1IP9A

Solution structure of the pb1 domain of bem1p
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
85
structure length
85
Chain Sequence
GAMGSSTSGLKTTKIKFYYKDDIFALMLKGDTTYKELRSKIAPRIDTDNFKLQTKLFDGSGEEIKTDSQVSNIIQAKLKISVHDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and ligand recognition of the PB1 domain: a novel protein module binding to the PC motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords BEM1 PROTEIN
total genus 10
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2001-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ip9A00
4PYUA 2KDFB 2D3GA 3DVNV 3ZIMA 1K8RB 1PQSA 3CF6E 4EKUA 3C0RB 2ASQA 3EC8A 4E74A 2FCNA 4WJQA 3M95A 1EF5A 5D7GA 5C23A 5DPSA 2LGXA 4HDOA 4DDGD 2KJHB 3HM3A 5JH5C 4AWJA 1WH3A 2AEHA 4GN1A 2R2QA 2KWVB 2D07B 4XX5A 4BVUC 1XQQA 2FNJB 4X57B 3M63B 4EOYA 3TCAA 3PHXB 2OOBB 3VTUA 1E5WA 4WJOA 1JRUA 4W9LA 4BFRA 2KFKA 2K8BA 1H8CA 1UBQA 4OVUA 3V6CB 1H4RA 4JGHB 3ZRFA 2GBJA 3KYCD 1GC7A 4LJPB 3B08A 4LDTD 2DAFA 2DENB 4I6PA 2KQ7A 4ZDVA 2AL6A 4MELA 2DZIA 2JZZA 2KZRA 2MA9B 3VH4B 4IWQA 1WJNA 5AZHA 1XT9B 4HWIB 2N7DA 4HLEA 2LGYA 2QHOA 3O65B 3VAWA 2DZKA 3QX1A 2JXXA 3VTWA 3AU4A 1YX5B 1S3SG 2XEWA 4BKTA 3ML9A 3UF8A 1ZKHA 3H1UA 2RPQA 3QAQA 4A20A 2KQSA 2I1KA 2N1VA 2A5UA 3L08A 3QHTA 2YVCA 4B95A 2LWPA 1Z2MA 2GBNA 4IWPA 5E6NA 1X1MA 5J17A 2MBHA 4GU2A 3WAOA 3VDZA 2ZZPB 4HJKA 1WGYA 5DPWA 5CHFA 3BINA 3ZNZB 1WXVA 2KC2A 4DHJB 2GOWA 1OTRB 2DYBA 2ZNVB 4WWPA 3U8ZA 1M94A 4FHJA 1RLFA 1WXSA 1SIFA 2Z59B 3EHVA 2BYFA 3NHEB 1J0GA 2MQJA 4BOZB 2L76A 2FUHB 3A9KA 4NAWA 2KLGA 2NS5A 3IFWB 2L7RA 3W1YA 3HM6X 2YLMA 2KLCA 1V81A 3A33B 2D10A 4NPNA 2OJRA 5HKHA 3U7DA 5AZFA 1YD8U 2KFKB 3QWZB 3ENEA 2ZVNA 2N9XA 3K9PB 5FR6A 2IO3B 3BY4B 3TMPB 1GUAB 2KFJA 3ALBA 4EZLA 5LXHA 3N3KB 4IM0A 3R7RA 4IUMB 4MGIE 2BKRB 1UH6A 4DHJD 2DZMA 2KMCA 3L17A 5D2MB 2KANA 3DPDA 1FXTB 1V49A 3CSFA 4KZ0A 4I6NB 5DPRA 3RZWC 3VFKA 3ZO5B 2C9WB 1MG8A 1V5TA 4LCDE 4ANVA 3JYUA 3T9LA 4ANUA 1TGZB 3PZDA 4FULA 4TUUA 1E8XA 3AXCA 2J7QB 2KO3A 5DPTA 3DOWA 2BGFA 3PV1A 2CHXA 4KSKC 2JWZA 2DAJA 2CKHB 1OQYA 3VH3B 3V61A 2KTRA 2BYEA 1IP9A 4BBNF 3SU8X 2O2VA 2PEAA 2WX0A 2LASA 4EFOA 2IY1B 3NY5A 4GDKB 2JF5A 3RD2A 1EO6A 2J0KA 2LGDA 3K9OB 2AWTA 3ECIA 4BOSC 1P0RA 1WY8A 2WYQA 2FCMA 2UYZB 1F9JA 1VCBA 4M0WB 2KX0A 3U30A 1U4AA 4DHZE 2K8HA 4HK2A 2KOXA 5G55A 2IYDB 1HE8A 1WXAA 5JHBA 4HVBA 4KIKA 3CMMB 1C3TA 1V9JA 2FIDA 2G4DB 2KHWB 2DYMA 2Y5BB 3MHSD 4GGQA 3APCA 3ZRCA 2KMAA 2LRWA 1UGMA 4PYZA 3VQIA 5EDSA 2C7HA 1NI2A 4FJZA 5E6OA 3PT2B 3V6EB 1WR1A 4E3CA 4HXDA 3DVGY 4A3OA 3R3MA 1WZ3A 1IYFA 1E90A 3A1QB 2KWCA 1GJZA 2MLBA 1BT0A 2N1WA 5CX3A 4FLHA 4EUTA 3H7PB 5CHWA 4F8CB 3TL5A 1QZEA 3ZVVA 2G4SA 2V1YA 3DBLI 3QARA 2B3AA 2NPTB 4PS8A 3ZTCA 4CHKA 4F1SA 1WX8A 2HE7A 1WFYA 2BWFA 2KN5A 2NCNA 1LM8B 1GG3A 3KUZA 2KDEB 4ANXA 2LI5A 1WM3A 3GOEA 4II3B 4RM8A 3VHTC 2ZPYA 3SDLC 4GIVA 2M1MA 3WA0A 4GDLA 2MBBB 3WAMA 4AUQC 2IO0B 4FA6A 2JVCA 2DZJA 1KM7A 2MP2B 3PSEB 4NY0A 5IAAC 3ML8A 2NR2A 4WWOA 1YQBA 2KDIA 4YL8A 4CYEA 4W9EA 2PJHA 3L13A 2G3QB 3PRPB 3SD5A 3ZW3A 3HHMA 5CHVC 4WQOB 2KNBA 4K7SA 2K39A 5LLIA 4PS7A 2CU1A 4GB9A 2ZPNA 4W9IA 4W9JA 2IY0B 4NNJB 2FCQA 5J18A 2D11A 1J8CA 3IG3A 3AULA 3DBSA 1CMXB 3NZUA 2O6VB 2KC1A 1E7VA 4N9F4 2BF8B 1J19A 2VRRB 2N9PC 3WALA 1WGRA 2CHWA 3VVWB 3IBEA 3M62B 4I6LB 4XZ4A 2MX2A 1EF1A 3QA8A 4ICVA 2XK5A 2M0XA 1WJ6A 4HCPB 4FN2A 2IZVB 4IM3A 1Z5SB 2LXAA 1WMHB 1TZ1A 3UINB 2NVUI 1NBFC 3UQAA 3PREA 2K8CA 2EKEC 4PS3A 4ZYNA 2L00B 3ZTDA 3PLUA 2K25A 3LJ3A 1GC6A 1V5OA 2KDBA 2N4FA 1UD7A 3JSVA 3W1SC 4MJSA 4MSMB 2K6QA 1Q1OA 3L10B 4MH0E 4HCNB 4E71A 4JIOU 4DWFA 3L0WB 3N30A 4MGYE 5AZGA 2XBBC 4XC2A 5TR5A 3QQ8B 1RRBA 3ZLZA 2O6VD 1RAXA 2NBWB 4BKSA 2RD0A 1ZW7A 1WI0A 3RT3B 2ZVOA 3A4SC 3JSVB 3OLMD 3PRMB 4IWOA 4BBNC 4KSLC 3DCGA 4W9KA 3R66C 2CR5A 3P2BA 2REXA 3V60A 2LVPA 1C1YB 2KJ6A 4MSQB 1YIWA 3TJPA 2EMTA 4FJVB 4W9GA 2K6DB 3AU5A 3R7QA 1EUVB 2V3SA 2XK5B 4KDIC 2N7EA 3KUCB 3VUWA 5C1ZA 2DHZA 3ZDMC 1WGDA 2D2QA 1R4NI 3APFA 4M8NA 1WRDB 4GMVA 3ZNHB 1I35A 2DYOA 1UELA 3PHWB 4NQKE 1V6EA 1WE6A 2DX5B 2JUOA 4FJYA 4AP4C 4CO7A 1WGGA 5KHQA 1LQBA 3IHPC 2MRPA 4ZRKA 2KTFA 3D32A 3M3JA 3OJ3A 4WJPA 1KLVA 3W1SA 3X23A 3A9JA 1S1QB 3PLVA 2LUEA 5L83A 3QIJA 2LVOA 2MP2A 3A9JB 2C60A 4KZCA 3PVLA 2BYVE 2WX1A 1P1AA 4GDLB 1TBEA 4W9CA 1SGHA 3DBRI 3RYTA 1WXMA 1YJ1A 4DDID 1I42A 1UZXB 2LVQA 3TBLD 4ASWC 2JY6A 2MBEA 4KVGB 3Q3JA 2GBKA 4HPMB 3VXWA 2KJRA 4JL9A 3MJWA 4K7UA 1E8YA 2MBQA 3EECA 3H6NA 4EZKA 3APDA 1GNUA 1WX7A 3PRZA 3OJ4B 4G0NB 4JLCA 2ZCBA 4BKGA 5GMVA 4IC7B 4FBJB 2L0TA 4RMAA 3KUDB 4A3PA 4IG7B 2KD0A 3X0WA 2L0FA 1OGWA 4MGKE 3DQVA 4RM9A 1WJ4A 1LXDA 2W9NA 3RZFA 2R2OA 3UGBB 3H7SA 2NBVB 4K7WA 4W9FA 2EMSA 5D6JB 4WJNA 1V80A 2JRIB 2JZ3B 4KIKB 1UBIA 1E8WA 4DBGA 2ZJDA 2V4LA 5DCNA 2LRUA 4DXAB 3NS8A 2KK8A 1Q5WB 2CHZA 2JPHA 3EFUA 3ZNGC 3UQBA 4IW0A 5D94A 4BKSD 4AOFA 5L95C 1WR6E 4GDKA 4LJOB 3TIXA 3ZNID 4KV2A 4FHKA 1WJUA 3HIZA 1G6JA 4W9HA 3NOBA 3AI5A 2KWUB 4MGZE 3NZSA 4II2B 3LDZE 4ZRIA 1WIAA 3A4RA 2GBRA 3CSTA 4MJSB 2FCSA 3SHQA 2KXJA 2HTHA 4M8MA 4DK5A 4JQWC 1ZGUB 2WDTB 2C5LC 3H9DA 3HK0A 3JW0X 3RULA 3RUIB 4WWNA 2M8SA 3B0AA 1WMHA 4HDQA 3VTVA 1WGHA 3QC8B 1WE7A 4GXBA 3V62A 2Z0EB 2LJ5A 2MCNB 3WIMA 2J0MA 3MTNB 1T0YA 4K1RB 2AL3A 3B1LX 2A4ZA 2IO2B 1WZ0A 2BKFA 4F7ZA 1OEYA 3KVFB 1RFAA 3WANA 2IO1B 2O6VA 2MW5A 4WAAA 1L7YA 3VUXA 5J2RA 2M17A 2AYOB 3DVGX 3GZNI 3KW5B 3UIOB 1D3ZA 2BWES 2I1JA 4NJ6A 5LXIB 5JHAA 4G3XB 3JVZX 2C7MB 3L54A 1KOTA 2MWSB 1V86A 3ZUNA 4B9KA 3N32A 2FIFA 4GSWA 4IM2A 3ZKJC 4ZRJA 1OEYJ 3A9KB 4NAWB 4TV3A 1SE9A 1WX9A 4MEMA 4FADA 4TQ0A 1ISNA 3KH0A 2RSUA 2LD9A 2HD5B 2JT4B 5BO4B 5G2NA 4KDLB 4G11A 5KHOA 1YX6B 3IVFA 4NQLB 2N9EB 4HPLB 2K1FA 3OAWA 1E7UA 3PPAA 4K81A 4URKA 2L8JA 3QCAA 2PPHA 2RR9A 1IPGA 1P98A 4GOCA 3DDCB 1AARA 4AJWA 4LDTB 1LFDA 2RGFA 4EZJA 2NPTA 3T8MA 4EEWA 1NDDA 2L3ZA 1TTNA 3H7PA 2L05A 4MM3A 3Q3FA 4J6IA 3WAPA 3ZDTA 1E8ZA 2Z0DB 5E6PA 3A1QA 3S2AA 5IA7A 3ONSA 2J0JA 4TQ1A 2BPSA 1P3QU 4B6WA 4MDKE 2NBUA 1P9DU 5JZEB 2PE6B 2MBOA 2ZCCA 3DVNU 2CS4A 3PS6A 1WM2A 4OVVA 4TKNA 4ICUA 1WYWB 4ANWA 2WWZA 1VD2A 3PTFC 5CTRC 2LXCA 5AEKB 3DBHI 1L2NA 3QJZA 2G45B 2MSED 4AJYB 2KVRA 4W9DA 2KX3A 1A5RA 2HJ8A 2M4NA 2JRHA 3PGEA 2ZEQA 4P7IA 2PE9A 3L16A 1Y8RC 4NJ7A 4DHZB 3RCZA 3KYDD 1R4MI 1KJTA 4G50A 2UWQA 2LZ6A 2O2VB 2IBIB 2ZNVC 1XD3B 3QK0A 2KTRB 3I3TB 2C7NB 2GMIC 1Q0WB 1WF9A 2FAZA 3VUYA 2KKCA 2GBMA 1V2YA 3UIPB
chains in the Genus database with same CATH superfamily
2D3GA 3DVNV 1K8RB 2ASQA 3EC8A 1MFWA 1NYQA 3U4EG 2JX5A 5JH5C 5IKCM 4GN1A 3BVMA 1I4PA 3OWEB 3RMKC 4QAYA 4EOYA 3TCAA 4J3OD 1E5WA 4WJOA 4AQ7A 1JRUA 1JWUD 4BFRA 4XDDA 3P4RB 2K8BA 4RFBA 1KTKA 1H4RA 2GBJA 3KYCD 4WIPA 3B08A 4YSZB 3EUB2 4ZDVA 5EE0A 4IWQA 1WJNA 4RGTA 2BW2A 5HHDG 1I4XA 2M19A 4BKTA 2K5PA 2RPQA 4OZCA 3AE3B 2G9HD 3L08A 4IWPA 1C79A 1YOVB 4GU2A 3MJ5A 1ROEA 1T6BX 5CHFA 3ZNZB 1WXVA 4XE0A 1ZP0B 4DHJB 1M94A 1XEEA 4N6EB 4IKGA 1WXSA 1OFFA 1SIFA 2Z59B 3EHVA 2BYFA 4MACA 1OQQA 2K22A 2WNMA 3A9KA 4NAWA 2L7RA 2PKOA 5LNK1 2KLCA 1V81A 2J52A 2BS4B 4NPNA 2DNFA 2K3UA 2OJRA 3AEDB 2WS3B 4WH4A 2N9XA 4M01A 3K9PB 3BY4B 1ZXHA 4WURA 1XLNA 3ALBA 4EZLA 3AEBB 1UH6A 4LNOA 2KMCA 2KANA 3DPDA 3VFKA 2W82A 4KZ0A 3NRZA 1J7AA 1D5MC 4OZAA 4ANVA 4ANUA 1IGDA 1E8XA 5DPTA 2KO3A 2WXNA 2BGFA 2CHXA 3VH3B 4RNAA 1IP9A 3SEBA 2WX0A 4EFOA 2LASA 2WXHA 3GB1A 4BOSC 4M0WB 1F9JA 2KX0A 1U4AA 3Q14C 1L5PA 3E56A 4HK2A 2IYDB 4GGQA 1AWDA 2LRWA 3LYYA 3DVGY 3Q2AC 4LNNA 1GJZA 4EUTA 2V9HA 1FFUA 1QZEA 2N9LA 3ZTCA 3TEXA 4II3B 4LLGM 3P1MA 4P1BC 3WAMA 2MP2B 3PSEB 1FRRA 2KAJA 1P7FA 4YL8A 2KT7A 3SFDB 1HQRD 2N7JA 4WAFA 1V1PB 4L23A 2KNBA 5EE1A 3EGRA 3LB8C 4W9IA 2D11A 2CJNA 2PVOD 3AULA 1WYGA 2MJDA 2O6VB 5IO9A 2N9PC 3HVZA 3IBEA 4XZ4A 2MX2A 1EF1A 3QA8A 1ZOYB 1OQRA 3MP9A 3UQAA 1PGBA 5G5HA 2K8CA 2EKEC 3ZTDA 1WWTA 1E7PB 4KX6B 3W1SC 5C3JB 4JPSA 2QILA 2K6QA 1Q1OA 4JIOU 3AE8B 1UGJA 3QQ8B 3VR8B 2OEDA 2RD0A 1ZW7A 2VH2A 3RT3B 2HJ1A 2ZVOA 1YN3A 4DQOC 1J7BA 2BB5A 3P2BA 1GB1A 2N0SB 3V60A 3ZYYX 2BT6A 4W9GA 2K6DB 3R7QA 2V3SA 3BIID 2N7EA 3VUWA 2WU5B 3AV8A 2QMTA 1WRDB 3Q69A 4HEA1 5G5GA 3DBHB 1E0ZA 2KTFA 3D32A 3RFZB 1AN8A 1JW9D 3BYTB 1L0YB 4L1BA 2ONQA 2ZW1A 4OHJA 2PMVA 1I4GA 2MP2A 5FK9C 1C4PA 2WX1A 3URYA 3RYTA 1WXMA 1I42A 1UZXB 4ASWC 4P16A 4KVGB 3Q3JA 2GBKA 4HPMB 4JL9A 4HKQA 2IGDA 3H6NA 4EZKA 3PRZA 2WGSA 4RMAA 2NMQA 1HZ6A 4MGKE 1L4ZB 2JU6X 3UGBB 4K7WA 2EMSA 2W3SA 4KIKB 1UBIA 1K50A 3EFCA 3P4PB 2ZJDA 5DCNA 3AE1B 2CHZA 4MT5A 4BKSD 3W5UB 3AMZA 3ZNID 5JXVA 1WJUA 3Q8CA 2KWUB 4MGZE 4ZRIA 3CSTA 4C7ZA 1T3QA 4MJSB 2HTHA 4ITKA 4JQWC 2WDTB 2M56B 3RUIB 1DOYA 3RNFC 1WMHA 3VTVA 1WGHA 3QC8B 1WE7A 4YTNB 2J0MA 2LHEA 4K1RB 4LNFA 1KH0A 1WZ0A 2BKFA 1PYWD 3KVFB 1MHXA 4LTUA 2IO1B 2MW5A 2M17A 2BWES 2IDYA 2L1AA 2EELA 1F1HA 3NUHB 3AN1A 3L54A 1KOTA 4ARCA 4RGOS 3ZUNA 2WXPA 2WXIA 3N32A 4IM2A 4ZRJA 1EWYC 2KDMA 3A9KB 4NAWB 4TV3A 1NEKB 4TQ0A 1E6EB 1TY2A 1JRPA 4NQLB 4HPLB 3OAWA 4URKA 4YTPB 1P98A 1HXYD 4GOCA 1R4NB 3RPFC 4YWGG 4BZAA 3T8MA 1N5XA 4EEWA 2BS2B 4RGMA 1FNWA 2WXKA 4J6IA 4KGTA 3S2AA 3ONSA 4C00A 1P3QU 2MHJA 1P9DU 3BWUD 2GLSA 1WM2A 3P63A 4ANWA 2LXCA 1L2NA 2PLPA 2UU7A 3PGEA 5BYRA 4DHZB 1VZ6A 3MC8A 4YXDB 3KYDD 4S17A 4PT5A 1HZ5A 2O2VB 2IBIB 2ZNVC 2KTRB 2C7NB 1Q0WB 1ZPSA 2WDQB 4E74A 5D7GA 1D6EC 2LGXA 3RNGC 3P4SB 1WH3A 2AEHA 2KWVB 2D07B 3R2TA 4BVUC 3PHXB 2VZKD 4W9LA 2PTLA 2KFKA 3MFGA 4XWWA 3NVYA 2INPE 2BVCA 2FBWB 2MJEA 3U7ZA 2KQ7A 1QQRA 2JZZA 1VRAB 3Q3OC 1N5WA 3O65B 1DGJA 2KMMA 2BYTA 3VTWA 2WDVB 1S3SG 2XEWA 4R3DA 4NAMA 3H1UA 2KQSA 2I1KA 2BBCA 2BB6A 2YVCA 2LWPA 4B95A 1Z2MA 2GBNA 1X1MA 4YSYB 5J17A 2MBHA 1TIFA 3VDZA 5DPWA 1EWCA 2KC2A 3ZGZA 1OTRB 2DYBA 1FXAA 4WWPA 2IGHA 4P6VF 1I4QA 1J0GA 2MQJA 1FPYA 1XLOA 1SSNA 5AUKA 3HM6X 2YLMA 4K3CA 1MHHE 3PZ8A 1P7EA 2YEPF 1ZUD2 2IO3B 3TMPB 4M00A 1GUAB 3OG5A 3P4QB 2INDC 2HTME 3SFEB 4N58A 3L17A 5DPRA 3CSFA 4I6NB 4LCDE 3JYUA 3T9LA 2AQ2B 3PZDA 3AXCA 3BK2A 2KYWA 2DAJA 1FCLA 2JWUA 2KTRA 2BYEA 2QDFA 2O2VA 1JWBD 3FILA 1C78A 2JF5A 2LGDA 1TKYA 1TS3A 2FCMA 1VCBA 3RN9C 3O13A 3CMMB 4Q2JA 2DYMA 3MHSD 3ZRCA 1M4VA 2C7HA 3W9CB 1NI2A 1B9RA 3PT2B 3AEGB 2LMCA 5BMIA 4F8CB 3DBLI 2V1YA 2ICIA 2B3AA 4F1SA 1WX8A 1WFYA 2I38A 2KN5A 3ZJVA 2NCNA 1LM8B 1GG3A 4ANXA 4RM8A 3VHTC 1VR9A 2ZPYA 3SDLC 4GIVA 3DBLB 3Q3NC 4FA6A 2DZJA 5IAAC 5C2TB 4WWOA 1K53A 1YQBA 2KDIA 3PRPB 4LNIA 3SD5A 3MC9A 3HHMA 4PS7A 2CU1A 4GB9A 3B2GA 5J18A 2LGIA 1D5ZC 3IG3A 4YSXB 1L6VA 1CMXB 3DBSA 3NZUA 5BMGA 3BVZA 4TMAB 2V0GA 3VVWB 4RH6A 4HKZE 3M62B 3VRAB 4I6LB 1TKGA 2FUG1 1NENB 2WQYB 2IZVB 4OZBA 2LXAA 1WGKA 2NVUI 1NBFC 3PREA 4PS3A 2L00B 3PLUA 2J4XA 2KWDA 2KDBA 4BAXA 2LJIA 4US9A 4KKIA 3L10B 4E71A 4HCNB 4DWFA 4HJGE 3N30A 1F2RI 5AZGA 4ZRPA 5TR5A 1RRBA 3ZLZA 1QOBA 3N9YC 3T3NA 1VDVA 2MEKA 1TJEA 4IWOA 3DCGA 2MJ3A 3R66C 2CR5A 2REXA 2QEJC 1C4CA 4HROA 1N60A 1YIWA 3Q8EA 1ET9A 2EMTA 1EUVB 5IP4D 1TS2A 3W2DA 4US8A 2YEPB 1NI3A 3APFA 1F2RC 1UELA 3PHWB 1V6EA 1WE6A 2Y5CA 4CO7A 1WGGA 5KHQA 1JWAD 4USAA 4ZRKA 3BK1A 1UWXA 1KLVA 1V1OA 2LUEA 3QIJA 2GI9A 3DHIC 3A9JB 5AUIA 2BYVE 1P1AA 1C4AA 4GDLB 1IUEA 1YJ1A 2LVQA 1FCCC 1XLQA 2Z8LA 3MJWA 4WQMA 3ZJUA 4A8XC 1IBXB 4REZA 3APDA 1GNUA 2H89B 1WX7A 3AE9B 4BKGA 1TZOA 5GMVA 2L0TA 1V97A 1R7SA 2WXQA 1OGWA 1WJ4A 1LXDA 3RZFA 2AQ1B 3H7SA 2NBVB 1FD6A 4JWUC 2JRIB 2RDBC 1E8WA 4DBGA 1QOFA 1QT9A 2LRUA 1DYQA 2KK8A 4C80A 1QLBB 3ZNGC 3UQBA 3U2SC 3B9JA 1FNUA 1UUPA 3FILB 4KV2A 4FHKA 5FR3A 1G6JA 4W9HA 4C4VB 1T0QC 4II2B 1BXTA 3A4RA 2KXJA 4M8MA 1D5XC 4DXFA 5TSSA 2C5LC 3H9DA 3B0AA 1T5XD 3V62A 2LJ5A 1K51A 3AE2B 3MTNB 1N63A 2IO2B 3AE7B 4DXGA 4M02A 4WAAA 1L7YA 5J2RA 3KW5B 3DVGX 3GZNI 3UIOB 1CJEA 2I1JA 5LXIB 3SR6A 4HRSA 3JVZX 3CWIA 1JCKB 2KN4A 4GSWA 4TSSA 5BYQA 1SE9A 1WX9A 5EE9A 1ISNA 2X38A 2RSUA 2HD5B 5KHOA 1YX6B 2OJWA 2N9EB 3PPAA 4K81A 1XLPA 3N1YC 2L8JA 3QCAA 2PPHA 2RR9A 1AARA 2DLBA 3FKYA 1YQ4B 1NDDA 2L3ZA 2KQ4X 1VJKA 2Z0DB 5IA7A 3A1QA 2BPSA 4MDKE 1JROA 1NVID 4HPPA 1C76A 2MBOA 2ZCCA 3DVNU 2CS4A 3PS6A 4OVVA 1WYWB 2IGGA 2WWZA 3I5JC 2G1EA 1SBBB 2MSED 3Q6BA 3QJZA 4AJYB 2KVRA 2HJ8A 4NJ7A 5D3IB 1KJTA 4G50A 3L4PA 1CQVA 2FAZA 2KKCA 1V2YA 3UIPB 1GB4A 2KDFB 3ZIMA 2D3AA 2E6XA 1PQSA 3KWVA 2V4IB 4EKUA 4B0MA 2FCNA 4WJQA 3KQ4A 1EF5A 5C23A 5DPSA 3AECB 1XCTL 3HVDA 2R2QA 2JYTA 2W55A 4LNKA 4XX5A 1QF6A 2ZW0A 2OOBB 2TSSA 1UBQA 4OVUA 3V6CB 1RWSA 1F52A 1GC7A 2R61A 3Q8BA 4LDTD 3N1XC 2DENB 2AL6A 1UF0A 4MELA 3UI3A 1SF0A 2KZRA 2MA9B 1TS4A 2LEKA 4HWIB 2N7DA 4HLEA 2QHOA 1MI0A 3VAWA 3GZNB 3AU4A 1I4RA 1YX5B 3ML9A 3UF8A 3QAQA 4A20A 4MM3B 2N1VA 2A5UA 1FXIA 2LFIA 5E6NA 1KRHA 2ZZPB 3BINA 2GOWA 3U8ZA 3DWGC 4FHJA 2V3NA 4BOZB 2FUHB 3IFWB 2BS3B 2AX5A 3A33B 2D10A 2SEBD 3U7DA 1ZDVA 4K3BA 5HG2A 2ZVNA 5FR6A 1Q10A 2K0PA 5LXHA 4IM0A 4IUMB 4MGIE 2BKRB 5E6JA 2DZMA 1JQ4A 5D2MB 3RZWC 3ZO5B 5H92C 3TEZA 3ZXRA 1VLBA 4FULA 4TUUA 2J7QB 2Y5PA 3E9SA 3DOWA 4C56C 2CKHB 3WCQA 3V61A 3W5VB 4BBNF 3N20C 4KKJA 2WDRB 3RD2A 1EO6A 2J0KA 3K9OB 2AWTA 4L2YA 2LGSA 2WYQA 3U30A 4DHZE 2K8HA 1HE8A 1WXAA 4KIKA 3I63C 1C3TA 1V9JA 2KHWB 2Y5BB 3APCA 5EDSA 4PYZA 1UGMA 1FO4A 3NS1A 4FJZA 3MHZA 3V6EB 1WR1A 4A3OA 3R3MA 1TT5B 1IYFA 3A1QB 2N1WA 2E3TA 3KWLA 5CHWA 3QARA 2G4SA 2HE7A 2AQ3B 2KDEB 1ET6A 2PVGC 1WM3A 4UDUC 2M1MA 1QILA 3TSSA 2IO0B 1KLUD 3ML8A 4CYEA 3ZW3A 4XWTA 2QJLA 5CHVC 4ZYSA 1T0RC 5LLIA 4W9JA 2IY0B 1L4DB 2KC1A 2VRRB 3BVGA 3WALA 2CHWA 3IAS1 3V3XA 4ICVA 3ABVB 1XO3A 2XK5A 4CQNA 3TEYA 4A9AA 1TZ1A 3AM9A 3UINB 3AH7A 4WWMA 1DOIA 2K25A 1GC6A 1V5OA 3JSVA 4MSMB 3L0WB 4C4VA 4MGYE 4XC2A 3EA6A 4A55A 3PO0A 1F0ZA 2K9XA 3DWMA 1GAQB 1VZ7A 3OLMD 4BBNC 3JSVB 3PRMB 4KSLC 1AYFA 4S0RA 4KGSA 4ZHOA 3TJPA 1J7CA 4KDIC 2WXLA 2XK5B 5C1ZA 2DHZA 3ZDMC 1R4NI 4GMVA 1JWSD 3Q8AA 3ZNHB 1IBXA 2MH7A 4NQKE 2DX5B 2JUOA 4FJYA 1KLGD 2XN9C 1I4HA 1V8CA 2JSVX 3M3JA 3OJ3A 4WJPA 4FXCA 3W1SA 3X23A 3A9JA 5IN7A 1SE3A 3BYYB 2LVOA 2C60A 4KZCA 1FEHA 1TBEA 1SGHA 2J42A 2INCC 1B1ZA 3TBLD 1JWMD 3AE6B 3VXWA 1MG4A 4EE2A 1E10A 3EECA 3ZQ4A 3OJ4B 4JLCA 4FBJB 3NVZA 3Q3MC 4A3PA 4IG7B 2BQQA 2L0FA 1I7HA 3DQVA 4AS1A 2W9NA 3GE3C 3N1ZC 1V80A 2JZ3B 2GRIA 5HFYA 1YJIA 2VZKB 2JPHA 4IW0A 5D94A 4AOFA 1XF5L 1C9FA 4LJOB 2LHDA 2RPVA 4B0EA 3HIZA 3NOBA 3LDZE 1XXGA 2GBRA 3SHQA 1CK1A 2D3BA 3DHGC 3HK0A 1N61A 3RULA 1SE2A 4WWNA 5H8YE 1AW7A 4GXBA 3IXSA 4ZHPA 1BUIC 3NVVA 2WP9B 2AL3A 2A4ZA 4F7ZA 1FFVA 1RFAA 3WANA 1LGRA 3VUXA 2AYOB 1JMLA 4NJ6A 5JHAA 4G3XB 2MWSB 1E9MA 1V86A 4B9KA 1T0SC 2FIFA 3ZKJC 4MEMA 2LD9A 2JT4B 5G2NA 1E7UA 3AE5B 3VR9B 1FIQA 4LDTB 1LO5D 2NPTA 3GE8C 1TTNA 3H7PA 4MM3A 3WAPA 1E8ZA 5E6PA 5BMHA 2J0JA 4TQ1A 1EM7A 3R8BA 1ENFA 2NBUA 3AB5A 5JZEB 2LUMA 4ICUA 1VD2A 5AEKB 3DHHC 5I4DA 2G45B 4W9DA 2M4NA 2JRHA 2ZEQA 1WRIA 2PE9A 1SJHD 3RCZA 1R4MI 1R4MB 3IT6B 4MH8A 4RF1A 1XD3B 1FM0D 3QK0A 3I3TB 4PK1A 2CJOA 2GMIC 1WF9A 3VUYA 3ZJTA 3GP7A 1PFDA 2GBMA 4PYUA 3CF6E 3J9CA 3C0RB 1L0VB 1RFKA 3M95A 4HDOA 1SXTA 2PW9A 2WXMA 4JWSC 2KJHB 3HM3A 1UWMA 4AWJA 4DDGD 4NZLB 1IGCA 1XQQA 2FNJB 4X57B 2QCZA 3M63B 1FNVA 3TUOA 3VTUA 3PZ7A 3KLSX 1N62A 1H8CA 4JGHB 2OHFA 3ZRFA 4LJPB 3NG0A 2DAFA 4I6PA 3FC4A 3AEFB 1YQ3B 2DZIA 3VH4B 1YN4A 3CIRB 1XT9B 5AZHA 5HI1A 2LGYA 3GS2A 2W54A 2DZKA 3QX1A 2JXXA 1ZKHA 3QHTA 3IAM1 3WAOA 3HUIA 3T3OA 4HJKA 1WGYA 4XDCA 1JALA 2ZNVB 1YJJA 1BMLC 3FAHA 1RLFA 3NHEB 2L76A 4C7YA 1SJED 2KLGA 2NS5A 3AEEB 3W1YA 1QKZA 1MJDA 2WXFA 2JZPA 1DOXA 3BZDB 5HKHA 1XCQL 5AZFA 1YD8U 2ACZB 2KFKB 3QWZB 3ENEA 3TEWA 2B76B 2KFJA 2H88B 1NYRA 2L52A 2QC8A 1PGAA 5MPOA 3N3KB 3R7RA 4DHJD 4O1NA 1FXTB 1V49A 1HEZE 1KF6B 2C9WB 1MG8A 1V5TA 3RNBC 1TGZB 2WHIA 4H2AA 3C19A 3PV1A 4KSKC 2JWZA 4OW0A 4OVZA 1OQYA 1WSPA 3MC0B 3SU8X 2PEAA 2IY1B 3NY5A 4GDKB 2QIEB 3ECIA 1P0RA 1WY8A 2UYZB 1C77A 1FRDA 2KOXA 5G55A 1ACCA 5JHBA 2KACA 4HVBA 2FIDA 2G4DB 2SAKA 2IPKD 3ETRA 1ESFA 2KMAA 3VQIA 5E6OA 3B2FA 4E3CA 4HXDA 5FKAC 1WZ3A 1E90A 2KWCA 1ZDXA 2MLBA 1BT0A 3ZXVA 5CX3A 4FLHA 3H7PB 3TL5A 3ZVVA 4CHKA 2NPTB 2INNE 4PS8A 1YMHE 2BWFA 2WXGA 2QSDA 3R2IA 3I9V1 3KUZA 1ZXIA 2LI5A 1SIJA 2DWQA 2JQRB 3GOEA 2RDHA 3WA0A 4GDLA 2MBBB 4AUQC 1K52A 2JVCA 1KM7A 2I2YA 4NY0A 2NR2A 4W9EA 2PJHA 2RMMA 3L13A 2G3QB 4WQOB 1SEBD 1MPEA 4K7SA 2K39A 1PUTA 2ZPNA 4NNJB 2FCQA 1J8CA 2L83A 1RYJA 1HTOA 4N9F4 1E7VA 4D2KA 2BF8B 1J19A 1WGRA 1HTQA 1KFYB 2M0XA 1WJ6A 4HCPB 4FN2A 4A90A 4IM3A 1Z5SB 1WMHB 2GB1A 3AEAB 4ZYNA 3C8YA 4RCOA 2N4FA 2FE8A 3LJ3A 1UD7A 4IDIA 4MJSA 4YTMB 4MH0E 3HRDD 1N6ZA 2XBBC 4IOIE 4RGNA 1CZPA 2O6VD 1RAXA 2NBWB 4BKSA 1WI0A 3A4SC 1FMAD 1TYGB 4W9KA 1YNTE 2RDGA 2LVPA 1C1YB 3DBRB 1L0XB 2KJ6A 4MSQB 4FJVB 3AU5A 4NJCA 2X8XX 1QOGA 4LK0M 3KUCB 4ZRQA 1HA5A 1WGDA 2D2QA 4P1CC 4M8NA 1I35A 2DYOA 1WXQA 2CU3A 4AP4C 2EKIA 1LQBA 3IHPC 2MRPA 3V05A 2NTTA 1S1QB 2HDEA 1D4BA 3PLVA 5L83A 1SE4A 2L32A 3PVLA 1TKEA 2J53A 2Y3AA 4W9CA 3DBRI 4ZOHC 4DDID 2JY6A 2MBEA 3P42A 2KJRA 4K7UA 1E8YA 2MBQA 3VRBB 2D3CA 2ON8A 5D3DA 4G0NB 2ZCBA 4IC7B 3H8HA 3KUDB 2KD0A 3X0WA 4XGAB 4RM9A 2R2OA 4W9FA 5D6JB 4WJNA 4YT0B 1YN5A 1UNSA 3U52E 5EE3A 1STEA 2V4LA 1A70A 4DXAB 3NS8A 1Q5WB 3EFUA 1TS5A 2VH1A 1EU3A 5L95C 1WR6E 4GDKA 3IT4B 2W3RA 4A6QA 3TIXA 4JE3B 3AI5A 1L6UA 3NZSA 1WIAA 2M0AA 2FCSA 1PDXA 4DK5A 1ZGUB 3JW0X 2M8SA 4HDQA 2WXRA 1SB3C 4KGRA 2Z0EB 4ARIA 2MCNB 3WIMA 4ACFA 1T0YA 3B1LX 1OEYA 4GLSC 2O6VA 2Q5WD 4JX1C 1D3ZA 3RNCC 2C7MB 2V3PA 2BTEA 2JYEA 1QOAA 1F77A 1V1PA 2WXJA 1OEYJ 4RF0A 2WXOA 4FADA 3KH0A 3I57A 5BO4B 4KDLB 4G11A 3IVFA 2DBYA 2K1FA 2KVZA 2XNAC 1IPGA 3DDCB 4XYCA 4AJWA 1LFDA 2RGFA 4EZJA 2NTSA 3NZ3A 5IOIA 2L05A 2JXTA 3AE4B 3Q3FA 3ZDTA 5GXGB 2D5GA 1GOZA 3RNEC 5BYSA 2N9KA 1EU4A 4B6WA 3LXFA 2PE6B 3Q8FA 4TKNA 1MVKA 3PTFC 5CTRC 3DBHI 5T8IA 1A5RA 2KX3A 1TY0A 4M0WA 4P7IA 1Y56A 3RNAC 3L16A 1PGXA 1Y8RC 2PIAA 2WLBA 2WU2B 3NVWA 2UWQA 2LZ6A 4N59A 1ZE3D 1GPXA 1RM6C 3NJTA 2IJ0A 1VZ8A 3RI7C
chains in the Genus database with same CATH topology
4PYUA 2KDFB 2D3GA 3DVNV 3ZIMA 1K8RB 1PQSA 3CF6E 4EKUA 3C0RB 2ASQA 3EC8A 4E74A 2FCNA 4WJQA 3M95A 1EF5A 5D7GA 5C23A 5DPSA 2LGXA 4HDOA 4DDGD 2KJHB 3HM3A 5JH5C 4AWJA 1WH3A 2AEHA 4GN1A 2R2QA 2KWVB 2D07B 4XX5A 4BVUC 1XQQA 2FNJB 4X57B 3M63B 4EOYA 3TCAA 3PHXB 2OOBB 3VTUA 1E5WA 4WJOA 1JRUA 4W9LA 4BFRA 2KFKA 2K8BA 1H8CA 1UBQA 4OVUA 3V6CB 1H4RA 4JGHB 3ZRFA 2GBJA 3KYCD 1GC7A 4LJPB 3B08A 4LDTD 2DAFA 2DENB 4I6PA 2KQ7A 4ZDVA 2AL6A 4MELA 2DZIA 2JZZA 2KZRA 2MA9B 3VH4B 4IWQA 1WJNA 5AZHA 1XT9B 4HWIB 2N7DA 4HLEA 2LGYA 2QHOA 3O65B 3VAWA 2DZKA 3QX1A 2JXXA 3VTWA 3AU4A 1YX5B 1S3SG 2XEWA 4BKTA 3ML9A 3UF8A 1ZKHA 3H1UA 2RPQA 3QAQA 4A20A 2KQSA 2I1KA 2N1VA 2A5UA 3L08A 3QHTA 2YVCA 4B95A 2LWPA 1Z2MA 2GBNA 4IWPA 5E6NA 1X1MA 5J17A 2MBHA 4GU2A 3WAOA 3VDZA 2ZZPB 4HJKA 1WGYA 5DPWA 5CHFA 3BINA 3ZNZB 1WXVA 2KC2A 4DHJB 2GOWA 1OTRB 2DYBA 2ZNVB 4WWPA 3U8ZA 1M94A 4FHJA 1RLFA 1WXSA 1SIFA 2Z59B 3EHVA 2BYFA 3NHEB 1J0GA 2MQJA 4BOZB 2L76A 2FUHB 3A9KA 4NAWA 2KLGA 2NS5A 3IFWB 2L7RA 3W1YA 3HM6X 2YLMA 2KLCA 1V81A 3A33B 2D10A 4NPNA 2OJRA 5HKHA 3U7DA 5AZFA 1YD8U 2KFKB 3QWZB 3ENEA 2ZVNA 2N9XA 3K9PB 5FR6A 2IO3B 3BY4B 3TMPB 1GUAB 2KFJA 3ALBA 4EZLA 5LXHA 3N3KB 4IM0A 3R7RA 4IUMB 4MGIE 2BKRB 1UH6A 4DHJD 2DZMA 2KMCA 3L17A 5D2MB 2KANA 3DPDA 1FXTB 1V49A 3CSFA 4KZ0A 4I6NB 5DPRA 3RZWC 3VFKA 3ZO5B 2C9WB 1MG8A 1V5TA 4LCDE 4ANVA 3JYUA 3T9LA 4ANUA 1TGZB 3PZDA 4FULA 4TUUA 1E8XA 3AXCA 2J7QB 2KO3A 5DPTA 3DOWA 2BGFA 3PV1A 2CHXA 4KSKC 2JWZA 2DAJA 2CKHB 1OQYA 3VH3B 3V61A 2KTRA 2BYEA 1IP9A 4BBNF 3SU8X 2O2VA 2PEAA 2WX0A 2LASA 4EFOA 2IY1B 3NY5A 4GDKB 2JF5A 3RD2A 1EO6A 2J0KA 2LGDA 3K9OB 2AWTA 3ECIA 4BOSC 1P0RA 1WY8A 2WYQA 2FCMA 2UYZB 1F9JA 1VCBA 4M0WB 2KX0A 3U30A 1U4AA 4DHZE 2K8HA 4HK2A 2KOXA 5G55A 2IYDB 1HE8A 1WXAA 5JHBA 4HVBA 4KIKA 3CMMB 1C3TA 1V9JA 2FIDA 2G4DB 2KHWB 2DYMA 2Y5BB 3MHSD 4GGQA 3APCA 3ZRCA 2KMAA 2LRWA 1UGMA 4PYZA 3VQIA 5EDSA 2C7HA 1NI2A 4FJZA 5E6OA 3PT2B 3V6EB 1WR1A 4E3CA 4HXDA 3DVGY 4A3OA 3R3MA 1WZ3A 1IYFA 1E90A 3A1QB 2KWCA 1GJZA 2MLBA 1BT0A 2N1WA 5CX3A 4FLHA 4EUTA 3H7PB 5CHWA 4F8CB 3TL5A 1QZEA 3ZVVA 2G4SA 2V1YA 3DBLI 3QARA 2B3AA 2NPTB 4PS8A 3ZTCA 4CHKA 4F1SA 1WX8A 2HE7A 1WFYA 2BWFA 2KN5A 2NCNA 1LM8B 1GG3A 3KUZA 2KDEB 4ANXA 2LI5A 1WM3A 3GOEA 4II3B 4RM8A 3VHTC 2ZPYA 3SDLC 4GIVA 2M1MA 3WA0A 4GDLA 2MBBB 3WAMA 4AUQC 2IO0B 4FA6A 2JVCA 2DZJA 1KM7A 2MP2B 3PSEB 4NY0A 5IAAC 3ML8A 2NR2A 4WWOA 1YQBA 2KDIA 4YL8A 4CYEA 4W9EA 2PJHA 3L13A 2G3QB 3PRPB 3SD5A 3ZW3A 3HHMA 5CHVC 4WQOB 2KNBA 4K7SA 2K39A 5LLIA 4PS7A 2CU1A 4GB9A 2ZPNA 4W9IA 4W9JA 2IY0B 4NNJB 2FCQA 5J18A 2D11A 1J8CA 3IG3A 3AULA 3DBSA 1CMXB 3NZUA 2O6VB 2KC1A 1E7VA 4N9F4 2BF8B 1J19A 2VRRB 2N9PC 3WALA 1WGRA 2CHWA 3VVWB 3IBEA 3M62B 4I6LB 4XZ4A 2MX2A 1EF1A 3QA8A 4ICVA 2XK5A 2M0XA 1WJ6A 4HCPB 4FN2A 2IZVB 4IM3A 1Z5SB 2LXAA 1WMHB 1TZ1A 3UINB 2NVUI 1NBFC 3UQAA 3PREA 2K8CA 2EKEC 4PS3A 4ZYNA 2L00B 3ZTDA 3PLUA 2K25A 3LJ3A 1GC6A 1V5OA 2KDBA 2N4FA 1UD7A 3JSVA 3W1SC 4MJSA 4MSMB 2K6QA 1Q1OA 3L10B 4MH0E 4HCNB 4E71A 4JIOU 4DWFA 3L0WB 3N30A 4MGYE 5AZGA 2XBBC 4XC2A 5TR5A 3QQ8B 1RRBA 3ZLZA 2O6VD 1RAXA 2NBWB 4BKSA 2RD0A 1ZW7A 1WI0A 3RT3B 2ZVOA 3A4SC 3JSVB 3OLMD 3PRMB 4IWOA 4BBNC 4KSLC 3DCGA 4W9KA 3R66C 2CR5A 3P2BA 2REXA 3V60A 2LVPA 1C1YB 2KJ6A 4MSQB 1YIWA 3TJPA 2EMTA 4FJVB 4W9GA 2K6DB 3AU5A 3R7QA 1EUVB 2V3SA 2XK5B 4KDIC 2N7EA 3KUCB 3VUWA 5C1ZA 2DHZA 3ZDMC 1WGDA 2D2QA 1R4NI 3APFA 4M8NA 1WRDB 4GMVA 3ZNHB 1I35A 2DYOA 1UELA 3PHWB 4NQKE 1V6EA 1WE6A 2DX5B 2JUOA 4FJYA 4AP4C 4CO7A 1WGGA 5KHQA 1LQBA 3IHPC 2MRPA 4ZRKA 2KTFA 3D32A 3M3JA 3OJ3A 4WJPA 1KLVA 3W1SA 3X23A 3A9JA 1S1QB 3PLVA 2LUEA 5L83A 3QIJA 2LVOA 2MP2A 3A9JB 2C60A 4KZCA 3PVLA 2BYVE 2WX1A 1P1AA 4GDLB 1TBEA 4W9CA 1SGHA 3DBRI 3RYTA 1WXMA 1YJ1A 4DDID 1I42A 1UZXB 2LVQA 3TBLD 4ASWC 2JY6A 2MBEA 4KVGB 3Q3JA 2GBKA 4HPMB 3VXWA 2KJRA 4JL9A 3MJWA 4K7UA 1E8YA 2MBQA 3EECA 3H6NA 4EZKA 3APDA 1GNUA 1WX7A 3PRZA 3OJ4B 4G0NB 4JLCA 2ZCBA 4BKGA 5GMVA 4IC7B 4FBJB 2L0TA 4RMAA 3KUDB 4A3PA 4IG7B 2KD0A 3X0WA 2L0FA 1OGWA 4MGKE 3DQVA 4RM9A 1WJ4A 1LXDA 2W9NA 3RZFA 2R2OA 3UGBB 3H7SA 2NBVB 4K7WA 4W9FA 2EMSA 5D6JB 4WJNA 1V80A 2JRIB 2JZ3B 4KIKB 1UBIA 1E8WA 4DBGA 2ZJDA 2V4LA 5DCNA 2LRUA 4DXAB 3NS8A 2KK8A 1Q5WB 2CHZA 2JPHA 3EFUA 3ZNGC 3UQBA 4IW0A 5D94A 4BKSD 4AOFA 5L95C 1WR6E 4GDKA 4LJOB 3TIXA 3ZNID 4KV2A 4FHKA 1WJUA 3HIZA 1G6JA 4W9HA 3NOBA 3AI5A 2KWUB 4MGZE 3NZSA 4II2B 3LDZE 4ZRIA 1WIAA 3A4RA 2GBRA 3CSTA 4MJSB 2FCSA 3SHQA 2KXJA 2HTHA 4M8MA 4DK5A 4JQWC 1ZGUB 2WDTB 2C5LC 3H9DA 3HK0A 3JW0X 3RULA 3RUIB 4WWNA 2M8SA 3B0AA 1WMHA 4HDQA 3VTVA 1WGHA 3QC8B 1WE7A 4GXBA 3V62A 2Z0EB 2LJ5A 2MCNB 3WIMA 2J0MA 3MTNB 1T0YA 4K1RB 2AL3A 3B1LX 2A4ZA 2IO2B 1WZ0A 2BKFA 4F7ZA 1OEYA 3KVFB 1RFAA 3WANA 2IO1B 2O6VA 2MW5A 4WAAA 1L7YA 3VUXA 5J2RA 2M17A 2AYOB 3DVGX 3GZNI 3KW5B 3UIOB 1D3ZA 2BWES 2I1JA 4NJ6A 5LXIB 5JHAA 4G3XB 3JVZX 2C7MB 3L54A 1KOTA 2MWSB 1V86A 3ZUNA 4B9KA 3N32A 2FIFA 4GSWA 4IM2A 3ZKJC 4ZRJA 1OEYJ 3A9KB 4NAWB 4TV3A 1SE9A 1WX9A 4MEMA 4FADA 4TQ0A 1ISNA 3KH0A 2RSUA 2LD9A 2HD5B 2JT4B 5BO4B 5G2NA 4KDLB 4G11A 5KHOA 1YX6B 3IVFA 4NQLB 2N9EB 4HPLB 2K1FA 3OAWA 1E7UA 3PPAA 4K81A 4URKA 2L8JA 3QCAA 2PPHA 2RR9A 1IPGA 1P98A 4GOCA 3DDCB 1AARA 4AJWA 4LDTB 1LFDA 2RGFA 4EZJA 2NPTA 3T8MA 4EEWA 1NDDA 2L3ZA 1TTNA 3H7PA 2L05A 4MM3A 3Q3FA 4J6IA 3WAPA 3ZDTA 1E8ZA 2Z0DB 5E6PA 3A1QA 3S2AA 5IA7A 3ONSA 2J0JA 4TQ1A 2BPSA 1P3QU 4B6WA 4MDKE 2NBUA 1P9DU 5JZEB 2PE6B 2MBOA 2ZCCA 3DVNU 2CS4A 3PS6A 1WM2A 4OVVA 4TKNA 4ICUA 1WYWB 4ANWA 2WWZA 1VD2A 3PTFC 5CTRC 2LXCA 5AEKB 3DBHI 1L2NA 3QJZA 2G45B 2MSED 4AJYB 2KVRA 4W9DA 2KX3A 1A5RA 2HJ8A 2M4NA 2JRHA 3PGEA 2ZEQA 4P7IA 2PE9A 3L16A 1Y8RC 4NJ7A 4DHZB 3RCZA 3KYDD 1R4MI 1KJTA 4G50A 2UWQA 2LZ6A 2O2VB 2IBIB 2ZNVC 1XD3B 3QK0A 2KTRB 3I3TB 2C7NB 2GMIC 1Q0WB 1WF9A 2FAZA 3VUYA 2KKCA 2GBMA 1V2YA 3UIPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PYU A;  2KDF B;  2D3G A;  3DVN V;  3ZIM A;  1K8R B;  1PQS A;  3CF6 E;  4EKU A;  3C0R B;  2ASQ A;  3EC8 A;  4E74 A;  2FCN A;  4WJQ A;  3M95 A;  1EF5 A;  5D7G A;  5C23 A;  5DPS A;  2LGX A;  4HDO A;  4DDG D;  2KJH B;  3HM3 A;  5JH5 C;  4AWJ A;  1WH3 A;  2AEH A;  4GN1 A;  2R2Q A;  2KWV B;  2D07 B;  4XX5 A;  4BVU C;  1XQQ A;  2FNJ B;  4X57 B;  3M63 B;  4EOY A;  3TCA A;  3PHX B;  2OOB B;  3VTU A;  1E5W A;  4WJO A;  1JRU A;  4W9L A;  4BFR A;  2KFK A;  2K8B A;  1H8C A;  1UBQ A;  4OVU A;  3V6C B;  1H4R A;  4JGH B;  3ZRF A;  2GBJ A;  3KYC D;  1GC7 A;  4LJP B;  3B08 A;  4LDT D;  2DAF A;  2DEN B;  4I6P A;  2KQ7 A;  4ZDV A;  2AL6 A;  4MEL A;  2DZI A;  2JZZ A;  2KZR A;  2MA9 B;  3VH4 B;  4IWQ A;  1WJN A;  5AZH A;  1XT9 B;  4HWI B;  2N7D A;  4HLE A;  2LGY A;  2QHO A;  3O65 B;  3VAW A;  2DZK A;  3QX1 A;  2JXX A;  3VTW A;  3AU4 A;  1YX5 B;  1S3S G;  2XEW A;  4BKT A;  3ML9 A;  3UF8 A;  1ZKH A;  3H1U A;  2RPQ A;  3QAQ A;  4A20 A;  2KQS A;  2I1K A;  2N1V A;  2A5U A;  3L08 A;  3QHT A;  2YVC A;  4B95 A;  2LWP A;  1Z2M A;  2GBN A;  4IWP A;  5E6N A;  1X1M A;  5J17 A;  2MBH A;  4GU2 A;  3WAO A;  3VDZ A;  2ZZP B;  4HJK A;  1WGY A;  5DPW A;  5CHF A;  3BIN A;  3ZNZ B;  1WXV A;  2KC2 A;  4DHJ B;  2GOW A;  1OTR B;  2DYB A;  2ZNV B;  4WWP A;  3U8Z A;  1M94 A;  4FHJ A;  1RLF A;  1WXS A;  1SIF A;  2Z59 B;  3EHV A;  2BYF A;  3NHE B;  1J0G A;  2MQJ A;  4BOZ B;  2L76 A;  2FUH B;  3A9K A;  4NAW A;  2KLG A;  2NS5 A;  3IFW B;  2L7R A;  3W1Y A;  3HM6 X;  2YLM A;  2KLC A;  1V81 A;  3A33 B;  2D10 A;  4NPN A;  2OJR A;  5HKH A;  3U7D A;  5AZF A;  1YD8 U;  2KFK B;  3QWZ B;  3ENE A;  2ZVN A;  2N9X A;  3K9P B;  5FR6 A;  2IO3 B;  3BY4 B;  3TMP B;  1GUA B;  2KFJ A;  3ALB A;  4EZL A;  5LXH A;  3N3K B;  4IM0 A;  3R7R A;  4IUM B;  4MGI E;  2BKR B;  1UH6 A;  4DHJ D;  2DZM A;  2KMC A;  3L17 A;  5D2M B;  2KAN A;  3DPD A;  1FXT B;  1V49 A;  3CSF A;  4KZ0 A;  4I6N B;  5DPR A;  3RZW C;  3VFK A;  3ZO5 B;  2C9W B;  1MG8 A;  1V5T A;  4LCD E;  4ANV A;  3JYU A;  3T9L A;  4ANU A;  1TGZ B;  3PZD A;  4FUL A;  4TUU A;  1E8X A;  3AXC A;  2J7Q B;  2KO3 A;  5DPT A;  3DOW A;  2BGF A;  3PV1 A;  2CHX A;  4KSK C;  2JWZ A;  2DAJ A;  2CKH B;  1OQY A;  3VH3 B;  3V61 A;  2KTR A;  2BYE A;  1IP9 A;  4BBN F;  3SU8 X;  2O2V A;  2PEA A;  2WX0 A;  2LAS A;  4EFO A;  2IY1 B;  3NY5 A;  4GDK B;  2JF5 A;  3RD2 A;  1EO6 A;  2J0K A;  2LGD A;  3K9O B;  2AWT A;  3ECI A;  4BOS C;  1P0R A;  1WY8 A;  2WYQ A;  2FCM A;  2UYZ B;  1F9J A;  1VCB A;  4M0W B;  2KX0 A;  3U30 A;  1U4A A;  4DHZ E;  2K8H A;  4HK2 A;  2KOX A;  5G55 A;  2IYD B;  1HE8 A;  1WXA A;  5JHB A;  4HVB A;  4KIK A;  3CMM B;  1C3T A;  1V9J A;  2FID A;  2G4D B;  2KHW B;  2DYM A;  2Y5B B;  3MHS D;  4GGQ A;  3APC A;  3ZRC A;  2KMA A;  2LRW A;  1UGM A;  4PYZ A;  3VQI A;  5EDS A;  2C7H A;  1NI2 A;  4FJZ A;  5E6O A;  3PT2 B;  3V6E B;  1WR1 A;  4E3C A;  4HXD A;  3DVG Y;  4A3O A;  3R3M A;  1WZ3 A;  1IYF A;  1E90 A;  3A1Q B;  2KWC A;  1GJZ A;  2MLB A;  1BT0 A;  2N1W A;  5CX3 A;  4FLH A;  4EUT A;  3H7P B;  5CHW A;  4F8C B;  3TL5 A;  1QZE A;  3ZVV A;  2G4S A;  2V1Y A;  3DBL I;  3QAR A;  2B3A A;  2NPT B;  4PS8 A;  3ZTC A;  4CHK A;  4F1S A;  1WX8 A;  2HE7 A;  1WFY A;  2BWF A;  2KN5 A;  2NCN A;  1LM8 B;  1GG3 A;  3KUZ A;  2KDE B;  4ANX A;  2LI5 A;  1WM3 A;  3GOE A;  4II3 B;  4RM8 A;  3VHT C;  2ZPY A;  3SDL C;  4GIV A;  2M1M A;  3WA0 A;  4GDL A;  2MBB B;  3WAM A;  4AUQ C;  2IO0 B;  4FA6 A;  2JVC A;  2DZJ A;  1KM7 A;  2MP2 B;  3PSE B;  4NY0 A;  5IAA C;  3ML8 A;  2NR2 A;  4WWO A;  1YQB A;  2KDI A;  4YL8 A;  4CYE A;  4W9E A;  2PJH A;  3L13 A;  2G3Q B;  3PRP B;  3SD5 A;  3ZW3 A;  3HHM A;  5CHV C;  4WQO B;  2KNB A;  4K7S A;  2K39 A;  5LLI A;  4PS7 A;  2CU1 A;  4GB9 A;  2ZPN A;  4W9I A;  4W9J A;  2IY0 B;  4NNJ B;  2FCQ A;  5J18 A;  2D11 A;  1J8C A;  3IG3 A;  3AUL A;  3DBS A;  1CMX B;  3NZU A;  2O6V B;  2KC1 A;  1E7V A;  4N9F 4;  2BF8 B;  1J19 A;  2VRR B;  2N9P C;  3WAL A;  1WGR A;  2CHW A;  3VVW B;  3IBE A;  3M62 B;  4I6L B;  4XZ4 A;  2MX2 A;  1EF1 A;  3QA8 A;  4ICV A;  2XK5 A;  2M0X A;  1WJ6 A;  4HCP B;  4FN2 A;  2IZV B;  4IM3 A;  1Z5S B;  2LXA A;  1WMH B;  1TZ1 A;  3UIN B;  2NVU I;  1NBF C;  3UQA A;  3PRE A;  2K8C A;  2EKE C;  4PS3 A;  4ZYN A;  2L00 B;  3ZTD A;  3PLU A;  2K25 A;  3LJ3 A;  1GC6 A;  1V5O A;  2KDB A;  2N4F A;  1UD7 A;  3JSV A;  3W1S C;  4MJS A;  4MSM B;  2K6Q A;  1Q1O A;  3L10 B;  4MH0 E;  4HCN B;  4E71 A;  4JIO U;  4DWF A;  3L0W B;  3N30 A;  4MGY E;  5AZG A;  2XBB C;  4XC2 A;  5TR5 A;  3QQ8 B;  1RRB A;  3ZLZ A;  2O6V D;  1RAX A;  2NBW B;  4BKS A;  2RD0 A;  1ZW7 A;  1WI0 A;  3RT3 B;  2ZVO A;  3A4S C;  3JSV B;  3OLM D;  3PRM B;  4IWO A;  4BBN C;  4KSL C;  3DCG A;  4W9K A;  3R66 C;  2CR5 A;  3P2B A;  2REX A;  3V60 A;  2LVP A;  1C1Y B;  2KJ6 A;  4MSQ B;  1YIW A;  3TJP A;  2EMT A;  4FJV B;  4W9G A;  2K6D B;  3AU5 A;  3R7Q A;  1EUV B;  2V3S A;  2XK5 B;  4KDI C;  2N7E A;  3KUC B;  3VUW A;  5C1Z A;  2DHZ A;  3ZDM C;  1WGD A;  2D2Q A;  1R4N I;  3APF A;  4M8N A;  1WRD B;  4GMV A;  3ZNH B;  1I35 A;  2DYO A;  1UEL A;  3PHW B;  4NQK E;  1V6E A;  1WE6 A;  2DX5 B;  2JUO A;  4FJY A;  4AP4 C;  4CO7 A;  1WGG A;  5KHQ A;  1LQB A;  3IHP C;  2MRP A;  4ZRK A;  2KTF A;  3D32 A;  3M3J A;  3OJ3 A;  4WJP A;  1KLV A;  3W1S A;  3X23 A;  3A9J A;  1S1Q B;  3PLV A;  2LUE A;  5L83 A;  3QIJ A;  2LVO A;  2MP2 A;  3A9J B;  2C60 A;  4KZC A;  3PVL A;  2BYV E;  2WX1 A;  1P1A A;  4GDL B;  1TBE A;  4W9C A;  1SGH A;  3DBR I;  3RYT A;  1WXM A;  1YJ1 A;  4DDI D;  1I42 A;  1UZX B;  2LVQ A;  3TBL D;  4ASW C;  2JY6 A;  2MBE A;  4KVG B;  3Q3J A;  2GBK A;  4HPM B;  3VXW A;  2KJR A;  4JL9 A;  3MJW A;  4K7U A;  1E8Y A;  2MBQ A;  3EEC A;  3H6N A;  4EZK A;  3APD A;  1GNU A;  1WX7 A;  3PRZ A;  3OJ4 B;  4G0N B;  4JLC A;  2ZCB A;  4BKG A;  5GMV A;  4IC7 B;  4FBJ B;  2L0T A;  4RMA A;  3KUD B;  4A3P A;  4IG7 B;  2KD0 A;  3X0W A;  2L0F A;  1OGW A;  4MGK E;  3DQV A;  4RM9 A;  1WJ4 A;  1LXD A;  2W9N A;  3RZF A;  2R2O A;  3UGB B;  3H7S A;  2NBV B;  4K7W A;  4W9F A;  2EMS A;  5D6J B;  4WJN A;  1V80 A;  2JRI B;  2JZ3 B;  4KIK B;  1UBI A;  1E8W A;  4DBG A;  2ZJD A;  2V4L A;  5DCN A;  2LRU A;  4DXA B;  3NS8 A;  2KK8 A;  1Q5W B;  2CHZ A;  2JPH A;  3EFU A;  3ZNG C;  3UQB A;  4IW0 A;  5D94 A;  4BKS D;  4AOF A;  5L95 C;  1WR6 E;  4GDK A;  4LJO B;  3TIX A;  3ZNI D;  4KV2 A;  4FHK A;  1WJU A;  3HIZ A;  1G6J A;  4W9H A;  3NOB A;  3AI5 A;  2KWU B;  4MGZ E;  3NZS A;  4II2 B;  3LDZ E;  4ZRI A;  1WIA A;  3A4R A;  2GBR A;  3CST A;  4MJS B;  2FCS A;  3SHQ A;  2KXJ A;  2HTH A;  4M8M A;  4DK5 A;  4JQW C;  1ZGU B;  2WDT B;  2C5L C;  3H9D A;  3HK0 A;  3JW0 X;  3RUL A;  3RUI B;  4WWN A;  2M8S A;  3B0A A;  1WMH A;  4HDQ A;  3VTV A;  1WGH A;  3QC8 B;  1WE7 A;  4GXB A;  3V62 A;  2Z0E B;  2LJ5 A;  2MCN B;  3WIM A;  2J0M A;  3MTN B;  1T0Y A;  4K1R B;  2AL3 A;  3B1L X;  2A4Z A;  2IO2 B;  1WZ0 A;  2BKF A;  4F7Z A;  1OEY A;  3KVF B;  1RFA A;  3WAN A;  2IO1 B;  2O6V A;  2MW5 A;  4WAA A;  1L7Y A;  3VUX A;  5J2R A;  2M17 A;  2AYO B;  3DVG X;  3GZN I;  3KW5 B;  3UIO B;  1D3Z A;  2BWE S;  2I1J A;  4NJ6 A;  5LXI B;  5JHA A;  4G3X B;  3JVZ X;  2C7M B;  3L54 A;  1KOT A;  2MWS B;  1V86 A;  3ZUN A;  4B9K A;  3N32 A;  2FIF A;  4GSW A;  4IM2 A;  3ZKJ C;  4ZRJ A;  1OEY J;  3A9K B;  4NAW B;  4TV3 A;  1SE9 A;  1WX9 A;  4MEM A;  4FAD A;  4TQ0 A;  1ISN A;  3KH0 A;  2RSU A;  2LD9 A;  2HD5 B;  2JT4 B;  5BO4 B;  5G2N A;  4KDL B;  4G11 A;  5KHO A;  1YX6 B;  3IVF A;  4NQL B;  2N9E B;  4HPL B;  2K1F A;  3OAW A;  1E7U A;  3PPA A;  4K81 A;  4URK A;  2L8J A;  3QCA A;  2PPH A;  2RR9 A;  1IPG A;  1P98 A;  4GOC A;  3DDC B;  1AAR A;  4AJW A;  4LDT B;  1LFD A;  2RGF A;  4EZJ A;  2NPT A;  3T8M A;  4EEW A;  1NDD A;  2L3Z A;  1TTN A;  3H7P A;  2L05 A;  4MM3 A;  3Q3F A;  4J6I A;  3WAP A;  3ZDT A;  1E8Z A;  2Z0D B;  5E6P A;  3A1Q A;  3S2A A;  5IA7 A;  3ONS A;  2J0J A;  4TQ1 A;  2BPS A;  1P3Q U;  4B6W A;  4MDK E;  2NBU A;  1P9D U;  5JZE B;  2PE6 B;  2MBO A;  2ZCC A;  3DVN U;  2CS4 A;  3PS6 A;  1WM2 A;  4OVV A;  4TKN A;  4ICU A;  1WYW B;  4ANW A;  2WWZ A;  1VD2 A;  3PTF C;  5CTR C;  2LXC A;  5AEK B;  3DBH I;  1L2N A;  3QJZ A;  2G45 B;  2MSE D;  4AJY B;  2KVR A;  4W9D A;  2KX3 A;  1A5R A;  2HJ8 A;  2M4N A;  2JRH A;  3PGE A;  2ZEQ A;  4P7I A;  2PE9 A;  3L16 A;  1Y8R C;  4NJ7 A;  4DHZ B;  3RCZ A;  3KYD D;  1R4M I;  1KJT A;  4G50 A;  2UWQ A;  2LZ6 A;  2O2V B;  2IBI B;  2ZNV C;  1XD3 B;  3QK0 A;  2KTR B;  3I3T B;  2C7N B;  2GMI C;  1Q0W B;  1WF9 A;  2FAZ A;  3VUY A;  2KKC A;  2GBM A;  1V2Y A;  3UIP B; 
#chains in the Genus database with same CATH topology
 2D3G A;  3DVN V;  1K8R B;  2ASQ A;  3EC8 A;  1MFW A;  1NYQ A;  3U4E G;  2JX5 A;  5JH5 C;  5IKC M;  4GN1 A;  3BVM A;  1I4P A;  3OWE B;  3RMK C;  4QAY A;  4EOY A;  3TCA A;  4J3O D;  1E5W A;  4WJO A;  4AQ7 A;  1JRU A;  1JWU D;  4BFR A;  4XDD A;  3P4R B;  2K8B A;  4RFB A;  1KTK A;  1H4R A;  2GBJ A;  3KYC D;  4WIP A;  3B08 A;  4YSZ B;  3EUB 2;  4ZDV A;  5EE0 A;  4IWQ A;  1WJN A;  4RGT A;  2BW2 A;  5HHD G;  1I4X A;  2M19 A;  4BKT A;  2K5P A;  2RPQ A;  4OZC A;  3AE3 B;  2G9H D;  3L08 A;  4IWP A;  1C79 A;  1YOV B;  4GU2 A;  3MJ5 A;  1ROE A;  1T6B X;  5CHF A;  3ZNZ B;  1WXV A;  4XE0 A;  1ZP0 B;  4DHJ B;  1M94 A;  1XEE A;  4N6E B;  4IKG A;  1WXS A;  1OFF A;  1SIF A;  2Z59 B;  3EHV A;  2BYF A;  4MAC A;  1OQQ A;  2K22 A;  2WNM A;  3A9K A;  4NAW A;  2L7R A;  2PKO A;  5LNK 1;  2KLC A;  1V81 A;  2J52 A;  2BS4 B;  4NPN A;  2DNF A;  2K3U A;  2OJR A;  3AED B;  2WS3 B;  4WH4 A;  2N9X A;  4M01 A;  3K9P B;  3BY4 B;  1ZXH A;  4WUR A;  1XLN A;  3ALB A;  4EZL A;  3AEB B;  1UH6 A;  4LNO A;  2KMC A;  2KAN A;  3DPD A;  3VFK A;  2W82 A;  4KZ0 A;  3NRZ A;  1J7A A;  1D5M C;  4OZA A;  4ANV A;  4ANU A;  1IGD A;  1E8X A;  5DPT A;  2KO3 A;  2WXN A;  2BGF A;  2CHX A;  3VH3 B;  4RNA A;  1IP9 A;  3SEB A;  2WX0 A;  4EFO A;  2LAS A;  2WXH A;  3GB1 A;  4BOS C;  4M0W B;  1F9J A;  2KX0 A;  1U4A A;  3Q14 C;  1L5P A;  3E56 A;  4HK2 A;  2IYD B;  4GGQ A;  1AWD A;  2LRW A;  3LYY A;  3DVG Y;  3Q2A C;  4LNN A;  1GJZ A;  4EUT A;  2V9H A;  1FFU A;  1QZE A;  2N9L A;  3ZTC A;  3TEX A;  4II3 B;  4LLG M;  3P1M A;  4P1B C;  3WAM A;  2MP2 B;  3PSE B;  1FRR A;  2KAJ A;  1P7F A;  4YL8 A;  2KT7 A;  3SFD B;  1HQR D;  2N7J A;  4WAF A;  1V1P B;  4L23 A;  2KNB A;  5EE1 A;  3EGR A;  3LB8 C;  4W9I A;  2D11 A;  2CJN A;  2PVO D;  3AUL A;  1WYG A;  2MJD A;  2O6V B;  5IO9 A;  2N9P C;  3HVZ A;  3IBE A;  4XZ4 A;  2MX2 A;  1EF1 A;  3QA8 A;  1ZOY B;  1OQR A;  3MP9 A;  3UQA A;  1PGB A;  5G5H A;  2K8C A;  2EKE C;  3ZTD A;  1WWT A;  1E7P B;  4KX6 B;  3W1S C;  5C3J B;  4JPS A;  2QIL A;  2K6Q A;  1Q1O A;  4JIO U;  3AE8 B;  1UGJ A;  3QQ8 B;  3VR8 B;  2OED A;  2RD0 A;  1ZW7 A;  2VH2 A;  3RT3 B;  2HJ1 A;  2ZVO A;  1YN3 A;  4DQO C;  1J7B A;  2BB5 A;  3P2B A;  1GB1 A;  2N0S B;  3V60 A;  3ZYY X;  2BT6 A;  4W9G A;  2K6D B;  3R7Q A;  2V3S A;  3BII D;  2N7E A;  3VUW A;  2WU5 B;  3AV8 A;  2QMT A;  1WRD B;  3Q69 A;  4HEA 1;  5G5G A;  3DBH B;  1E0Z A;  2KTF A;  3D32 A;  3RFZ B;  1AN8 A;  1JW9 D;  3BYT B;  1L0Y B;  4L1B A;  2ONQ A;  2ZW1 A;  4OHJ A;  2PMV A;  1I4G A;  2MP2 A;  5FK9 C;  1C4P A;  2WX1 A;  3URY A;  3RYT A;  1WXM A;  1I42 A;  1UZX B;  4ASW C;  4P16 A;  4KVG B;  3Q3J A;  2GBK A;  4HPM B;  4JL9 A;  4HKQ A;  2IGD A;  3H6N A;  4EZK A;  3PRZ A;  2WGS A;  4RMA A;  2NMQ A;  1HZ6 A;  4MGK E;  1L4Z B;  2JU6 X;  3UGB B;  4K7W A;  2EMS A;  2W3S A;  4KIK B;  1UBI A;  1K50 A;  3EFC A;  3P4P B;  2ZJD A;  5DCN A;  3AE1 B;  2CHZ A;  4MT5 A;  4BKS D;  3W5U B;  3AMZ A;  3ZNI D;  5JXV A;  1WJU A;  3Q8C A;  2KWU B;  4MGZ E;  4ZRI A;  3CST A;  4C7Z A;  1T3Q A;  4MJS B;  2HTH A;  4ITK A;  4JQW C;  2WDT B;  2M56 B;  3RUI B;  1DOY A;  3RNF C;  1WMH A;  3VTV A;  1WGH A;  3QC8 B;  1WE7 A;  4YTN B;  2J0M A;  2LHE A;  4K1R B;  4LNF A;  1KH0 A;  1WZ0 A;  2BKF A;  1PYW D;  3KVF B;  1MHX A;  4LTU A;  2IO1 B;  2MW5 A;  2M17 A;  2BWE S;  2IDY A;  2L1A A;  2EEL A;  1F1H A;  3NUH B;  3AN1 A;  3L54 A;  1KOT A;  4ARC A;  4RGO S;  3ZUN A;  2WXP A;  2WXI A;  3N32 A;  4IM2 A;  4ZRJ A;  1EWY C;  2KDM A;  3A9K B;  4NAW B;  4TV3 A;  1NEK B;  4TQ0 A;  1E6E B;  1TY2 A;  1JRP A;  4NQL B;  4HPL B;  3OAW A;  4URK A;  4YTP B;  1P98 A;  1HXY D;  4GOC A;  1R4N B;  3RPF C;  4YWG G;  4BZA A;  3T8M A;  1N5X A;  4EEW A;  2BS2 B;  4RGM A;  1FNW A;  2WXK A;  4J6I A;  4KGT A;  3S2A A;  3ONS A;  4C00 A;  1P3Q U;  2MHJ A;  1P9D U;  3BWU D;  2GLS A;  1WM2 A;  3P63 A;  4ANW A;  2LXC A;  1L2N A;  2PLP A;  2UU7 A;  3PGE A;  5BYR A;  4DHZ B;  1VZ6 A;  3MC8 A;  4YXD B;  3KYD D;  4S17 A;  4PT5 A;  1HZ5 A;  2O2V B;  2IBI B;  2ZNV C;  2KTR B;  2C7N B;  1Q0W B;  1ZPS A;  2WDQ B;  4E74 A;  5D7G A;  1D6E C;  2LGX A;  3RNG C;  3P4S B;  1WH3 A;  2AEH A;  2KWV B;  2D07 B;  3R2T A;  4BVU C;  3PHX B;  2VZK D;  4W9L A;  2PTL A;  2KFK A;  3MFG A;  4XWW A;  3NVY A;  2INP E;  2BVC A;  2FBW B;  2MJE A;  3U7Z A;  2KQ7 A;  1QQR A;  2JZZ A;  1VRA B;  3Q3O C;  1N5W A;  3O65 B;  1DGJ A;  2KMM A;  2BYT A;  3VTW A;  2WDV B;  1S3S G;  2XEW A;  4R3D A;  4NAM A;  3H1U A;  2KQS A;  2I1K A;  2BBC A;  2BB6 A;  2YVC A;  2LWP A;  4B95 A;  1Z2M A;  2GBN A;  1X1M A;  4YSY B;  5J17 A;  2MBH A;  1TIF A;  3VDZ A;  5DPW A;  1EWC A;  2KC2 A;  3ZGZ A;  1OTR B;  2DYB A;  1FXA A;  4WWP A;  2IGH A;  4P6V F;  1I4Q A;  1J0G A;  2MQJ A;  1FPY A;  1XLO A;  1SSN A;  5AUK A;  3HM6 X;  2YLM A;  4K3C A;  1MHH E;  3PZ8 A;  1P7E A;  2YEP F;  1ZUD 2;  2IO3 B;  3TMP B;  4M00 A;  1GUA B;  3OG5 A;  3P4Q B;  2IND C;  2HTM E;  3SFE B;  4N58 A;  3L17 A;  5DPR A;  3CSF A;  4I6N B;  4LCD E;  3JYU A;  3T9L A;  2AQ2 B;  3PZD A;  3AXC A;  3BK2 A;  2KYW A;  2DAJ A;  1FCL A;  2JWU A;  2KTR A;  2BYE A;  2QDF A;  2O2V A;  1JWB D;  3FIL A;  1C78 A;  2JF5 A;  2LGD A;  1TKY A;  1TS3 A;  2FCM A;  1VCB A;  3RN9 C;  3O13 A;  3CMM B;  4Q2J A;  2DYM A;  3MHS D;  3ZRC A;  1M4V A;  2C7H A;  3W9C B;  1NI2 A;  1B9R A;  3PT2 B;  3AEG B;  2LMC A;  5BMI A;  4F8C B;  3DBL I;  2V1Y A;  2ICI A;  2B3A A;  4F1S A;  1WX8 A;  1WFY A;  2I38 A;  2KN5 A;  3ZJV A;  2NCN A;  1LM8 B;  1GG3 A;  4ANX A;  4RM8 A;  3VHT C;  1VR9 A;  2ZPY A;  3SDL C;  4GIV A;  3DBL B;  3Q3N C;  4FA6 A;  2DZJ A;  5IAA C;  5C2T B;  4WWO A;  1K53 A;  1YQB A;  2KDI A;  3PRP B;  4LNI A;  3SD5 A;  3MC9 A;  3HHM A;  4PS7 A;  2CU1 A;  4GB9 A;  3B2G A;  5J18 A;  2LGI A;  1D5Z C;  3IG3 A;  4YSX B;  1L6V A;  1CMX B;  3DBS A;  3NZU A;  5BMG A;  3BVZ A;  4TMA B;  2V0G A;  3VVW B;  4RH6 A;  4HKZ E;  3M62 B;  3VRA B;  4I6L B;  1TKG A;  2FUG 1;  1NEN B;  2WQY B;  2IZV B;  4OZB A;  2LXA A;  1WGK A;  2NVU I;  1NBF C;  3PRE A;  4PS3 A;  2L00 B;  3PLU A;  2J4X A;  2KWD A;  2KDB A;  4BAX A;  2LJI A;  4US9 A;  4KKI A;  3L10 B;  4E71 A;  4HCN B;  4DWF A;  4HJG E;  3N30 A;  1F2R I;  5AZG A;  4ZRP A;  5TR5 A;  1RRB A;  3ZLZ A;  1QOB A;  3N9Y C;  3T3N A;  1VDV A;  2MEK A;  1TJE A;  4IWO A;  3DCG A;  2MJ3 A;  3R66 C;  2CR5 A;  2REX A;  2QEJ C;  1C4C A;  4HRO A;  1N60 A;  1YIW A;  3Q8E A;  1ET9 A;  2EMT A;  1EUV B;  5IP4 D;  1TS2 A;  3W2D A;  4US8 A;  2YEP B;  1NI3 A;  3APF A;  1F2R C;  1UEL A;  3PHW B;  1V6E A;  1WE6 A;  2Y5C A;  4CO7 A;  1WGG A;  5KHQ A;  1JWA D;  4USA A;  4ZRK A;  3BK1 A;  1UWX A;  1KLV A;  1V1O A;  2LUE A;  3QIJ A;  2GI9 A;  3DHI C;  3A9J B;  5AUI A;  2BYV E;  1P1A A;  1C4A A;  4GDL B;  1IUE A;  1YJ1 A;  2LVQ A;  1FCC C;  1XLQ A;  2Z8L A;  3MJW A;  4WQM A;  3ZJU A;  4A8X C;  1IBX B;  4REZ A;  3APD A;  1GNU A;  2H89 B;  1WX7 A;  3AE9 B;  4BKG A;  1TZO A;  5GMV A;  2L0T A;  1V97 A;  1R7S A;  2WXQ A;  1OGW A;  1WJ4 A;  1LXD A;  3RZF A;  2AQ1 B;  3H7S A;  2NBV B;  1FD6 A;  4JWU C;  2JRI B;  2RDB C;  1E8W A;  4DBG A;  1QOF A;  1QT9 A;  2LRU A;  1DYQ A;  2KK8 A;  4C80 A;  1QLB B;  3ZNG C;  3UQB A;  3U2S C;  3B9J A;  1FNU A;  1UUP A;  3FIL B;  4KV2 A;  4FHK A;  5FR3 A;  1G6J A;  4W9H A;  4C4V B;  1T0Q C;  4II2 B;  1BXT A;  3A4R A;  2KXJ A;  4M8M A;  1D5X C;  4DXF A;  5TSS A;  2C5L C;  3H9D A;  3B0A A;  1T5X D;  3V62 A;  2LJ5 A;  1K51 A;  3AE2 B;  3MTN B;  1N63 A;  2IO2 B;  3AE7 B;  4DXG A;  4M02 A;  4WAA A;  1L7Y A;  5J2R A;  3KW5 B;  3DVG X;  3GZN I;  3UIO B;  1CJE A;  2I1J A;  5LXI B;  3SR6 A;  4HRS A;  3JVZ X;  3CWI A;  1JCK B;  2KN4 A;  4GSW A;  4TSS A;  5BYQ A;  1SE9 A;  1WX9 A;  5EE9 A;  1ISN A;  2X38 A;  2RSU A;  2HD5 B;  5KHO A;  1YX6 B;  2OJW A;  2N9E B;  3PPA A;  4K81 A;  1XLP A;  3N1Y C;  2L8J A;  3QCA A;  2PPH A;  2RR9 A;  1AAR A;  2DLB A;  3FKY A;  1YQ4 B;  1NDD A;  2L3Z A;  2KQ4 X;  1VJK A;  2Z0D B;  5IA7 A;  3A1Q A;  2BPS A;  4MDK E;  1JRO A;  1NVI D;  4HPP A;  1C76 A;  2MBO A;  2ZCC A;  3DVN U;  2CS4 A;  3PS6 A;  4OVV A;  1WYW B;  2IGG A;  2WWZ A;  3I5J C;  2G1E A;  1SBB B;  2MSE D;  3Q6B A;  3QJZ A;  4AJY B;  2KVR A;  2HJ8 A;  4NJ7 A;  5D3I B;  1KJT A;  4G50 A;  3L4P A;  1CQV A;  2FAZ A;  2KKC A;  1V2Y A;  3UIP B;  1GB4 A;  2KDF B;  3ZIM A;  2D3A A;  2E6X A;  1PQS A;  3KWV A;  2V4I B;  4EKU A;  4B0M A;  2FCN A;  4WJQ A;  3KQ4 A;  1EF5 A;  5C23 A;  5DPS A;  3AEC B;  1XCT L;  3HVD A;  2R2Q A;  2JYT A;  2W55 A;  4LNK A;  4XX5 A;  1QF6 A;  2ZW0 A;  2OOB B;  2TSS A;  1UBQ A;  4OVU A;  3V6C B;  1RWS A;  1F52 A;  1GC7 A;  2R61 A;  3Q8B A;  4LDT D;  3N1X C;  2DEN B;  2AL6 A;  1UF0 A;  4MEL A;  3UI3 A;  1SF0 A;  2KZR A;  2MA9 B;  1TS4 A;  2LEK A;  4HWI B;  2N7D A;  4HLE A;  2QHO A;  1MI0 A;  3VAW A;  3GZN B;  3AU4 A;  1I4R A;  1YX5 B;  3ML9 A;  3UF8 A;  3QAQ A;  4A20 A;  4MM3 B;  2N1V A;  2A5U A;  1FXI A;  2LFI A;  5E6N A;  1KRH A;  2ZZP B;  3BIN A;  2GOW A;  3U8Z A;  3DWG C;  4FHJ A;  2V3N A;  4BOZ B;  2FUH B;  3IFW B;  2BS3 B;  2AX5 A;  3A33 B;  2D10 A;  2SEB D;  3U7D A;  1ZDV A;  4K3B A;  5HG2 A;  2ZVN A;  5FR6 A;  1Q10 A;  2K0P A;  5LXH A;  4IM0 A;  4IUM B;  4MGI E;  2BKR B;  5E6J A;  2DZM A;  1JQ4 A;  5D2M B;  3RZW C;  3ZO5 B;  5H92 C;  3TEZ A;  3ZXR A;  1VLB A;  4FUL A;  4TUU A;  2J7Q B;  2Y5P A;  3E9S A;  3DOW A;  4C56 C;  2CKH B;  3WCQ A;  3V61 A;  3W5V B;  4BBN F;  3N20 C;  4KKJ A;  2WDR B;  3RD2 A;  1EO6 A;  2J0K A;  3K9O B;  2AWT A;  4L2Y A;  2LGS A;  2WYQ A;  3U30 A;  4DHZ E;  2K8H A;  1HE8 A;  1WXA A;  4KIK A;  3I63 C;  1C3T A;  1V9J A;  2KHW B;  2Y5B B;  3APC A;  5EDS A;  4PYZ A;  1UGM A;  1FO4 A;  3NS1 A;  4FJZ A;  3MHZ A;  3V6E B;  1WR1 A;  4A3O A;  3R3M A;  1TT5 B;  1IYF A;  3A1Q B;  2N1W A;  2E3T A;  3KWL A;  5CHW A;  3QAR A;  2G4S A;  2HE7 A;  2AQ3 B;  2KDE B;  1ET6 A;  2PVG C;  1WM3 A;  4UDU C;  2M1M A;  1QIL A;  3TSS A;  2IO0 B;  1KLU D;  3ML8 A;  4CYE A;  3ZW3 A;  4XWT A;  2QJL A;  5CHV C;  4ZYS A;  1T0R C;  5LLI A;  4W9J A;  2IY0 B;  1L4D B;  2KC1 A;  2VRR B;  3BVG A;  3WAL A;  2CHW A;  3IAS 1;  3V3X A;  4ICV A;  3ABV B;  1XO3 A;  2XK5 A;  4CQN A;  3TEY A;  4A9A A;  1TZ1 A;  3AM9 A;  3UIN B;  3AH7 A;  4WWM A;  1DOI A;  2K25 A;  1GC6 A;  1V5O A;  3JSV A;  4MSM B;  3L0W B;  4C4V A;  4MGY E;  4XC2 A;  3EA6 A;  4A55 A;  3PO0 A;  1F0Z A;  2K9X A;  3DWM A;  1GAQ B;  1VZ7 A;  3OLM D;  4BBN C;  3JSV B;  3PRM B;  4KSL C;  1AYF A;  4S0R A;  4KGS A;  4ZHO A;  3TJP A;  1J7C A;  4KDI C;  2WXL A;  2XK5 B;  5C1Z A;  2DHZ A;  3ZDM C;  1R4N I;  4GMV A;  1JWS D;  3Q8A A;  3ZNH B;  1IBX A;  2MH7 A;  4NQK E;  2DX5 B;  2JUO A;  4FJY A;  1KLG D;  2XN9 C;  1I4H A;  1V8C A;  2JSV X;  3M3J A;  3OJ3 A;  4WJP A;  4FXC A;  3W1S A;  3X23 A;  3A9J A;  5IN7 A;  1SE3 A;  3BYY B;  2LVO A;  2C60 A;  4KZC A;  1FEH A;  1TBE A;  1SGH A;  2J42 A;  2INC C;  1B1Z A;  3TBL D;  1JWM D;  3AE6 B;  3VXW A;  1MG4 A;  4EE2 A;  1E10 A;  3EEC A;  3ZQ4 A;  3OJ4 B;  4JLC A;  4FBJ B;  3NVZ A;  3Q3M C;  4A3P A;  4IG7 B;  2BQQ A;  2L0F A;  1I7H A;  3DQV A;  4AS1 A;  2W9N A;  3GE3 C;  3N1Z C;  1V80 A;  2JZ3 B;  2GRI A;  5HFY A;  1YJI A;  2VZK B;  2JPH A;  4IW0 A;  5D94 A;  4AOF A;  1XF5 L;  1C9F A;  4LJO B;  2LHD A;  2RPV A;  4B0E A;  3HIZ A;  3NOB A;  3LDZ E;  1XXG A;  2GBR A;  3SHQ A;  1CK1 A;  2D3B A;  3DHG C;  3HK0 A;  1N61 A;  3RUL A;  1SE2 A;  4WWN A;  5H8Y E;  1AW7 A;  4GXB A;  3IXS A;  4ZHP A;  1BUI C;  3NVV A;  2WP9 B;  2AL3 A;  2A4Z A;  4F7Z A;  1FFV A;  1RFA A;  3WAN A;  1LGR A;  3VUX A;  2AYO B;  1JML A;  4NJ6 A;  5JHA A;  4G3X B;  2MWS B;  1E9M A;  1V86 A;  4B9K A;  1T0S C;  2FIF A;  3ZKJ C;  4MEM A;  2LD9 A;  2JT4 B;  5G2N A;  1E7U A;  3AE5 B;  3VR9 B;  1FIQ A;  4LDT B;  1LO5 D;  2NPT A;  3GE8 C;  1TTN A;  3H7P A;  4MM3 A;  3WAP A;  1E8Z A;  5E6P A;  5BMH A;  2J0J A;  4TQ1 A;  1EM7 A;  3R8B A;  1ENF A;  2NBU A;  3AB5 A;  5JZE B;  2LUM A;  4ICU A;  1VD2 A;  5AEK B;  3DHH C;  5I4D A;  2G45 B;  4W9D A;  2M4N A;  2JRH A;  2ZEQ A;  1WRI A;  2PE9 A;  1SJH D;  3RCZ A;  1R4M I;  1R4M B;  3IT6 B;  4MH8 A;  4RF1 A;  1XD3 B;  1FM0 D;  3QK0 A;  3I3T B;  4PK1 A;  2CJO A;  2GMI C;  1WF9 A;  3VUY A;  3ZJT A;  3GP7 A;  1PFD A;  2GBM A;  4PYU A;  3CF6 E;  3J9C A;  3C0R B;  1L0V B;  1RFK A;  3M95 A;  4HDO A;  1SXT A;  2PW9 A;  2WXM A;  4JWS C;  2KJH B;  3HM3 A;  1UWM A;  4AWJ A;  4DDG D;  4NZL B;  1IGC A;  1XQQ A;  2FNJ B;  4X57 B;  2QCZ A;  3M63 B;  1FNV A;  3TUO A;  3VTU A;  3PZ7 A;  3KLS X;  1N62 A;  1H8C A;  4JGH B;  2OHF A;  3ZRF A;  4LJP B;  3NG0 A;  2DAF A;  4I6P A;  3FC4 A;  3AEF B;  1YQ3 B;  2DZI A;  3VH4 B;  1YN4 A;  3CIR B;  1XT9 B;  5AZH A;  5HI1 A;  2LGY A;  3GS2 A;  2W54 A;  2DZK A;  3QX1 A;  2JXX A;  1ZKH A;  3QHT A;  3IAM 1;  3WAO A;  3HUI A;  3T3O A;  4HJK A;  1WGY A;  4XDC A;  1JAL A;  2ZNV B;  1YJJ A;  1BML C;  3FAH A;  1RLF A;  3NHE B;  2L76 A;  4C7Y A;  1SJE D;  2KLG A;  2NS5 A;  3AEE B;  3W1Y A;  1QKZ A;  1MJD A;  2WXF A;  2JZP A;  1DOX A;  3BZD B;  5HKH A;  1XCQ L;  5AZF A;  1YD8 U;  2ACZ B;  2KFK B;  3QWZ B;  3ENE A;  3TEW A;  2B76 B;  2KFJ A;  2H88 B;  1NYR A;  2L52 A;  2QC8 A;  1PGA A;  5MPO A;  3N3K B;  3R7R A;  4DHJ D;  4O1N A;  1FXT B;  1V49 A;  1HEZ E;  1KF6 B;  2C9W B;  1MG8 A;  1V5T A;  3RNB C;  1TGZ B;  2WHI A;  4H2A A;  3C19 A;  3PV1 A;  4KSK C;  2JWZ A;  4OW0 A;  4OVZ A;  1OQY A;  1WSP A;  3MC0 B;  3SU8 X;  2PEA A;  2IY1 B;  3NY5 A;  4GDK B;  2QIE B;  3ECI A;  1P0R A;  1WY8 A;  2UYZ B;  1C77 A;  1FRD A;  2KOX A;  5G55 A;  1ACC A;  5JHB A;  2KAC A;  4HVB A;  2FID A;  2G4D B;  2SAK A;  2IPK D;  3ETR A;  1ESF A;  2KMA A;  3VQI A;  5E6O A;  3B2F A;  4E3C A;  4HXD A;  5FKA C;  1WZ3 A;  1E90 A;  2KWC A;  1ZDX A;  2MLB A;  1BT0 A;  3ZXV A;  5CX3 A;  4FLH A;  3H7P B;  3TL5 A;  3ZVV A;  4CHK A;  2NPT B;  2INN E;  4PS8 A;  1YMH E;  2BWF A;  2WXG A;  2QSD A;  3R2I A;  3I9V 1;  3KUZ A;  1ZXI A;  2LI5 A;  1SIJ A;  2DWQ A;  2JQR B;  3GOE A;  2RDH A;  3WA0 A;  4GDL A;  2MBB B;  4AUQ C;  1K52 A;  2JVC A;  1KM7 A;  2I2Y A;  4NY0 A;  2NR2 A;  4W9E A;  2PJH A;  2RMM A;  3L13 A;  2G3Q B;  4WQO B;  1SEB D;  1MPE A;  4K7S A;  2K39 A;  1PUT A;  2ZPN A;  4NNJ B;  2FCQ A;  1J8C A;  2L83 A;  1RYJ A;  1HTO A;  4N9F 4;  1E7V A;  4D2K A;  2BF8 B;  1J19 A;  1WGR A;  1HTQ A;  1KFY B;  2M0X A;  1WJ6 A;  4HCP B;  4FN2 A;  4A90 A;  4IM3 A;  1Z5S B;  1WMH B;  2GB1 A;  3AEA B;  4ZYN A;  3C8Y A;  4RCO A;  2N4F A;  2FE8 A;  3LJ3 A;  1UD7 A;  4IDI A;  4MJS A;  4YTM B;  4MH0 E;  3HRD D;  1N6Z A;  2XBB C;  4IOI E;  4RGN A;  1CZP A;  2O6V D;  1RAX A;  2NBW B;  4BKS A;  1WI0 A;  3A4S C;  1FMA D;  1TYG B;  4W9K A;  1YNT E;  2RDG A;  2LVP A;  1C1Y B;  3DBR B;  1L0X B;  2KJ6 A;  4MSQ B;  4FJV B;  3AU5 A;  4NJC A;  2X8X X;  1QOG A;  4LK0 M;  3KUC B;  4ZRQ A;  1HA5 A;  1WGD A;  2D2Q A;  4P1C C;  4M8N A;  1I35 A;  2DYO A;  1WXQ A;  2CU3 A;  4AP4 C;  2EKI A;  1LQB A;  3IHP C;  2MRP A;  3V05 A;  2NTT A;  1S1Q B;  2HDE A;  1D4B A;  3PLV A;  5L83 A;  1SE4 A;  2L32 A;  3PVL A;  1TKE A;  2J53 A;  2Y3A A;  4W9C A;  3DBR I;  4ZOH C;  4DDI D;  2JY6 A;  2MBE A;  3P42 A;  2KJR A;  4K7U A;  1E8Y A;  2MBQ A;  3VRB B;  2D3C A;  2ON8 A;  5D3D A;  4G0N B;  2ZCB A;  4IC7 B;  3H8H A;  3KUD B;  2KD0 A;  3X0W A;  4XGA B;  4RM9 A;  2R2O A;  4W9F A;  5D6J B;  4WJN A;  4YT0 B;  1YN5 A;  1UNS A;  3U52 E;  5EE3 A;  1STE A;  2V4L A;  1A70 A;  4DXA B;  3NS8 A;  1Q5W B;  3EFU A;  1TS5 A;  2VH1 A;  1EU3 A;  5L95 C;  1WR6 E;  4GDK A;  3IT4 B;  2W3R A;  4A6Q A;  3TIX A;  4JE3 B;  3AI5 A;  1L6U A;  3NZS A;  1WIA A;  2M0A A;  2FCS A;  1PDX A;  4DK5 A;  1ZGU B;  3JW0 X;  2M8S A;  4HDQ A;  2WXR A;  1SB3 C;  4KGR A;  2Z0E B;  4ARI A;  2MCN B;  3WIM A;  4ACF A;  1T0Y A;  3B1L X;  1OEY A;  4GLS C;  2O6V A;  2Q5W D;  4JX1 C;  1D3Z A;  3RNC C;  2C7M B;  2V3P A;  2BTE A;  2JYE A;  1QOA A;  1F77 A;  1V1P A;  2WXJ A;  1OEY J;  4RF0 A;  2WXO A;  4FAD A;  3KH0 A;  3I57 A;  5BO4 B;  4KDL B;  4G11 A;  3IVF A;  2DBY A;  2K1F A;  2KVZ A;  2XNA C;  1IPG A;  3DDC B;  4XYC A;  4AJW A;  1LFD A;  2RGF A;  4EZJ A;  2NTS A;  3NZ3 A;  5IOI A;  2L05 A;  2JXT A;  3AE4 B;  3Q3F A;  3ZDT A;  5GXG B;  2D5G A;  1GOZ A;  3RNE C;  5BYS A;  2N9K A;  1EU4 A;  4B6W A;  3LXF A;  2PE6 B;  3Q8F A;  4TKN A;  1MVK A;  3PTF C;  5CTR C;  3DBH I;  5T8I A;  1A5R A;  2KX3 A;  1TY0 A;  4M0W A;  4P7I A;  1Y56 A;  3RNA C;  3L16 A;  1PGX A;  1Y8R C;  2PIA A;  2WLB A;  2WU2 B;  3NVW A;  2UWQ A;  2LZ6 A;  4N59 A;  1ZE3 D;  1GPX A;  1RM6 C;  3NJT A;  2IJ0 A;  1VZ8 A;  3RI7 C; 
#chains in the Genus database with same CATH homology
 4PYU A;  2KDF B;  2D3G A;  3DVN V;  3ZIM A;  1K8R B;  1PQS A;  3CF6 E;  4EKU A;  3C0R B;  2ASQ A;  3EC8 A;  4E74 A;  2FCN A;  4WJQ A;  3M95 A;  1EF5 A;  5D7G A;  5C23 A;  5DPS A;  2LGX A;  4HDO A;  4DDG D;  2KJH B;  3HM3 A;  5JH5 C;  4AWJ A;  1WH3 A;  2AEH A;  4GN1 A;  2R2Q A;  2KWV B;  2D07 B;  4XX5 A;  4BVU C;  1XQQ A;  2FNJ B;  4X57 B;  3M63 B;  4EOY A;  3TCA A;  3PHX B;  2OOB B;  3VTU A;  1E5W A;  4WJO A;  1JRU A;  4W9L A;  4BFR A;  2KFK A;  2K8B A;  1H8C A;  1UBQ A;  4OVU A;  3V6C B;  1H4R A;  4JGH B;  3ZRF A;  2GBJ A;  3KYC D;  1GC7 A;  4LJP B;  3B08 A;  4LDT D;  2DAF A;  2DEN B;  4I6P A;  2KQ7 A;  4ZDV A;  2AL6 A;  4MEL A;  2DZI A;  2JZZ A;  2KZR A;  2MA9 B;  3VH4 B;  4IWQ A;  1WJN A;  5AZH A;  1XT9 B;  4HWI B;  2N7D A;  4HLE A;  2LGY A;  2QHO A;  3O65 B;  3VAW A;  2DZK A;  3QX1 A;  2JXX A;  3VTW A;  3AU4 A;  1YX5 B;  1S3S G;  2XEW A;  4BKT A;  3ML9 A;  3UF8 A;  1ZKH A;  3H1U A;  2RPQ A;  3QAQ A;  4A20 A;  2KQS A;  2I1K A;  2N1V A;  2A5U A;  3L08 A;  3QHT A;  2YVC A;  4B95 A;  2LWP A;  1Z2M A;  2GBN A;  4IWP A;  5E6N A;  1X1M A;  5J17 A;  2MBH A;  4GU2 A;  3WAO A;  3VDZ A;  2ZZP B;  4HJK A;  1WGY A;  5DPW A;  5CHF A;  3BIN A;  3ZNZ B;  1WXV A;  2KC2 A;  4DHJ B;  2GOW A;  1OTR B;  2DYB A;  2ZNV B;  4WWP A;  3U8Z A;  1M94 A;  4FHJ A;  1RLF A;  1WXS A;  1SIF A;  2Z59 B;  3EHV A;  2BYF A;  3NHE B;  1J0G A;  2MQJ A;  4BOZ B;  2L76 A;  2FUH B;  3A9K A;  4NAW A;  2KLG A;  2NS5 A;  3IFW B;  2L7R A;  3W1Y A;  3HM6 X;  2YLM A;  2KLC A;  1V81 A;  3A33 B;  2D10 A;  4NPN A;  2OJR A;  5HKH A;  3U7D A;  5AZF A;  1YD8 U;  2KFK B;  3QWZ B;  3ENE A;  2ZVN A;  2N9X A;  3K9P B;  5FR6 A;  2IO3 B;  3BY4 B;  3TMP B;  1GUA B;  2KFJ A;  3ALB A;  4EZL A;  5LXH A;  3N3K B;  4IM0 A;  3R7R A;  4IUM B;  4MGI E;  2BKR B;  1UH6 A;  4DHJ D;  2DZM A;  2KMC A;  3L17 A;  5D2M B;  2KAN A;  3DPD A;  1FXT B;  1V49 A;  3CSF A;  4KZ0 A;  4I6N B;  5DPR A;  3RZW C;  3VFK A;  3ZO5 B;  2C9W B;  1MG8 A;  1V5T A;  4LCD E;  4ANV A;  3JYU A;  3T9L A;  4ANU A;  1TGZ B;  3PZD A;  4FUL A;  4TUU A;  1E8X A;  3AXC A;  2J7Q B;  2KO3 A;  5DPT A;  3DOW A;  2BGF A;  3PV1 A;  2CHX A;  4KSK C;  2JWZ A;  2DAJ A;  2CKH B;  1OQY A;  3VH3 B;  3V61 A;  2KTR A;  2BYE A;  1IP9 A;  4BBN F;  3SU8 X;  2O2V A;  2PEA A;  2WX0 A;  2LAS A;  4EFO A;  2IY1 B;  3NY5 A;  4GDK B;  2JF5 A;  3RD2 A;  1EO6 A;  2J0K A;  2LGD A;  3K9O B;  2AWT A;  3ECI A;  4BOS C;  1P0R A;  1WY8 A;  2WYQ A;  2FCM A;  2UYZ B;  1F9J A;  1VCB A;  4M0W B;  2KX0 A;  3U30 A;  1U4A A;  4DHZ E;  2K8H A;  4HK2 A;  2KOX A;  5G55 A;  2IYD B;  1HE8 A;  1WXA A;  5JHB A;  4HVB A;  4KIK A;  3CMM B;  1C3T A;  1V9J A;  2FID A;  2G4D B;  2KHW B;  2DYM A;  2Y5B B;  3MHS D;  4GGQ A;  3APC A;  3ZRC A;  2KMA A;  2LRW A;  1UGM A;  4PYZ A;  3VQI A;  5EDS A;  2C7H A;  1NI2 A;  4FJZ A;  5E6O A;  3PT2 B;  3V6E B;  1WR1 A;  4E3C A;  4HXD A;  3DVG Y;  4A3O A;  3R3M A;  1WZ3 A;  1IYF A;  1E90 A;  3A1Q B;  2KWC A;  1GJZ A;  2MLB A;  1BT0 A;  2N1W A;  5CX3 A;  4FLH A;  4EUT A;  3H7P B;  5CHW A;  4F8C B;  3TL5 A;  1QZE A;  3ZVV A;  2G4S A;  2V1Y A;  3DBL I;  3QAR A;  2B3A A;  2NPT B;  4PS8 A;  3ZTC A;  4CHK A;  4F1S A;  1WX8 A;  2HE7 A;  1WFY A;  2BWF A;  2KN5 A;  2NCN A;  1LM8 B;  1GG3 A;  3KUZ A;  2KDE B;  4ANX A;  2LI5 A;  1WM3 A;  3GOE A;  4II3 B;  4RM8 A;  3VHT C;  2ZPY A;  3SDL C;  4GIV A;  2M1M A;  3WA0 A;  4GDL A;  2MBB B;  3WAM A;  4AUQ C;  2IO0 B;  4FA6 A;  2JVC A;  2DZJ A;  1KM7 A;  2MP2 B;  3PSE B;  4NY0 A;  5IAA C;  3ML8 A;  2NR2 A;  4WWO A;  1YQB A;  2KDI A;  4YL8 A;  4CYE A;  4W9E A;  2PJH A;  3L13 A;  2G3Q B;  3PRP B;  3SD5 A;  3ZW3 A;  3HHM A;  5CHV C;  4WQO B;  2KNB A;  4K7S A;  2K39 A;  5LLI A;  4PS7 A;  2CU1 A;  4GB9 A;  2ZPN A;  4W9I A;  4W9J A;  2IY0 B;  4NNJ B;  2FCQ A;  5J18 A;  2D11 A;  1J8C A;  3IG3 A;  3AUL A;  3DBS A;  1CMX B;  3NZU A;  2O6V B;  2KC1 A;  1E7V A;  4N9F 4;  2BF8 B;  1J19 A;  2VRR B;  2N9P C;  3WAL A;  1WGR A;  2CHW A;  3VVW B;  3IBE A;  3M62 B;  4I6L B;  4XZ4 A;  2MX2 A;  1EF1 A;  3QA8 A;  4ICV A;  2XK5 A;  2M0X A;  1WJ6 A;  4HCP B;  4FN2 A;  2IZV B;  4IM3 A;  1Z5S B;  2LXA A;  1WMH B;  1TZ1 A;  3UIN B;  2NVU I;  1NBF C;  3UQA A;  3PRE A;  2K8C A;  2EKE C;  4PS3 A;  4ZYN A;  2L00 B;  3ZTD A;  3PLU A;  2K25 A;  3LJ3 A;  1GC6 A;  1V5O A;  2KDB A;  2N4F A;  1UD7 A;  3JSV A;  3W1S C;  4MJS A;  4MSM B;  2K6Q A;  1Q1O A;  3L10 B;  4MH0 E;  4HCN B;  4E71 A;  4JIO U;  4DWF A;  3L0W B;  3N30 A;  4MGY E;  5AZG A;  2XBB C;  4XC2 A;  5TR5 A;  3QQ8 B;  1RRB A;  3ZLZ A;  2O6V D;  1RAX A;  2NBW B;  4BKS A;  2RD0 A;  1ZW7 A;  1WI0 A;  3RT3 B;  2ZVO A;  3A4S C;  3JSV B;  3OLM D;  3PRM B;  4IWO A;  4BBN C;  4KSL C;  3DCG A;  4W9K A;  3R66 C;  2CR5 A;  3P2B A;  2REX A;  3V60 A;  2LVP A;  1C1Y B;  2KJ6 A;  4MSQ B;  1YIW A;  3TJP A;  2EMT A;  4FJV B;  4W9G A;  2K6D B;  3AU5 A;  3R7Q A;  1EUV B;  2V3S A;  2XK5 B;  4KDI C;  2N7E A;  3KUC B;  3VUW A;  5C1Z A;  2DHZ A;  3ZDM C;  1WGD A;  2D2Q A;  1R4N I;  3APF A;  4M8N A;  1WRD B;  4GMV A;  3ZNH B;  1I35 A;  2DYO A;  1UEL A;  3PHW B;  4NQK E;  1V6E A;  1WE6 A;  2DX5 B;  2JUO A;  4FJY A;  4AP4 C;  4CO7 A;  1WGG A;  5KHQ A;  1LQB A;  3IHP C;  2MRP A;  4ZRK A;  2KTF A;  3D32 A;  3M3J A;  3OJ3 A;  4WJP A;  1KLV A;  3W1S A;  3X23 A;  3A9J A;  1S1Q B;  3PLV A;  2LUE A;  5L83 A;  3QIJ A;  2LVO A;  2MP2 A;  3A9J B;  2C60 A;  4KZC A;  3PVL A;  2BYV E;  2WX1 A;  1P1A A;  4GDL B;  1TBE A;  4W9C A;  1SGH A;  3DBR I;  3RYT A;  1WXM A;  1YJ1 A;  4DDI D;  1I42 A;  1UZX B;  2LVQ A;  3TBL D;  4ASW C;  2JY6 A;  2MBE A;  4KVG B;  3Q3J A;  2GBK A;  4HPM B;  3VXW A;  2KJR A;  4JL9 A;  3MJW A;  4K7U A;  1E8Y A;  2MBQ A;  3EEC A;  3H6N A;  4EZK A;  3APD A;  1GNU A;  1WX7 A;  3PRZ A;  3OJ4 B;  4G0N B;  4JLC A;  2ZCB A;  4BKG A;  5GMV A;  4IC7 B;  4FBJ B;  2L0T A;  4RMA A;  3KUD B;  4A3P A;  4IG7 B;  2KD0 A;  3X0W A;  2L0F A;  1OGW A;  4MGK E;  3DQV A;  4RM9 A;  1WJ4 A;  1LXD A;  2W9N A;  3RZF A;  2R2O A;  3UGB B;  3H7S A;  2NBV B;  4K7W A;  4W9F A;  2EMS A;  5D6J B;  4WJN A;  1V80 A;  2JRI B;  2JZ3 B;  4KIK B;  1UBI A;  1E8W A;  4DBG A;  2ZJD A;  2V4L A;  5DCN A;  2LRU A;  4DXA B;  3NS8 A;  2KK8 A;  1Q5W B;  2CHZ A;  2JPH A;  3EFU A;  3ZNG C;  3UQB A;  4IW0 A;  5D94 A;  4BKS D;  4AOF A;  5L95 C;  1WR6 E;  4GDK A;  4LJO B;  3TIX A;  3ZNI D;  4KV2 A;  4FHK A;  1WJU A;  3HIZ A;  1G6J A;  4W9H A;  3NOB A;  3AI5 A;  2KWU B;  4MGZ E;  3NZS A;  4II2 B;  3LDZ E;  4ZRI A;  1WIA A;  3A4R A;  2GBR A;  3CST A;  4MJS B;  2FCS A;  3SHQ A;  2KXJ A;  2HTH A;  4M8M A;  4DK5 A;  4JQW C;  1ZGU B;  2WDT B;  2C5L C;  3H9D A;  3HK0 A;  3JW0 X;  3RUL A;  3RUI B;  4WWN A;  2M8S A;  3B0A A;  1WMH A;  4HDQ A;  3VTV A;  1WGH A;  3QC8 B;  1WE7 A;  4GXB A;  3V62 A;  2Z0E B;  2LJ5 A;  2MCN B;  3WIM A;  2J0M A;  3MTN B;  1T0Y A;  4K1R B;  2AL3 A;  3B1L X;  2A4Z A;  2IO2 B;  1WZ0 A;  2BKF A;  4F7Z A;  1OEY A;  3KVF B;  1RFA A;  3WAN A;  2IO1 B;  2O6V A;  2MW5 A;  4WAA A;  1L7Y A;  3VUX A;  5J2R A;  2M17 A;  2AYO B;  3DVG X;  3GZN I;  3KW5 B;  3UIO B;  1D3Z A;  2BWE S;  2I1J A;  4NJ6 A;  5LXI B;  5JHA A;  4G3X B;  3JVZ X;  2C7M B;  3L54 A;  1KOT A;  2MWS B;  1V86 A;  3ZUN A;  4B9K A;  3N32 A;  2FIF A;  4GSW A;  4IM2 A;  3ZKJ C;  4ZRJ A;  1OEY J;  3A9K B;  4NAW B;  4TV3 A;  1SE9 A;  1WX9 A;  4MEM A;  4FAD A;  4TQ0 A;  1ISN A;  3KH0 A;  2RSU A;  2LD9 A;  2HD5 B;  2JT4 B;  5BO4 B;  5G2N A;  4KDL B;  4G11 A;  5KHO A;  1YX6 B;  3IVF A;  4NQL B;  2N9E B;  4HPL B;  2K1F A;  3OAW A;  1E7U A;  3PPA A;  4K81 A;  4URK A;  2L8J A;  3QCA A;  2PPH A;  2RR9 A;  1IPG A;  1P98 A;  4GOC A;  3DDC B;  1AAR A;  4AJW A;  4LDT B;  1LFD A;  2RGF A;  4EZJ A;  2NPT A;  3T8M A;  4EEW A;  1NDD A;  2L3Z A;  1TTN A;  3H7P A;  2L05 A;  4MM3 A;  3Q3F A;  4J6I A;  3WAP A;  3ZDT A;  1E8Z A;  2Z0D B;  5E6P A;  3A1Q A;  3S2A A;  5IA7 A;  3ONS A;  2J0J A;  4TQ1 A;  2BPS A;  1P3Q U;  4B6W A;  4MDK E;  2NBU A;  1P9D U;  5JZE B;  2PE6 B;  2MBO A;  2ZCC A;  3DVN U;  2CS4 A;  3PS6 A;  1WM2 A;  4OVV A;  4TKN A;  4ICU A;  1WYW B;  4ANW A;  2WWZ A;  1VD2 A;  3PTF C;  5CTR C;  2LXC A;  5AEK B;  3DBH I;  1L2N A;  3QJZ A;  2G45 B;  2MSE D;  4AJY B;  2KVR A;  4W9D A;  2KX3 A;  1A5R A;  2HJ8 A;  2M4N A;  2JRH A;  3PGE A;  2ZEQ A;  4P7I A;  2PE9 A;  3L16 A;  1Y8R C;  4NJ7 A;  4DHZ B;  3RCZ A;  3KYD D;  1R4M I;  1KJT A;  4G50 A;  2UWQ A;  2LZ6 A;  2O2V B;  2IBI B;  2ZNV C;  1XD3 B;  3QK0 A;  2KTR B;  3I3T B;  2C7N B;  2GMI C;  1Q0W B;  1WF9 A;  2FAZ A;  3VUY A;  2KKC A;  2GBM A;  1V2Y A;  3UIP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...