1IOXA

Nmr structure of human betacellulin-2
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
50
structure length
50
Chain Sequence
RKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of betacellulin, a new member of EGF-family ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
molecule keywords Betacellulin
total genus 6
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2001-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1ioxA00
4X8UL 1FAXL 3LC5B 4FM5A 1PTHA 3IITB 5E8DA 4YT7L 1NFYB 4BXSA 2BMGA 3TBDA 3FBYA 5K0HB 2M74A 1IQGL 2J34B 3HS7A 3K9XA 4G1MB 1IGZA 2BZ6L 3BT2A 5CKMA 2WYJB 3OLUA 3SOQA 2P94L 4X8TL 5JBCE 2VVCK 2GD4A 1ATDA 1HT8A 1IQIL 3ZYJB 4D0FA 1YUGA 4D0EA 2W2ME 1KLIL 4X8SL 4MMYB 2PHBB 3CA7A 4RS0A 1PGEA 2W86A 1DQBA 1KLOA 2BQ7A 4ISHL 3LAQA 4BTUA 4A7IA 2J94B 3N8WB 1F7MA 4E1GA 3KRKA 2RHPA 4BDXA 2KL7A 1HAEA 2XBWL 1CX2A 2WPKE 1WHFA 4JZFL 2VVUL 1EPGA 1V3XB 3HPTA 2W2OE 2P3UA 1YUKB 2VVVL 1C5MF 2FLBL 3NJPC 2YGPA 2RNLA 1OB1C 4RUTA 1U67A 1HAFA 2K2SB 2P95L 3N8YB 2P3FL 2P28B 5IKRA 3GCXE 4ZXXL 3LTFB 2UWLB 3M36L 4ZHAB 3POYA 2P26A 3CENL 1XKAL 1Q4GA 4ISIL 1F0RB 1F0SB 2AYLA 2VWOL 4LMFA 1G1TA 2YGOA 5CKNA 1XDTR 4PH9A 1FFMA 1EMNA 1BF9A 2W2NE 1G1RA 1DVAL 2FZZL 5KIRA 2WYGB 2J4IB 2VH6B 2W3KB 1TOZA 1FSBA 4RRXA 2XC4L 1HREA 3GISX 3Q7DA 3KQDL 1YGCL 3F1SB 1X7AL 2WPIE 2RA0L 1Z6EL 1M1XB 1HZ8A 2FLRL 1CCVA 1NZIA 3KL6B 4JZDL 5I46L 3TK5B 1DIYA 1CCFA 5JVYA 1ADXA 1DX5I 2WPJE 3TH3L 4JYUL 3NT1A 5KN5C 1PRHA 1KLJL 4RRZA 2BQ6A 2P16L 3SW2A 3V65B 2Y7XB 2G00L 2KV4A 1FAKL 2H9EL 1IP0A 2XBVL 3N8WA 1NQLB 1G1QA 5CISA 1MOXC 2WPHE 2XC5L 1FF7A 1IQML 4BXWA 1L3YA 2MGRA 1LPGA 1KIGL 6COXA 1Z6CA 1NFUB 1IQHL 5L30L 1DDXA 1YUFA 4M10A 1NPEB 2Y5HL 1EMOA 2WPME 4LORA 5CKQA 1HX2A 4JYVL 2Y5FL 4CUFA 1FE2A 4ZH8B 2EI8B 3U7UG 4CSYA 3SOVA 1GK5A 5F19A 1IQNL 5JB8E 2I9BA 1WHEA 1B9WA 5L2YL 4D90A 3ZYGA 3NTBA 3ZYIB 3HS6A 3N8ZA 2VH0B 2J38B 3BT1A 1CEJA 1PFXL 2BOKL 4Y6DB 1HCGB 1IOEL 2PUQL 5COXA 4Y7AB 1IQEL 4Y71B 2FLGA 2W26B 5IKVA 2DDUA 2EI6B 3QMOA 3HO3A 1EQHA 2FD6A 4XL1A 3LC3B 3KK6A 1UZPA 1P0SL 1COUA 1WU1B 1LPZA 2Y38A 3TGFA 1EAIC 4BTIA 1UZQA 2BOHA 4O1ZA 4M11A 1IQLL 1APOA 1XKBA 3N8YA 2Y80B 2MGPA 3OLTA 1ZAQA 4Z6AL 2BOUA 1P9JA 5FDQA 4ZAEB 4RRYA 1EPIA 4X8VL 1NT0A 3LN1A 3HS5A 3C9AC 3FCSB 1ATBA 2PR3B 2WPLE 3DEMA 4CUDA 1SZBA 3V64C 2BO2A 4MMZB 4Y7BB 4XBMA 3ENSA 3MDLA 2W3IB 1L5GB 3ASIA 1ATEA 2WG3C 3BPSE 1IQJL 2EI7B 2Y81B 4Z0LA 5IKQA 1I0UA 3KCGL 4TGFA 2WG4B 1IOXA 2UWOB 1CQEA 2WFXB 3LTGD 4AQTA 2D1JB 2ADXA 3PGHA 3Q3KB 4Z0KB 4ZXYL 2J2UB 4NGAL 1CVUA 2Y82B 3LN0A 4Y79B 5JVZA 1W8BL 4YT6L 1HRFA 1JV2B 1IVOC 3KQEL 1AUTL 1LMJA 4OTJA 2B7DL 4C16A 1NFWB 2MHPA 4O02B 4YZUB 1K37A 2NPRA 1F7EA 2XBXL 2W2QE 1J9CL 1MQ5L 3M37L 1JBUL 3CFWA 1TLEA 3KQBL 4BTTA 5JB9E 1HJ7A 4COXA 2P3TA 1O5DL 2Y7ZB 3N8VA 3MQEA 3LIWB 2I9AA 1URKA 2OYUP 4NA9L 1IQFL 2BOXA 2TGFA 1EPJA 2WFTA 3H5CB 4CUEA 1PXXA 3HO4A 2XC0L 1N1IA 2UWPB 2OYEP 3FFGL 3P5BL 2VJ3A 1G2LB 3CS7L 1K36A 2VWNL 4RRWA 3QH0A 3ELAL 2XBYL 3RR3A 1G1SA 1W7XL 4NG9L 2VWLL 3HO5A 1IGXA 3N8XA 4OTYA 1YO8A 4XLWA 1EPHA 1KSNB 1LPKA 1XFEA 1IQKL 3U73A 2KB9A 1IJQA 2P3FN 1EBVA 1TPGA 1ATAA 2Q1JB 3EGFA 4Y76B 4MMXB 1FJSL 2K2TA 5JBAE 3F6UL 2Y5GL 5EGMB 5JW1A 2P93L 3TZIA 3SOBB 4BDWA 1CVWL 3IJEB 1EZQB 3GCWE 1APQA 1NFXB 2JKHL 1UZKA 3KQCL 1JL9A 5L2ZL 5F1AA 1G2MB 1N7DA 1QFKL 3TK6B 1RFNB 1HT5A 3NTGA 2F9BL 1EQGA 1EGFA 1MQ6L 1A3PA 5JBBE 2J95B 2BQWA 1UZJA 3R05A 1LQDA 4JZEL 3QCWA 2CJIB 1U8CB 2W2PE 2VWMK 5IKTA
chains in the Genus database with same CATH superfamily
4X8UL 1FAXL 3LC5B 4FM5A 1PTHA 3IITB 5E8DA 4YT7L 1NFYB 4BXSA 2BMGA 3TBDA 3FBYA 5K0HB 2M74A 1IQGL 2J34B 3HS7A 3K9XA 4G1MB 1IGZA 2BZ6L 3BT2A 5CKMA 2HOXA 2WYJB 3OLUA 3SOQA 2P94L 2HORA 4X8TL 5JBCE 2VVCK 2GD4A 1ATDA 1HT8A 1IQIL 3ZYJB 4D0FA 1YUGA 4D0EA 2W2ME 1KLIL 4X8SL 4MMYB 2PHBB 3CA7A 4RS0A 1PGEA 2W86A 1DQBA 1KLOA 2BQ7A 4ISHL 1LK9A 3LAQA 4BTUA 4A7IA 2J94B 3N8WB 1F7MA 4E1GA 3KRKA 2RHPA 4BDXA 2KL7A 1HAEA 2XBWL 1CX2A 2WPKE 1WHFA 4JZFL 2VVUL 1EPGA 1V3XB 3HPTA 2W2OE 2P3UA 1YUKB 2VVVL 1C5MF 2FLBL 3NJPC 2YGPA 2RNLA 1OB1C 4RUTA 1U67A 1HAFA 2K2SB 2P95L 3N8YB 2P3FL 2P28B 1QIUA 5IKRA 3GCXE 4ZXXL 3LTFB 2UWLB 3M36L 4ZHAB 2BT8A 3POYA 2P26A 3CENL 1XKAL 4A94C 1Q4GA 4ISIL 1F0RB 1F0SB 2AYLA 2VWOL 4LMFA 1G1TA 2YGOA 5CKNA 1XDTR 4PH9A 1FFMA 1EMNA 1BF9A 2W2NE 1G1RA 1DVAL 2FZZL 5KIRA 2WYGB 2J4IB 2VH6B 2W3KB 1TOZA 1FSBA 4RRXA 2XC4L 1HREA 3GISX 3Q7DA 3KQDL 1YGCL 3F1SB 1X7AL 2WPIE 2RA0L 1Z6EL 1M1XB 1HZ8A 2FLRL 1CCVA 1NZIA 3KL6B 4JZDL 5I46L 3TK5B 1DIYA 1CCFA 5JVYA 2BSFA 1ADXA 1DX5I 2YGQA 2BT7A 2WPJE 2H9EC 3TH3L 4JYUL 3NT1A 5KN5C 1PRHA 1KLJL 4RRZA 2BQ6A 2P16L 3SW2A 3V65B 2Y7XB 2G00L 2KV4A 1FAKL 2H9EL 1IP0A 2XBVL 3N8WA 1NQLB 1G1QA 5CISA 1MOXC 2WPHE 2XC5L 1FF7A 1V1HA 1IQML 4BXWA 1L3YA 2MGRA 1LPGA 1KIGL 6COXA 1Z6CA 1NFUB 1IQHL 5L30L 1DDXA 1YUFA 4M10A 1NPEB 2Y5HL 1EMOA 2WPME 4LORA 5CKQA 1HX2A 4JYVL 2Y5FL 4CUFA 1FE2A 4ZH8B 2EI8B 3U7UG 4CSYA 3SOVA 1GK5A 5F19A 1IQNL 5JB8E 2I9BA 1WHEA 1B9WA 5L2YL 4D90A 3ZYGA 3NTBA 3ZYIB 3HS6A 3N8ZA 2VH0B 2J38B 3BT1A 1CEJA 1PFXL 2BOKL 4Y6DB 1HCGB 1IOEL 2PUQL 1KKEA 5COXA 4Y7AB 1IQEL 4Y71B 2FLGA 2W26B 5IKVA 2DDUA 2EI6B 3QMOA 3HO3A 1EQHA 2FD6A 4XL1A 3LC3B 3KK6A 1UZPA 1LMMA 4GU3A 1P0SL 1COUA 1WU1B 1LPZA 2Y38A 3TGFA 1EAIC 4BTIA 1UZQA 2BOHA 4O1ZA 4M11A 1IQLL 1APOA 1XKBA 3N8YA 2Y80B 2MGPA 3OLTA 1ZAQA 4Z6AL 2BOUA 1P9JA 5FDQA 4ZAEB 4RRYA 1EPIA 4X8VL 1NT0A 3LN1A 3HS5A 3C9AC 3FCSB 1ATBA 2PR3B 2WPLE 3DEMA 4CUDA 1SZBA 3V64C 2BO2A 4MMZB 4Y7BB 4XBMA 3ENSA 3MDLA 2W3IB 1L5GB 3ASIA 1ATEA 2WG3C 3BPSE 1IQJL 2EI7B 2Y81B 4Z0LA 5IKQA 1I0UA 3KCGL 4TGFA 2WG4B 1IOXA 2UWOB 1CQEA 2WFXB 3LTGD 4AQTA 2D1JB 2ADXA 3PGHA 3Q3KB 4Z0KB 4ZXYL 1V1IA 2J2UB 4NGAL 1CVUA 2Y82B 3LN0A 4Y79B 5JVZA 1W8BL 4YT6L 1HRFA 1JV2B 1IVOC 3KQEL 1AUTL 1LMJA 4OTJA 2B7DL 4C16A 1NFWB 2MHPA 4O02B 4YZUB 1K37A 2NPRA 1F7EA 2XBXL 2W2QE 1J9CL 1MQ5L 3M37L 1JBUL 3CFWA 1TLEA 3KQBL 4BTTA 5JB9E 1HJ7A 4COXA 2P3TA 1O5DL 2Y7ZB 3N8VA 3MQEA 3LIWB 4GU4A 2I9AA 1URKA 2OYUP 4NA9L 1IQFL 2BOXA 2TGFA 1EPJA 2WFTA 3H5CB 4CUEA 1PXXA 3HO4A 2XC0L 1N1IA 2UWPB 2OYEP 3FFGL 3P5BL 2VJ3A 1G2LB 3CS7L 1K36A 2VWNL 4RRWA 3QH0A 3ELAL 2XBYL 3RR3A 1G1SA 1W7XL 4NG9L 2VWLL 3HO5A 1IGXA 3N8XA 4OTYA 1YO8A 4XLWA 1EPHA 1KSNB 1LPKA 1XFEA 1IQKL 3U73A 2KB9A 1IJQA 2P3FN 3S6XA 1EBVA 1TPGA 1ATAA 2Q1JB 3EGFA 2JJLA 4Y76B 4MMXB 1FJSL 2K2TA 5JBAE 3F6UL 2Y5GL 5EGMB 5JW1A 2P93L 3TZIA 3SOBB 4BDWA 1CVWL 3IJEB 1EZQB 3GCWE 1APQA 1NFXB 2KNIA 2JKHL 1UZKA 3KQCL 1JL9A 5L2ZL 5F1AA 1G2MB 1N7DA 1QFKL 3TK6B 1RFNB 1HT5A 3NTGA 2F9BL 1EQGA 1EGFA 1MQ6L 1A3PA 5JBBE 2J95B 2BQWA 1UZJA 3R05A 1LQDA 4JZEL 3QCWA 2CJIB 1U8CB 2WZPP 2W2PE 2VRSA 2VWMK 5IKTA
chains in the Genus database with same CATH topology
4X8UL 1FAXL 3LC5B 4FM5A 1PTHA 3IITB 5E8DA 4YT7L 1NFYB 4BXSA 2BMGA 3TBDA 3FBYA 5K0HB 2M74A 1IQGL 2J34B 3HS7A 3K9XA 4G1MB 1IGZA 2BZ6L 3BT2A 5CKMA 2WYJB 3OLUA 3SOQA 2P94L 4X8TL 5JBCE 2VVCK 2GD4A 1ATDA 1HT8A 1IQIL 3ZYJB 4D0FA 1YUGA 4D0EA 2W2ME 1KLIL 4X8SL 4MMYB 2PHBB 3CA7A 4RS0A 1PGEA 2W86A 1DQBA 1KLOA 2BQ7A 4ISHL 3LAQA 4BTUA 4A7IA 2J94B 3N8WB 1F7MA 4E1GA 3KRKA 2RHPA 4BDXA 2KL7A 1HAEA 2XBWL 1CX2A 2WPKE 1WHFA 4JZFL 2VVUL 1EPGA 1V3XB 3HPTA 2W2OE 2P3UA 1YUKB 2VVVL 1C5MF 2FLBL 3NJPC 2YGPA 2RNLA 1OB1C 4RUTA 1U67A 1HAFA 2K2SB 2P95L 3N8YB 2P3FL 2P28B 5IKRA 3GCXE 4ZXXL 3LTFB 2UWLB 3M36L 4ZHAB 3POYA 2P26A 3CENL 1XKAL 4A94C 1Q4GA 4ISIL 1F0RB 1F0SB 2AYLA 2VWOL 4LMFA 1G1TA 2YGOA 5CKNA 1XDTR 4PH9A 1FFMA 1EMNA 1BF9A 2W2NE 1G1RA 1DVAL 2FZZL 5KIRA 2WYGB 2J4IB 2VH6B 2W3KB 1TOZA 1FSBA 4RRXA 2XC4L 1HREA 3GISX 3Q7DA 3KQDL 1YGCL 3F1SB 1X7AL 2WPIE 2RA0L 1Z6EL 1M1XB 1HZ8A 2FLRL 1CCVA 1NZIA 3KL6B 4JZDL 5I46L 3TK5B 1DIYA 1CCFA 5JVYA 1ADXA 1DX5I 2YGQA 2WPJE 2H9EC 3TH3L 4JYUL 3NT1A 5KN5C 1PRHA 1KLJL 4RRZA 2BQ6A 2P16L 3SW2A 3V65B 2Y7XB 2G00L 2KV4A 1FAKL 2H9EL 1IP0A 2XBVL 3N8WA 1NQLB 1G1QA 5CISA 1MOXC 2WPHE 2XC5L 1FF7A 1IQML 4BXWA 1L3YA 2MGRA 1LPGA 1KIGL 6COXA 1Z6CA 1NFUB 1IQHL 5L30L 1DDXA 1YUFA 4M10A 1NPEB 2Y5HL 1EMOA 2WPME 4LORA 5CKQA 1HX2A 4JYVL 2Y5FL 4CUFA 1FE2A 4ZH8B 2EI8B 3U7UG 4CSYA 3SOVA 1GK5A 5F19A 1IQNL 5JB8E 2I9BA 1WHEA 1B9WA 5L2YL 4D90A 3ZYGA 3NTBA 3ZYIB 3HS6A 3N8ZA 2VH0B 2J38B 3BT1A 1CEJA 1PFXL 2BOKL 4Y6DB 1HCGB 1IOEL 2PUQL 5COXA 4Y7AB 1IQEL 4Y71B 2FLGA 2W26B 5IKVA 2DDUA 2EI6B 3QMOA 3HO3A 1EQHA 2FD6A 4XL1A 3LC3B 3KK6A 1UZPA 1LMMA 1P0SL 1COUA 1WU1B 1LPZA 2Y38A 3TGFA 1EAIC 4BTIA 1UZQA 2BOHA 4O1ZA 4M11A 1IQLL 1APOA 1XKBA 3N8YA 2Y80B 2MGPA 3OLTA 1ZAQA 4Z6AL 2BOUA 1P9JA 5FDQA 4ZAEB 4RRYA 1EPIA 4X8VL 1NT0A 3LN1A 3HS5A 3C9AC 3FCSB 1ATBA 2PR3B 2WPLE 3DEMA 4CUDA 1SZBA 3V64C 2BO2A 4MMZB 4Y7BB 4XBMA 3ENSA 3MDLA 2W3IB 1L5GB 3ASIA 1ATEA 2WG3C 3BPSE 1IQJL 2EI7B 2Y81B 4Z0LA 5IKQA 1I0UA 3KCGL 4TGFA 2WG4B 1IOXA 2UWOB 1CQEA 2WFXB 3LTGD 4AQTA 2D1JB 2ADXA 3PGHA 3Q3KB 4Z0KB 4ZXYL 2J2UB 4NGAL 1CVUA 2Y82B 3LN0A 4Y79B 5JVZA 1W8BL 4YT6L 1HRFA 1JV2B 1IVOC 3KQEL 1AUTL 1LMJA 4OTJA 2B7DL 4C16A 1NFWB 2MHPA 4O02B 4YZUB 1K37A 2NPRA 1F7EA 2XBXL 2W2QE 1J9CL 1MQ5L 3M37L 1JBUL 3CFWA 1TLEA 3KQBL 4BTTA 5JB9E 1HJ7A 4COXA 2P3TA 1O5DL 2Y7ZB 3N8VA 3MQEA 3LIWB 2I9AA 1URKA 2OYUP 4NA9L 1IQFL 2BOXA 2TGFA 1EPJA 2WFTA 3H5CB 4CUEA 1PXXA 3HO4A 2XC0L 1N1IA 2UWPB 2OYEP 3FFGL 3P5BL 2VJ3A 1G2LB 3CS7L 1K36A 2VWNL 4RRWA 3QH0A 3ELAL 2XBYL 3RR3A 1G1SA 1W7XL 4NG9L 2VWLL 3HO5A 1IGXA 3N8XA 4OTYA 1YO8A 4XLWA 1EPHA 1KSNB 1LPKA 1XFEA 1IQKL 3U73A 2KB9A 1IJQA 2P3FN 3S6XA 1EBVA 1TPGA 1ATAA 2Q1JB 3EGFA 4Y76B 4MMXB 1FJSL 2K2TA 5JBAE 3F6UL 2Y5GL 5EGMB 5JW1A 2P93L 3TZIA 3SOBB 4BDWA 1CVWL 3IJEB 1EZQB 3GCWE 1APQA 1NFXB 2KNIA 2JKHL 1UZKA 3KQCL 1JL9A 5L2ZL 5F1AA 1G2MB 1N7DA 1QFKL 3TK6B 1RFNB 1HT5A 3NTGA 2F9BL 1EQGA 1EGFA 1MQ6L 1A3PA 5JBBE 2J95B 2BQWA 1UZJA 3R05A 1LQDA 4JZEL 3QCWA 2CJIB 1U8CB 2WZPP 2W2PE 2VWMK 5IKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X8U L;  1FAX L;  3LC5 B;  4FM5 A;  1PTH A;  3IIT B;  5E8D A;  4YT7 L;  1NFY B;  4BXS A;  2BMG A;  3TBD A;  3FBY A;  5K0H B;  2M74 A;  1IQG L;  2J34 B;  3HS7 A;  3K9X A;  4G1M B;  1IGZ A;  2BZ6 L;  3BT2 A;  5CKM A;  2WYJ B;  3OLU A;  3SOQ A;  2P94 L;  4X8T L;  5JBC E;  2VVC K;  2GD4 A;  1ATD A;  1HT8 A;  1IQI L;  3ZYJ B;  4D0F A;  1YUG A;  4D0E A;  2W2M E;  1KLI L;  4X8S L;  4MMY B;  2PHB B;  3CA7 A;  4RS0 A;  1PGE A;  2W86 A;  1DQB A;  1KLO A;  2BQ7 A;  4ISH L;  3LAQ A;  4BTU A;  4A7I A;  2J94 B;  3N8W B;  1F7M A;  4E1G A;  3KRK A;  2RHP A;  4BDX A;  2KL7 A;  1HAE A;  2XBW L;  1CX2 A;  2WPK E;  1WHF A;  4JZF L;  2VVU L;  1EPG A;  1V3X B;  3HPT A;  2W2O E;  2P3U A;  1YUK B;  2VVV L;  1C5M F;  2FLB L;  3NJP C;  2YGP A;  2RNL A;  1OB1 C;  4RUT A;  1U67 A;  1HAF A;  2K2S B;  2P95 L;  3N8Y B;  2P3F L;  2P28 B;  5IKR A;  3GCX E;  4ZXX L;  3LTF B;  2UWL B;  3M36 L;  4ZHA B;  3POY A;  2P26 A;  3CEN L;  1XKA L;  1Q4G A;  4ISI L;  1F0R B;  1F0S B;  2AYL A;  2VWO L;  4LMF A;  1G1T A;  2YGO A;  5CKN A;  1XDT R;  4PH9 A;  1FFM A;  1EMN A;  1BF9 A;  2W2N E;  1G1R A;  1DVA L;  2FZZ L;  5KIR A;  2WYG B;  2J4I B;  2VH6 B;  2W3K B;  1TOZ A;  1FSB A;  4RRX A;  2XC4 L;  1HRE A;  3GIS X;  3Q7D A;  3KQD L;  1YGC L;  3F1S B;  1X7A L;  2WPI E;  2RA0 L;  1Z6E L;  1M1X B;  1HZ8 A;  2FLR L;  1CCV A;  1NZI A;  3KL6 B;  4JZD L;  5I46 L;  3TK5 B;  1DIY A;  1CCF A;  5JVY A;  1ADX A;  1DX5 I;  2WPJ E;  3TH3 L;  4JYU L;  3NT1 A;  5KN5 C;  1PRH A;  1KLJ L;  4RRZ A;  2BQ6 A;  2P16 L;  3SW2 A;  3V65 B;  2Y7X B;  2G00 L;  2KV4 A;  1FAK L;  2H9E L;  1IP0 A;  2XBV L;  3N8W A;  1NQL B;  1G1Q A;  5CIS A;  1MOX C;  2WPH E;  2XC5 L;  1FF7 A;  1IQM L;  4BXW A;  1L3Y A;  2MGR A;  1LPG A;  1KIG L;  6COX A;  1Z6C A;  1NFU B;  1IQH L;  5L30 L;  1DDX A;  1YUF A;  4M10 A;  1NPE B;  2Y5H L;  1EMO A;  2WPM E;  4LOR A;  5CKQ A;  1HX2 A;  4JYV L;  2Y5F L;  4CUF A;  1FE2 A;  4ZH8 B;  2EI8 B;  3U7U G;  4CSY A;  3SOV A;  1GK5 A;  5F19 A;  1IQN L;  5JB8 E;  2I9B A;  1WHE A;  1B9W A;  5L2Y L;  4D90 A;  3ZYG A;  3NTB A;  3ZYI B;  3HS6 A;  3N8Z A;  2VH0 B;  2J38 B;  3BT1 A;  1CEJ A;  1PFX L;  2BOK L;  4Y6D B;  1HCG B;  1IOE L;  2PUQ L;  5COX A;  4Y7A B;  1IQE L;  4Y71 B;  2FLG A;  2W26 B;  5IKV A;  2DDU A;  2EI6 B;  3QMO A;  3HO3 A;  1EQH A;  2FD6 A;  4XL1 A;  3LC3 B;  3KK6 A;  1UZP A;  1P0S L;  1COU A;  1WU1 B;  1LPZ A;  2Y38 A;  3TGF A;  1EAI C;  4BTI A;  1UZQ A;  2BOH A;  4O1Z A;  4M11 A;  1IQL L;  1APO A;  1XKB A;  3N8Y A;  2Y80 B;  2MGP A;  3OLT A;  1ZAQ A;  4Z6A L;  2BOU A;  1P9J A;  5FDQ A;  4ZAE B;  4RRY A;  1EPI A;  4X8V L;  1NT0 A;  3LN1 A;  3HS5 A;  3C9A C;  3FCS B;  1ATB A;  2PR3 B;  2WPL E;  3DEM A;  4CUD A;  1SZB A;  3V64 C;  2BO2 A;  4MMZ B;  4Y7B B;  4XBM A;  3ENS A;  3MDL A;  2W3I B;  1L5G B;  3ASI A;  1ATE A;  2WG3 C;  3BPS E;  1IQJ L;  2EI7 B;  2Y81 B;  4Z0L A;  5IKQ A;  1I0U A;  3KCG L;  4TGF A;  2WG4 B;  1IOX A;  2UWO B;  1CQE A;  2WFX B;  3LTG D;  4AQT A;  2D1J B;  2ADX A;  3PGH A;  3Q3K B;  4Z0K B;  4ZXY L;  2J2U B;  4NGA L;  1CVU A;  2Y82 B;  3LN0 A;  4Y79 B;  5JVZ A;  1W8B L;  4YT6 L;  1HRF A;  1JV2 B;  1IVO C;  3KQE L;  1AUT L;  1LMJ A;  4OTJ A;  2B7D L;  4C16 A;  1NFW B;  2MHP A;  4O02 B;  4YZU B;  1K37 A;  2NPR A;  1F7E A;  2XBX L;  2W2Q E;  1J9C L;  1MQ5 L;  3M37 L;  1JBU L;  3CFW A;  1TLE A;  3KQB L;  4BTT A;  5JB9 E;  1HJ7 A;  4COX A;  2P3T A;  1O5D L;  2Y7Z B;  3N8V A;  3MQE A;  3LIW B;  2I9A A;  1URK A;  2OYU P;  4NA9 L;  1IQF L;  2BOX A;  2TGF A;  1EPJ A;  2WFT A;  3H5C B;  4CUE A;  1PXX A;  3HO4 A;  2XC0 L;  1N1I A;  2UWP B;  2OYE P;  3FFG L;  3P5B L;  2VJ3 A;  1G2L B;  3CS7 L;  1K36 A;  2VWN L;  4RRW A;  3QH0 A;  3ELA L;  2XBY L;  3RR3 A;  1G1S A;  1W7X L;  4NG9 L;  2VWL L;  3HO5 A;  1IGX A;  3N8X A;  4OTY A;  1YO8 A;  4XLW A;  1EPH A;  1KSN B;  1LPK A;  1XFE A;  1IQK L;  3U73 A;  2KB9 A;  1IJQ A;  2P3F N;  1EBV A;  1TPG A;  1ATA A;  2Q1J B;  3EGF A;  4Y76 B;  4MMX B;  1FJS L;  2K2T A;  5JBA E;  3F6U L;  2Y5G L;  5EGM B;  5JW1 A;  2P93 L;  3TZI A;  3SOB B;  4BDW A;  1CVW L;  3IJE B;  1EZQ B;  3GCW E;  1APQ A;  1NFX B;  2JKH L;  1UZK A;  3KQC L;  1JL9 A;  5L2Z L;  5F1A A;  1G2M B;  1N7D A;  1QFK L;  3TK6 B;  1RFN B;  1HT5 A;  3NTG A;  2F9B L;  1EQG A;  1EGF A;  1MQ6 L;  1A3P A;  5JBB E;  2J95 B;  2BQW A;  1UZJ A;  3R05 A;  1LQD A;  4JZE L;  3QCW A;  2CJI B;  1U8C B;  2W2P E;  2VWM K;  5IKT A; 
#chains in the Genus database with same CATH topology
 4X8U L;  1FAX L;  3LC5 B;  4FM5 A;  1PTH A;  3IIT B;  5E8D A;  4YT7 L;  1NFY B;  4BXS A;  2BMG A;  3TBD A;  3FBY A;  5K0H B;  2M74 A;  1IQG L;  2J34 B;  3HS7 A;  3K9X A;  4G1M B;  1IGZ A;  2BZ6 L;  3BT2 A;  5CKM A;  2HOX A;  2WYJ B;  3OLU A;  3SOQ A;  2P94 L;  2HOR A;  4X8T L;  5JBC E;  2VVC K;  2GD4 A;  1ATD A;  1HT8 A;  1IQI L;  3ZYJ B;  4D0F A;  1YUG A;  4D0E A;  2W2M E;  1KLI L;  4X8S L;  4MMY B;  2PHB B;  3CA7 A;  4RS0 A;  1PGE A;  2W86 A;  1DQB A;  1KLO A;  2BQ7 A;  4ISH L;  1LK9 A;  3LAQ A;  4BTU A;  4A7I A;  2J94 B;  3N8W B;  1F7M A;  4E1G A;  3KRK A;  2RHP A;  4BDX A;  2KL7 A;  1HAE A;  2XBW L;  1CX2 A;  2WPK E;  1WHF A;  4JZF L;  2VVU L;  1EPG A;  1V3X B;  3HPT A;  2W2O E;  2P3U A;  1YUK B;  2VVV L;  1C5M F;  2FLB L;  3NJP C;  2YGP A;  2RNL A;  1OB1 C;  4RUT A;  1U67 A;  1HAF A;  2K2S B;  2P95 L;  3N8Y B;  2P3F L;  2P28 B;  1QIU A;  5IKR A;  3GCX E;  4ZXX L;  3LTF B;  2UWL B;  3M36 L;  4ZHA B;  2BT8 A;  3POY A;  2P26 A;  3CEN L;  1XKA L;  4A94 C;  1Q4G A;  4ISI L;  1F0R B;  1F0S B;  2AYL A;  2VWO L;  4LMF A;  1G1T A;  2YGO A;  5CKN A;  1XDT R;  4PH9 A;  1FFM A;  1EMN A;  1BF9 A;  2W2N E;  1G1R A;  1DVA L;  2FZZ L;  5KIR A;  2WYG B;  2J4I B;  2VH6 B;  2W3K B;  1TOZ A;  1FSB A;  4RRX A;  2XC4 L;  1HRE A;  3GIS X;  3Q7D A;  3KQD L;  1YGC L;  3F1S B;  1X7A L;  2WPI E;  2RA0 L;  1Z6E L;  1M1X B;  1HZ8 A;  2FLR L;  1CCV A;  1NZI A;  3KL6 B;  4JZD L;  5I46 L;  3TK5 B;  1DIY A;  1CCF A;  5JVY A;  2BSF A;  1ADX A;  1DX5 I;  2YGQ A;  2BT7 A;  2WPJ E;  2H9E C;  3TH3 L;  4JYU L;  3NT1 A;  5KN5 C;  1PRH A;  1KLJ L;  4RRZ A;  2BQ6 A;  2P16 L;  3SW2 A;  3V65 B;  2Y7X B;  2G00 L;  2KV4 A;  1FAK L;  2H9E L;  1IP0 A;  2XBV L;  3N8W A;  1NQL B;  1G1Q A;  5CIS A;  1MOX C;  2WPH E;  2XC5 L;  1FF7 A;  1V1H A;  1IQM L;  4BXW A;  1L3Y A;  2MGR A;  1LPG A;  1KIG L;  6COX A;  1Z6C A;  1NFU B;  1IQH L;  5L30 L;  1DDX A;  1YUF A;  4M10 A;  1NPE B;  2Y5H L;  1EMO A;  2WPM E;  4LOR A;  5CKQ A;  1HX2 A;  4JYV L;  2Y5F L;  4CUF A;  1FE2 A;  4ZH8 B;  2EI8 B;  3U7U G;  4CSY A;  3SOV A;  1GK5 A;  5F19 A;  1IQN L;  5JB8 E;  2I9B A;  1WHE A;  1B9W A;  5L2Y L;  4D90 A;  3ZYG A;  3NTB A;  3ZYI B;  3HS6 A;  3N8Z A;  2VH0 B;  2J38 B;  3BT1 A;  1CEJ A;  1PFX L;  2BOK L;  4Y6D B;  1HCG B;  1IOE L;  2PUQ L;  1KKE A;  5COX A;  4Y7A B;  1IQE L;  4Y71 B;  2FLG A;  2W26 B;  5IKV A;  2DDU A;  2EI6 B;  3QMO A;  3HO3 A;  1EQH A;  2FD6 A;  4XL1 A;  3LC3 B;  3KK6 A;  1UZP A;  1LMM A;  4GU3 A;  1P0S L;  1COU A;  1WU1 B;  1LPZ A;  2Y38 A;  3TGF A;  1EAI C;  4BTI A;  1UZQ A;  2BOH A;  4O1Z A;  4M11 A;  1IQL L;  1APO A;  1XKB A;  3N8Y A;  2Y80 B;  2MGP A;  3OLT A;  1ZAQ A;  4Z6A L;  2BOU A;  1P9J A;  5FDQ A;  4ZAE B;  4RRY A;  1EPI A;  4X8V L;  1NT0 A;  3LN1 A;  3HS5 A;  3C9A C;  3FCS B;  1ATB A;  2PR3 B;  2WPL E;  3DEM A;  4CUD A;  1SZB A;  3V64 C;  2BO2 A;  4MMZ B;  4Y7B B;  4XBM A;  3ENS A;  3MDL A;  2W3I B;  1L5G B;  3ASI A;  1ATE A;  2WG3 C;  3BPS E;  1IQJ L;  2EI7 B;  2Y81 B;  4Z0L A;  5IKQ A;  1I0U A;  3KCG L;  4TGF A;  2WG4 B;  1IOX A;  2UWO B;  1CQE A;  2WFX B;  3LTG D;  4AQT A;  2D1J B;  2ADX A;  3PGH A;  3Q3K B;  4Z0K B;  4ZXY L;  1V1I A;  2J2U B;  4NGA L;  1CVU A;  2Y82 B;  3LN0 A;  4Y79 B;  5JVZ A;  1W8B L;  4YT6 L;  1HRF A;  1JV2 B;  1IVO C;  3KQE L;  1AUT L;  1LMJ A;  4OTJ A;  2B7D L;  4C16 A;  1NFW B;  2MHP A;  4O02 B;  4YZU B;  1K37 A;  2NPR A;  1F7E A;  2XBX L;  2W2Q E;  1J9C L;  1MQ5 L;  3M37 L;  1JBU L;  3CFW A;  1TLE A;  3KQB L;  4BTT A;  5JB9 E;  1HJ7 A;  4COX A;  2P3T A;  1O5D L;  2Y7Z B;  3N8V A;  3MQE A;  3LIW B;  4GU4 A;  2I9A A;  1URK A;  2OYU P;  4NA9 L;  1IQF L;  2BOX A;  2TGF A;  1EPJ A;  2WFT A;  3H5C B;  4CUE A;  1PXX A;  3HO4 A;  2XC0 L;  1N1I A;  2UWP B;  2OYE P;  3FFG L;  3P5B L;  2VJ3 A;  1G2L B;  3CS7 L;  1K36 A;  2VWN L;  4RRW A;  3QH0 A;  3ELA L;  2XBY L;  3RR3 A;  1G1S A;  1W7X L;  4NG9 L;  2VWL L;  3HO5 A;  1IGX A;  3N8X A;  4OTY A;  1YO8 A;  4XLW A;  1EPH A;  1KSN B;  1LPK A;  1XFE A;  1IQK L;  3U73 A;  2KB9 A;  1IJQ A;  2P3F N;  3S6X A;  1EBV A;  1TPG A;  1ATA A;  2Q1J B;  3EGF A;  2JJL A;  4Y76 B;  4MMX B;  1FJS L;  2K2T A;  5JBA E;  3F6U L;  2Y5G L;  5EGM B;  5JW1 A;  2P93 L;  3TZI A;  3SOB B;  4BDW A;  1CVW L;  3IJE B;  1EZQ B;  3GCW E;  1APQ A;  1NFX B;  2KNI A;  2JKH L;  1UZK A;  3KQC L;  1JL9 A;  5L2Z L;  5F1A A;  1G2M B;  1N7D A;  1QFK L;  3TK6 B;  1RFN B;  1HT5 A;  3NTG A;  2F9B L;  1EQG A;  1EGF A;  1MQ6 L;  1A3P A;  5JBB E;  2J95 B;  2BQW A;  1UZJ A;  3R05 A;  1LQD A;  4JZE L;  3QCW A;  2CJI B;  1U8C B;  2WZP P;  2W2P E;  2VRS A;  2VWM K;  5IKT A; 
#chains in the Genus database with same CATH homology
 4X8U L;  1FAX L;  3LC5 B;  4FM5 A;  1PTH A;  3IIT B;  5E8D A;  4YT7 L;  1NFY B;  4BXS A;  2BMG A;  3TBD A;  3FBY A;  5K0H B;  2M74 A;  1IQG L;  2J34 B;  3HS7 A;  3K9X A;  4G1M B;  1IGZ A;  2BZ6 L;  3BT2 A;  5CKM A;  2WYJ B;  3OLU A;  3SOQ A;  2P94 L;  4X8T L;  5JBC E;  2VVC K;  2GD4 A;  1ATD A;  1HT8 A;  1IQI L;  3ZYJ B;  4D0F A;  1YUG A;  4D0E A;  2W2M E;  1KLI L;  4X8S L;  4MMY B;  2PHB B;  3CA7 A;  4RS0 A;  1PGE A;  2W86 A;  1DQB A;  1KLO A;  2BQ7 A;  4ISH L;  3LAQ A;  4BTU A;  4A7I A;  2J94 B;  3N8W B;  1F7M A;  4E1G A;  3KRK A;  2RHP A;  4BDX A;  2KL7 A;  1HAE A;  2XBW L;  1CX2 A;  2WPK E;  1WHF A;  4JZF L;  2VVU L;  1EPG A;  1V3X B;  3HPT A;  2W2O E;  2P3U A;  1YUK B;  2VVV L;  1C5M F;  2FLB L;  3NJP C;  2YGP A;  2RNL A;  1OB1 C;  4RUT A;  1U67 A;  1HAF A;  2K2S B;  2P95 L;  3N8Y B;  2P3F L;  2P28 B;  5IKR A;  3GCX E;  4ZXX L;  3LTF B;  2UWL B;  3M36 L;  4ZHA B;  3POY A;  2P26 A;  3CEN L;  1XKA L;  4A94 C;  1Q4G A;  4ISI L;  1F0R B;  1F0S B;  2AYL A;  2VWO L;  4LMF A;  1G1T A;  2YGO A;  5CKN A;  1XDT R;  4PH9 A;  1FFM A;  1EMN A;  1BF9 A;  2W2N E;  1G1R A;  1DVA L;  2FZZ L;  5KIR A;  2WYG B;  2J4I B;  2VH6 B;  2W3K B;  1TOZ A;  1FSB A;  4RRX A;  2XC4 L;  1HRE A;  3GIS X;  3Q7D A;  3KQD L;  1YGC L;  3F1S B;  1X7A L;  2WPI E;  2RA0 L;  1Z6E L;  1M1X B;  1HZ8 A;  2FLR L;  1CCV A;  1NZI A;  3KL6 B;  4JZD L;  5I46 L;  3TK5 B;  1DIY A;  1CCF A;  5JVY A;  1ADX A;  1DX5 I;  2YGQ A;  2WPJ E;  2H9E C;  3TH3 L;  4JYU L;  3NT1 A;  5KN5 C;  1PRH A;  1KLJ L;  4RRZ A;  2BQ6 A;  2P16 L;  3SW2 A;  3V65 B;  2Y7X B;  2G00 L;  2KV4 A;  1FAK L;  2H9E L;  1IP0 A;  2XBV L;  3N8W A;  1NQL B;  1G1Q A;  5CIS A;  1MOX C;  2WPH E;  2XC5 L;  1FF7 A;  1IQM L;  4BXW A;  1L3Y A;  2MGR A;  1LPG A;  1KIG L;  6COX A;  1Z6C A;  1NFU B;  1IQH L;  5L30 L;  1DDX A;  1YUF A;  4M10 A;  1NPE B;  2Y5H L;  1EMO A;  2WPM E;  4LOR A;  5CKQ A;  1HX2 A;  4JYV L;  2Y5F L;  4CUF A;  1FE2 A;  4ZH8 B;  2EI8 B;  3U7U G;  4CSY A;  3SOV A;  1GK5 A;  5F19 A;  1IQN L;  5JB8 E;  2I9B A;  1WHE A;  1B9W A;  5L2Y L;  4D90 A;  3ZYG A;  3NTB A;  3ZYI B;  3HS6 A;  3N8Z A;  2VH0 B;  2J38 B;  3BT1 A;  1CEJ A;  1PFX L;  2BOK L;  4Y6D B;  1HCG B;  1IOE L;  2PUQ L;  5COX A;  4Y7A B;  1IQE L;  4Y71 B;  2FLG A;  2W26 B;  5IKV A;  2DDU A;  2EI6 B;  3QMO A;  3HO3 A;  1EQH A;  2FD6 A;  4XL1 A;  3LC3 B;  3KK6 A;  1UZP A;  1LMM A;  1P0S L;  1COU A;  1WU1 B;  1LPZ A;  2Y38 A;  3TGF A;  1EAI C;  4BTI A;  1UZQ A;  2BOH A;  4O1Z A;  4M11 A;  1IQL L;  1APO A;  1XKB A;  3N8Y A;  2Y80 B;  2MGP A;  3OLT A;  1ZAQ A;  4Z6A L;  2BOU A;  1P9J A;  5FDQ A;  4ZAE B;  4RRY A;  1EPI A;  4X8V L;  1NT0 A;  3LN1 A;  3HS5 A;  3C9A C;  3FCS B;  1ATB A;  2PR3 B;  2WPL E;  3DEM A;  4CUD A;  1SZB A;  3V64 C;  2BO2 A;  4MMZ B;  4Y7B B;  4XBM A;  3ENS A;  3MDL A;  2W3I B;  1L5G B;  3ASI A;  1ATE A;  2WG3 C;  3BPS E;  1IQJ L;  2EI7 B;  2Y81 B;  4Z0L A;  5IKQ A;  1I0U A;  3KCG L;  4TGF A;  2WG4 B;  1IOX A;  2UWO B;  1CQE A;  2WFX B;  3LTG D;  4AQT A;  2D1J B;  2ADX A;  3PGH A;  3Q3K B;  4Z0K B;  4ZXY L;  2J2U B;  4NGA L;  1CVU A;  2Y82 B;  3LN0 A;  4Y79 B;  5JVZ A;  1W8B L;  4YT6 L;  1HRF A;  1JV2 B;  1IVO C;  3KQE L;  1AUT L;  1LMJ A;  4OTJ A;  2B7D L;  4C16 A;  1NFW B;  2MHP A;  4O02 B;  4YZU B;  1K37 A;  2NPR A;  1F7E A;  2XBX L;  2W2Q E;  1J9C L;  1MQ5 L;  3M37 L;  1JBU L;  3CFW A;  1TLE A;  3KQB L;  4BTT A;  5JB9 E;  1HJ7 A;  4COX A;  2P3T A;  1O5D L;  2Y7Z B;  3N8V A;  3MQE A;  3LIW B;  2I9A A;  1URK A;  2OYU P;  4NA9 L;  1IQF L;  2BOX A;  2TGF A;  1EPJ A;  2WFT A;  3H5C B;  4CUE A;  1PXX A;  3HO4 A;  2XC0 L;  1N1I A;  2UWP B;  2OYE P;  3FFG L;  3P5B L;  2VJ3 A;  1G2L B;  3CS7 L;  1K36 A;  2VWN L;  4RRW A;  3QH0 A;  3ELA L;  2XBY L;  3RR3 A;  1G1S A;  1W7X L;  4NG9 L;  2VWL L;  3HO5 A;  1IGX A;  3N8X A;  4OTY A;  1YO8 A;  4XLW A;  1EPH A;  1KSN B;  1LPK A;  1XFE A;  1IQK L;  3U73 A;  2KB9 A;  1IJQ A;  2P3F N;  3S6X A;  1EBV A;  1TPG A;  1ATA A;  2Q1J B;  3EGF A;  4Y76 B;  4MMX B;  1FJS L;  2K2T A;  5JBA E;  3F6U L;  2Y5G L;  5EGM B;  5JW1 A;  2P93 L;  3TZI A;  3SOB B;  4BDW A;  1CVW L;  3IJE B;  1EZQ B;  3GCW E;  1APQ A;  1NFX B;  2KNI A;  2JKH L;  1UZK A;  3KQC L;  1JL9 A;  5L2Z L;  5F1A A;  1G2M B;  1N7D A;  1QFK L;  3TK6 B;  1RFN B;  1HT5 A;  3NTG A;  2F9B L;  1EQG A;  1EGF A;  1MQ6 L;  1A3P A;  5JBB E;  2J95 B;  2BQW A;  1UZJ A;  3R05 A;  1LQD A;  4JZE L;  3QCW A;  2CJI B;  1U8C B;  2WZP P;  2W2P E;  2VWM K;  5IKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...