;  3MMH A;  1ZTU A;  3BWL A;  4K08 A;  3VV4 A;  1NLY A;  1OT6 A;  4MN7 A;  4UQI S;  3E4O A;  2W3F A;  4UQI M;  2KOI A;  5IS1 A;  4HIA A;  1TS6 A;  1WA9 A;  1OJG A;  1NRJ A;  2VLG A;  4Q0J A;  2NUP C;  4P6Z S;  1VB6 A;  3HCY A;  5TJJ A;  3CAX A;  5CX7 A;  4O8G A;  2R78 A;  4DN0 A;  1T1C A;  2VEA A;  2OWH A;  2QYB A;  3E4Q A;  3VOL A;  3T4Q A;  4GS9 A;  3OOV A;  1W63 Q;  1S66 L;  1D06 A;  1T19 A;  4LRY C;  1NLZ A;  2VGL S;  2XA7 S;  3D72 A;  1LSV A;  2JKT M;  3CIT A;  4HJ3 A;  4WF0 A;  2VGL M;  3FC7 A;  2PYP A;  3ZQ5 A;  1STZ A;  2KLI A;  1T1A A;  3LI9 A;  5HD5 A;  4GW9 A;  3PBN A;  2ZOI A;  5HPF A;  5AVE A;  3A0S A;  3PBS A;  4JGQ A;  4OOM A;  1JNU A;  1GSX A;  4HQA A;  4G3K A;  3MR0 A;  3KYQ A;  1N9L A;  1YKD A;  4IHQ A;  5TBM A;  3ICY A;  4LLO B;  5J4E A;  4BWI A;  2W0N A;  3C2W A;  1MKM A;  1P9R A;  3CUE C;  2P7J A;  1H3Q A;  2O9A A;  4Z1W A;  4HP4 A;  3K2N A;  3EEH A;  1G6O A;  3H82 B;  3F1P A;  4FOF A;  4PKY A;  4WUJ A;  3G6O A;  3T4K A;  4R3A A;  4EES A;  4EUV A;  4GCZ A;  1DP6 A;  2J3T C;  1XJ2 A;  2K31 A;  3LIB A;  2PD7 A;  2A24 B;  2JN7 A;  4MCW A;  4M4X A;  2Z6C A;  2KX6 A;  4LRX C;  4KQD A;  4Y3I A;  3UE3 A;  3KX0 X;  5A8B A;  5G4Z A;  2FH5 A;  3LID A;  4ME4 A;  3E98 A;  4F3L B;  3PHY A;  1GSV A;  1DP9 A;  3EWK A;  2Z6D A;  2J3W A;  2PT7 A;  4PKY G;  2I9V A;  2LB9 A;  4KUO A;  3C38 A;  4JGR A;  1OJ5 A;  1OTE A;  3UB6 A;  4CLC D;  3C30 A;  2O0Y A;  2OWJ A;  3OC2 A;  5DF9 A;  2ZBB A;  3MF0 A;  1H8M A;  3ULF A;  2BAS A;  1LSX A;  1OTA A;  3S7Q A;  5HD3 A;  3TJZ C;  3CLO A;  3EQV A;  5HWV A;  2HGV A;  4O01 A;  4BBT A;  2VZW A;  1UGU A;  4WEK A;  4IUH A;  2VV8 A;  2W1T B;  4JGO A;  3KO6 A;  3O5Y A;  2JHE A;  4CLC B;  5F5Y A;  4EQ1 A;  3PBR A;  2PYR A;  3F1P B;  3KSI A;  4I3J A;  2B18 A;  3R4K A;  5HDS A;  2W3G A;  2PR6 A;  5HWW A;  4EEU A;  2KDK A;  3T4S A;  2O99 A;  2M7U A;  3LR3 A;  2A2L A;  4HNB A;  1DRM A;  3BY9 A;  5IT5 A;  3EGD C;  1GSW A;  1UWN X;  4XT2 B;  1ZHH B;  4B93 A;  3CWF A;  3RH8 B;  2GNX A;  1LT0 A;  5L8M A;  2ZMV A;  3U2A A;  5AVF A;  2EWV A;  2QHK A;  3PBQ A;  2VV7 A;  2J80 A;  4GHI B;  3H82 A;  4EXO A;  2W3D A;  2V0U A;  2H28 A;  4NXF A;  4L9E A;  4ETX A;  2DMW A;  2M7V A;  4I39 A;  1YSP A;  5DFY A;  2YKF A;  4P6Z M;  3V67 A;  5FL3 A;  1MZU A;  2A24 A;  3PYP A;  3UB7 A;  2GX5 A;  3H7W A;  1UWP X;  4G3W A;  2V1B A;  1V9Z A;  2WKR A;  3HJI A;  4MMN A;  3TRC A;  2XA7 M;  4F3L A;  1S1Y A;  3NHQ A;  2M1C A;  3EQU A;  3LFV A;  3NJA A;  2OAP 1;  2W27 A;  4OOL A;  1S4S A;  4Y2F A;  2IA2 A;  2WKQ A;  4IJG A;  3T50 A;  3MXQ A;  4I38 A;  5AJG A;  3A0V A;  3NOU C;  3D3O A;  3LIF A;  2JKR M;  2LB5 A;  4HH2 A;  5IU1 A;  5LBR A;  4ARZ B;  2ZOH A;  3JVU A;  1OPX A;  5F6A A;  4DJ2 A;  4Q0I A;  4I5S A;  2W1T A;  3LR5 A;  2QJ7 A;  3F1O B;  4YNR A;  4CLC A;  1DP8 A;  1IFQ A;  1YSQ A;  5J3W A;  5HL6 A;  1NWZ A;  2VJW A;  4R6L A;  2P04 A;  3ZYT A;  3EOI A;  5DJU A;  2O9B A;  3H7W B;  5DJT A;  2VX8 A;  3EGX C;  1Y28 A;  4HP9 A;  4XT2 A;  1N9N A;  2HV1 A;  4UEY A;  3OCL A;  2JKT I;  2QKP A;  5F69 A;  3MQO A;  3LYX A;  1P97 A;  4HI4 A;  4GHI A;  3A0R A;  3LI8 A;  4EET B;  3LR4 A;  3C8C A;  4DJ3 A;  4G3V A;  1OTD A;  3S7P A;  4CQH A;  4NKP A;  1TS0 A;  1TS8 A;  5DKK A;  4PAU A;  4Y5F A;  3MJQ A;  3S7N A;  2NUT C;  2B02 A;  5HZH A;  4WEL A;  3PBT A;  3LIA A;  4LRZ E;  3PBO A;  5HDD A;  4L9F A;  3BY8 A;  4R70 A;  3TE8 A;  3PXP A;  2G7U A;  1VHM A;  3BW6 A;  3B47 A;  2PDR A;  2J3T D;  4KUK A;  5DKL A;  3VE4 A;  2XRN A;  3NOT C;  4EEP A;  3MFX A;  4R38 A;  2INW A;  4HY8 A;  5HSQ A;  3UB9 A;  4QPR A;  4ARZ A;  1IOU A;  4I3A A;  3IS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...