1IPFA

Tropinone reductase-ii complexed with nadph and tropinone
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
259
structure length
259
Chain Sequence
AGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSERQELMNTVANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPEQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMANCGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPINONE REDUCTASE-II
publication title Capturing Enzyme Structure Prior to Reaction Initiation: Tropinone Reductase-II-Substrate Complexes
pubmed doi rcsb
source organism Datura stramonium
molecule tags Oxidoreductase
total genus 99
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 1.1.1.236: Tropinone reductase II.
pdb deposition date 2001-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ipfA00
1DJNA 4I9NA 1GL3A 2DU8A 3WYBA 1LDYA 2DPHA 2W8ZA 1VL6A 4WE3A 2EP5A 1T4BA 3OJOA 1E3WB 1E5QA 2Q1SA 3ASVA 3AUTA 3WIEA 3V1YA 2WSBA 2R00A 4E4YA 3JD4A 2YHUA 1R4MB 3ZW8A 2Q1TA 2RIRA 4L0QA 4EYEA 3GLQA 4P4LA 2BI8A 2O3QA 1EVIA 2VYND 4FFRA 4YQYA 3RBVA 4DQXA 2LDBA 4IUYA 1T2DA 1A71A 1XHLA 3MJ4A 3A4VA 4R16A 5T5QA 4Z6KA 3KLPX 4J90A 3WQRA 4BGVA 4FC7A 3KV3O 3VVCA 3K9QO 4FSHA 4J4HA 1HE5A 2NTNA 4OSPA 2VHXA 3H9EO 2V65A 3I4CA 3OP4A 3ONEA 3IJRA 1A5ZA 2V6GA 2VNAA 3NJ4A 2AXQA 1ZVMA 1GCUA 1U28A 4MDHA 1I5RA 1NM5A 1HL3A 4AJHA 1FK8A 1M67A 4XQCA 1ADFA 1UXKA 4DLAA 2GF2A 3AY6A 4N5NA 1BTOA 1HEUA 3FD8A 4B3JA 1H5QA 1XWFA 3PXXA 2PD3A 4EUEA 3NTQA 5IXYA 3OA0A 1CYDA 3VVBA 1HE2A 3D3EA 2VRCD 3KETA 2OO5A 4J1QA 4PRLA 4FFOA 1NBOA 4MIYA 1Y9AA 1YB4A 2X9VA 4PZEA 4IZHA 5IZCC 4L8VA 2YUTA 3A14A 3QWAA 1DLIA 2HMSA 3R6DA 3S1LA 4D42A 1DEHA 1XA0A 4JCOA 1Q7CA 2D2IA 4E2YA 4B7CA 5JMPA 1U5AA 5CG1A 1LDNA 4TWRA 2HK9A 2IZ1A 2Y1DA 2ZYAA 5DBFA 5MDHA 4U5QA 3ZU5A 5EPOA 1ISGA 3KM0A 4LK3A 1LLCA 1O0SA 1BVUA 2AE2A 4NK5A 4E5NA 4TROA 1H94A 2HCTA 3PHJA 2VWGA 3AK4A 2X58A 4N54A 1M66A 2AEFA 2HMVA 1S7CA 3GEDA 3OEWA 4IIVA 3PGXA 1IPFA 3RAJA 1S6YA 4E0BA 1BXKA 4PG7A 4GSKA 3DBRB 4YPOA 1V3VA 3NYWA 1IHYA 3I3OA 4ND5A 2YV2A 2HDHA 3BMOB 4NU6A 2ZYGA 4NBUA 3RUFA 3OJEA 4LCEA 3S2IA 5FFFA 2ZJ0A 3UW3A 5DBIA 4BNKA 4CMJA 3QHAA 3OH8A 2VZ8A 1Z75A 1P1HA 4GH5A 3ZWBA 3RSHA 3WGYA 1YWGO 3FPLA 4PG5A 4BNLA 1FF9A 3EAGA 4BKQA 4E12A 3N58A 1Z6ZA 4BNMA 4JGBA 3IQDB 2OUIA 2GD1O 2Y1CA 1GYPA 1VPDA 2QZZA 3WLFA 4CMEA 4YRBA 4J1TA 3NKLA 4AJPA 3OSUA 3WGIA 3IOYA 1HXHA 3OIGA 2E82A 4KTTE 4EEXA 1UAYA 2OZPA 4DUPA 5IXSA 4FCCA 4Y6PA 4R3WA 5DP2A 3RFTA 3WSVA 3OEYA 3HG7A 3QRWA 4I8XA 4DREA 5GY7A 3ITDA 4KUGA 4HV4A 4CMAA 1CEQA 1XG5A 2J5KA 3WGHA 4R1SA 1E7YA 5G0WA 2PV7A 1H6AA 3WX0A 3KTDA 1E6UA 1DLJA 3DAFA 4A73A 1Z82A 4DGSA 5KVSA 3DTTA 3GG2A 2X0RA 2Y1GA 1JWAB 2BHLA 4DLBA 4R41A 1F0YA 2FRDA 1C0KA 2B37A 4J7XA 3UHAA 5I9MA 1JU9A 1GZ3A 4CMHA 4BVAA 1SB8A 4BO4A 1XSEA 3CE6A 4PZCA 2WWRA 1E5LA 4NFSA 3IMFA 2E37A 4YCAA 4RDIA 3PK0A 3ZWOA 4GGOA 2ZB4A 1DRWA 3QWIA 5KNLA 4WKGA 4EJ6A 1SO8A 4CR6A 4S1VA 1V8BA 1CF2O 1HDZA 4FS3A 2HU2A 1TB4A 1Y8RA 4A5OA 1SNYA 4R4JA 2FP4A 2HRBA 2ZIZA 1UDBA 3AM5A 4BNVA 3ZWVA 5L9AA 3GK3A 2BFAA 4YJDA 4AJEA 1A9YA 2O2SA 2PZMA 4AJIA 5EINA 1P3DA 2CNBA 3WWYA 5F1OA 1IHXA 2I3GA 3ETDA 1C1DB 4NBVA 4MJLA 3BXXA 5KKCA 1GDHA 3JYNA 2Y66A 4UVHA 4J16A 1T2CA 4FPXA 1YOVA 3M2PA 1AE1A 1C0IA 1KOLA 1NFFA 3MWEB 4Z9FA 3GZ4A 3PHGA 4KZPA 1ZEJA 1EVJA 4FR5A 1JVSA 1QLJA 1T1RA 1N1EA 1XKQA 2DTDA 3C7AA 3KHUA 3MJSA 4Q3AA 5I7SA 4KQXA 3PHHA 2ZJ1A 4LRTB 1IZ9A 3ROPA 3NT2A 4OM8A 4MVJG 1DRVA 1K3TA 4WK6A 3TFOA 4K6FA 3WMXA 4LSWA 1CJCA 4XA8A 5BSFA 3JD1A 5I8ZA 4GKVA 2EV9A 1SOWA 1U3VA 3IUSA 3O03A 3WG9A 3FBTA 3L6OO 4CL3A 2C2YA 4PN3A 1KEPA 2TMGA 4WUVA 2R6JA 4ND1A 2X4GA 3B20A 1WNTA 3TZQA 3I9NA 2EKPA 4M55A 2Q99A 3C8MA 3TL2A 4XYGA 5JYEA 2F1KA 4QFDA 4LVCA 1XIVA 2GO1A 5CEJA 3G79A 3O38A 5LDHA 1UJMA 1PL6A 2PTGA 1SAYA 3VDRA 4HY3A 5AXBA 4XR4A 4O1MA 1B8PA 2J6IA 4OIMA 1GZ6A 4EUFA 2HUNA 4ZJUA 3UUWA 4B7UA 4IXTA 3DL2A 3CMCO 5IZ4A 4IDBA 3I1JA 1PSDA 3L6EA 5G0TA 1EUCA 3BMNA 1QYWA 1VI2A 4CQLB 2PH5A 1EFLA 4BV9A 5HTOA 1U4OA 3CMMA 4M8SA 1YS4A 3ZNNA 1CWUA 1FMCA 2YV1A 3ZNPA 1NQOA 1P44A 2QYTA 4NFYA 3PYLA 4F6CA 1JLLA 1VM6A 3ASUA 1BG6A 5CG2A 2JCVA 2NTVA 3VPGA 2DTEA 3RKUA 4I9HA 3ETEA 2ZYDA 4J4BA 4M89A 5T8KC 4ALNA 2EIHA 2F00A 2NVUA 3ZH2A 1LDEA 3VTZA 3JQ8A 2YQ4A 1E7MA 2QRLA 4RF2A 4WCDA 1I3NA 2W90A 4DPKA 1LRLA 4BNGA 3QWHA 4KUHA 1P1FA 2W4QA 1H2HA 3PPIA 4MP6A 4ZRMA 3VC7A 4WLFA 2P4HX 3AOEA 4G5HA 4CV0A 4XDYA 4CUZA 1Q1NA 1T2AA 1PJ3A 3BYZA 3V8BA 4ZD6A 2YZ7A 5CP8A 4XYLA 2Y0EA 1N7GA 3FBGA 3LC1O 2A4KA 3V1TC 4DYVA 2VHVA 1Y8RB 1QXSA 1QYCA 4LMRA 4MIEA 5ENVA 3ZV4A 5KVQA 3PJDA 1IB6A 2QG4A 4EDFA 1MFZA 2GN6A 1N5DA 2UUPA 4RDHA 5L3ZA 3BHMA 3JQAA 2O3RA 1E1MA 1DDOA 5LDGA 3VH3A 3VZQA 1R6DA 3KYCA 2DFDA 3LF2A 4PLZA 3RD5A 3ZWYA 1SPXA 2QQ5A 1W8DA 4I9UA 2JAPA 3EHEA 2BFOA 3GZNA 2HJSA 4YT2A 1QR6A 2Q1WA 4P38A 3IS3A 4HFJA 5TT1A 1TA4A 1F17A 4GKBA 4QUKA 4FFNA 1PX0A 2G0TA 1KYQA 3OBBA 1GUFA 4W9NC 3IJPA 5TS3A 3NJ8A 2EKQA 1UXIA 1LQUA 3JSAA 3JD0A 5DP1A 2D5CA 5IFLA 1PZFA 1PGPA 2AQ8A 2CVOA 2X0NA 1BDMA 3ICPA 4IIUA 2CF5A 4F46A 5TIIA 2O3TA 2JHGA 1ZW1A 1J0XO 1NPDA 3TL3A 4L4RA 1LDBA 4TMFA 5TQVA 5DCWA 3GEGA 3WQQA 2E48A 1SOVA 5TT0A 5JYDA 3GT0A 1E1NA 1H6CA 2FR0A 5DZSA 1UXGA 1T24A 2ZQYA 3ROMA 4PG8A 3BMCB 3TWOA 5GZ3A 3CUKA 5L53A 5JAMA 3DC2A 3EYWA 3WWZA 3WBBA 1V3UA 4CM9D 4BNJA 3ADPA 4PRKA 4FGSA 4UAGA 5L7TA 1ZK2A 1PEDA 3H3FA 1PU2A 2CF6A 3CXRA 3GQVA 1PWZA 3E9NA 4EBFA 3E03A 2NV6A 4IDFA 4MVJF 5EN4A 3PJFA 3VPXA 1EDOA 1DAOA 4YACA 5TGDA 3OECA 2LDXA 4EZBA 1NFRA 1DC4A 3HSKA 3RUIA 3BMNB 2JKVA 3PWSA 1ADBA 5T67A 3G0OA 4W4TA 4LGVA 3H8VA 2FN7A 2JCYA 5ENDA 8LDHA 4JROA 2X7HA 4LN1A 2QIOA 1ONNA 2VYVD 1ZK4A 5DT9A 4M86A 5DCYA 1W0CA 4B3IA 2HRZA 4RZHA 4Z9XA 5U4QA 1HYGA 2NVUB 4WLUA 5AYVA 1Y5MA 4DRYA 2AQKA 2WTBA 2WEKA 3ZWNA 2VHWA 3JQ8B 3UFXA 5JY1A 2GZ2A 4R1TA 4RZIA 1YJQA 4WPGA 4OQYA 1LQTA 1BRMA 3T7CA 1PWXA 4B4OA 1NVGA 1AHIA 3R3SA 1O9BA 2X0IA 4AG3A 3AI2A 5F1PA 1HSOA 4RO0A 3D4PA 1NR7A 3P2OA 1VJTA 1NQTA 1NR1A 2YV3A 1MUUA 1GCOA 4J7UA 4E13A 2JFFA 4TQGA 2FPIA 1U3WA 1UP6A 1I3MA 5CDUA 1FXSA 4Z0TA 3DQPA 3E48A 2ET6A 2VWHA 2BFMA 2WMDA 3ZWMA 1V3TA 3DXFA 3QVTA 4U6SA 1L7EA 4Y6SA 4UEKA 5A4DA 1Y5RA 5KVVA 3D0OA 1P31A 2GN9A 3JQAB 3K31A 5CHEA 4XQGA 5I7FA 3AOGA 3KYCB 2X22A 3LVFO 3E82A 3H5RA 2I67A 1DB3A 5T57A 4OYRA 3NX4A 2JD2A 3EW7A 4XDZA 1PS8A 3VH4A 3WFJA 4XJTA 3ZU4A 4IGFA 4RJTA 1LLQA 3GZNB 4K6CA 3U0BA 4NJOA 3G1TA 3GMSA 4GLOA 5DF1A 1I10A 3SVTA 3D4OA 4CV3A 1HE4A 1E92A 1DIHA 2EJVA 1Y9EA 4JNKA 4I1IA 1DJQA 1WDLA 3Q3CA 4BNUA 3PJEA 2VN8A 3STHA 4DQUA 3ANLA 1O8CA 3BTVA 3NT5A 3SEFA 3W4IA 1IOLA 4GMFA 2NU6A 3GUYA 5KKAA 1E77A 3DOOA 3CIFA 4OOEA 4QEDA 1PJQA 3DBHA 3V2GA 5A06A 2DM6A 1EUZA 4BMVA 2AG5A 2QHXA 4BNWA 4NZ9A 1E1KA 4RPKA 3QQPA 1DC6A 2IDZA 3F1KA 3O8QB 4RF4A 5BSGA 3OJLA 3WYCA 3MJTA 5A02A 4BB6A 4II2A 4BHTA 4GLLA 1TT7A 4NBWA 1Q7BA 2DBZA 1LSOA 1UR5A 4UVGA 3RBXA 2FY8A 3H2SA 4QFCA 3BTSA 3IDSA 4ZQBA 2I9PA 5ILOA 2C7GA 1E6EA 1YRLA 4CM6A 4XQEA 5JSFA 2EF1A 4BO9A 5L7WA 4CQMA 1Q7GA 4YT5A 1LLUA 5T6BA 1R0LA 1KIFA 5AVOA 1XR3A 4WNCA 1I33A 2OGUA 3I9LA 4XB2A 1WMBA 4AJ2A 2PH3A 3I9JA 5JPIA 4WEQA 4MVJP 3AY3A 4Y6RA 3C7CB 1KERA 1VRWA 2YW9A 4OSOA 2PZJA 2IXBA 1HKUA 2H6EA 3ZN2A 3QVOA 3LLVA 4RVUA 1CERA 1I32A 4WOKA 4E2XA 1WDMA 1XELA 3JQGA 1EEHA 4AFNA 4YJFA 3PWZA 1DPGA 1EK6A 3V2HA 3GOHA 4ILKA 4N5MA 4TZKA 1YQXA 4GAEA 2XXJA 1DIAA 4XQ9A 1ISHA 3QP9A 1AXEA 4GWGA 1J49A 4J1NA 4CV1A 4KDFA 4CR8A 1SEPA 5JAIA 1EVZA 3AI1A 4B3HA 3E5RA 4F3YA 1PJTA 3RKRA 4B79A 3ZWWA 5IDQA 2QYSA 4YQZA 4QTZA 4NR0A 4PCVA 3GVPA 3LDHA 4UUPA 3DMTC 3AUSA 5IAAA 2GUGA 1KY4A 4JBIA 4KWHA 2QRKA 4QXMA 3UGKA 1DC5A 3GNSA 2QW8A 1WAMA 3HJAA 4ZVVA 4ID9A 4J9UE 4BKRA 4IY1A 2WYUA 4JJFA 4MP8A 3E1KA 5JCJA 1UAGA 3FTNA 4BQRA 1E7WA 2AEJA 5JS6A 2DTXA 1E0DA 3AW9A 4XGIA 3S2GA 9LDBA 2JFHA 5EERA 4YYZA 3AM4A 4A10A 1I8TA 3KLMX 2ZTLA 3ULKA 4J7CA 1HDGO 4CLDA 4DTIA 1L7DA 2GZ1A 3SC4A 3UOGA 2X5KO 4RPJA 3DR3A 3INGA 1GAEO 2RHCA 2EXXA 3S2FA 4BS9A 2JAHA 3S2EA 1VC2A 1EE9A 2B83A 3ZI0A 4QX6A 1YXMA 5JNLA 1MB4A 4MKZA 4Z3DA 4NHEA 4PLGA 3I4FA 5EESA 2GASA 4I5DA 2DBVO 3NT4A 1ZO8A 2EGGA 4NJMA 4CUJA 3TF5A 4BNYA 1M6WA 3G49A 1YKFA 1NPTO 2IZZA 2NU9A 3N74A 4KDEA 4O63O 4CM5A 5C3MA 2XAAA 3NUGA 5CPFA 5JAZA 5BSEA 2X9NA 1ORRA 4YJGB 4LMPA 4TKLA 4AJJA 1F14A 2YFHA 4HXYA 3DBHB 4BO6A 5JY6A 2A9FA 4J43A 2YYYA 3TOXA 1I01A 2A92A 2QX7A 3DTYA 4FFMA 4R01A 4RF3A 2V6MA 3RASA 4IM7A 3HN7A 1LRKA 1OC2A 4K1LA 1GPDG 1O94A 3VZSA 4BB5A 4HBGA 1ZK0A 5ILGA 2Y0CA 1KY5A 1ISJA 1EUDA 2X9GA 3LT2A 8ADHA 2ZATA 4PZDA 3JQ7B 2OMEA 1E7QA 3Q1LA 4KWIA 1PQPA 3T7EA 5ICSA 1B16A 3P5SA 3DFUA 4MVJA 3TN7A 3U4DA 4L74A 4GBJA 4HWKA 3H9QA 4CQMB 3F3SA 5TX7A 5F3RA 3PDUA 1B15A 4MVJI 3G17A 1XEAA 4A26A 3H9UA 3SJ7A 3ZW9A 3RJ9A 4M54A 4B4WA 2Y0DA 4I5FA 3GA0A 1LBEA 4OKNA 4NBTA 2XXBA 5JDIC 4O59O 5K6AC 1AUPA 1B8UA 2E6UX 1JQBA 1OZAA 3LQFA 5H82A 3F4LA 5T64A 4RF5A 2IEBA 3H7AA 2J5RA 3A9WA 3GAZA 1U3UA 3HFGA 5CDTA 3U4CA 3WYEA 3ZU3A 3GHHA 2PZKA 2I6TA 1Z45A 3JQGB 4YJFB 1R37A 3UCEA 3W1VA 2YDXA 3QSGA 4NH4A 1X7GA 1XLTA 2CMDA 3RUEA 2FZWA 3ADOA 3GH3A 3IP1A 3FNGA 1B14A 2FHSA 1N7HA 5IZCA 1B26A 2GR9A 1ZZEA 5LCXA 1W73A 4DMMA 1GV0A 3H6KA 4L75A 4LSMA 4YB8A 1KEVA 2PK3A 1RWBA 1HLDA 1LNQA 2NQ8A 3PZBA 4M49A 3RFXA 3SBOA 1IZ0A 1GU7A 2DC1A 1N9GA 5A9TA 1YBMA 1YONA 3ABIA 2GYYA 1X14A 3IAHA 5C7IO 2PKQP 2AW5A 1FDTA 1QLHA 2WYVA 1U7TA 4XYMA 5EQDA 4GVXA 1Z73A 3HZZA 1RPNA 3ANMA 5IG2A 1LXCA 3TPCA 4E5MA 1ZMTA 4OMUA 1WZEA 3LT1A 3K5PA 4U6QA 5U1PA 3AWDA 4CMBA 3H2ZA 4KP7A 3P7MA 3ROKA 1UUFA 4RPGA 1HDRA 3MZ0A 4DVJA 1B7GO 1IE3A 4NBRA 3VPFA 1XCBA 4J2OA 4FW8A 1PJBA 5JDCC 3PHIA 4R9RA 3LZ6A 3WMWA 2TMDA 1NFQA 4YBZA 3COSA 4EGFA 3S8MA 2G76A 4XKJA 1JAXA 3L4BA 2BD0A 3TRIA 1C1XA 1R0KA 4O5OA 1IY8A 5H83A 5HS6A 4NJMB 4ONEA 4BIIA 3GY0A 1R66A 2VUUA 1CRWG 4LCJA 1U3TA 3MEQA 3I5MA 4N5LA 5DDIP 4DIFA 4R68A 4UVEA 3ZZNA 3DMYA 3C85A 5CDSA 3N7UA 3WTCA 2NVWA 2VRBA 2H9IA 5KJEA 5KJ6A 1NAIA 2G82A 5TSDA 4H7PA 1ADCA 3QW2A 3BHJA 2FR1A 1CETA 1HZZA 4QSMA 1XDWA 3TQHA 2GNAA 2D8AA 4FN4A 2DUWA 3V2UA 3GVCA 1H6DA 4YEDA 1UP4A 3RC9A 1EQ2A 2O2YA 4GWKA 3UICA 3VOSA 3DDNA 3D5TA 3Q2IA 3QE3A 3RFVA 1I2BA 1WDKA 4OJNA 3TZHA 5I7EA 3ZDFA 3WIDA 3FHLA 1TEHA 4WCFC 4LRSB 1ZEMA 4R51A 3K8ZA 3W4JA 4D41A 5C5IA 3QWBA 1ARZA 1F12A 3C24A 1X0XA 4M1QA 4AJ1A 3JQ9C 5JBIA 1QG6A 5G4LA 3MOGA 4YA6A 4UUMA 4K28A 2DPGA 1DIRA 4H3VA 5CEFA 2CSUA 2Q45A 3JTMA 4KMSA 1GQ2A 3TNLA 5GZ1A 1P0CA 2IODA 1PJ2A 1WW8A 3K6JA 3JYOA 1BWSA 4BNTA 4IJUA 4TSKA 1D8AA 5IDWA 1AN9A 1WMAA 4E31A 2RBEA 4CLOA 5A04A 2B4RO 3WLEA 3CTMA 4W82A 4DPMA 3WJAA 3H9JA 1YQGA 2Z1MA 5B4TA 4YRDA 2ZB8A 2VTEA 3W8DA 3Q9NA 2Q2QA 4E21A 1AGNA 1DXYA 5TC4A 1P45A 3WICA 3UXYA 1RYEA 5AOVA 3UCFA 1UH5A 3KVOA 1GY8A 3ST7A 3PRJA 4ZHSA 3KXDA 4Y8VA 1CDOA 2OORA 3BTOA 1ZMOA 1HDOA 1QYVA 1N9GB 4XX0A 1BDBA 1B3BA 5MGBA 3DFZA 1I3KA 1PJCA 3AU8A 4D46A 1ZXBA 1OOEA 4MO2A 3NGXA 1C3VA 1ZJZA 4FDAA 1QRRA 3ONDA 4J49A 2JJYA 1QYXA 1HF3A 2ZTVA 2NNLD 1LC0A 1YGYA 4FFLA 3U4HA 4RLSA 4BNZA 1PTJA 3HB4X 4TRMA 2QRJA 3FNHA 1PGQA 1G0NA 4ITUA 4ALKA 1YE3A 3FI9A 4BO0A 1M75A 1NHWA 4J4TA 5C37A 1CQIA 3BAZA 4FD3A 2J3HA 2V6FA 3EUWA 2BGKA 4GX0A 4XIJA 3OIDA 2NM0A 3DZBA 1P33A 3G3EA 1RM4A 4CM3A 5HWSA 1MG0A 1C1XB 3CPSA 1P0FA 1U8FO 4MIOA 1TLTA 3KYDA 1GQYA 2AQIA 1I0ZA 2EEZA 3ZWAA 1IULA 1ISIA 4JJIA 1EE2A 2AMFA 4Q9NA 3FN4A 3HADA 4PG6A 2FSSA 1NQ5A 2DBQA 5H81A 4IINA 2C54A 1I36A 1U4SA 4BNFA 2Y68A 2VWPA 2PGLA 3D4NA 3JQDA 4YAJA 2NWQA 1YL5A 2EG9A 3R0IA 1NVMB 4OL9A 4P4GA 1LDMA 1HZJA 3OQ6A 4BGUA 4EW6A 3VZRA 2X86A 4HKTA 2OHXA 1MC4A 5DBGA 5BT9A 2Y1EA 4R54A 1ZSNA 1K6IA 3RUHA 3NAQA 5EL0A 3M1AA 3I9MA 4BQPA 7ADHA 2YFQA 1A4IA 3MCVA 2NTJA 3GVIA 4P8RA 3DZKA 2OP0A 1YOVB 1T4DA 2EERA 3F5QA 3EZYA 4Z0PA 1I2CA 5DNAA 5L51A 3PEFA 5BNIA 2G17A 1V0JA 5GMOA 1BXZA 4XRGA 3JYLA 3IP3A 4Q3DA 2ZB3A 4J3FA 1KBZA 2AG8A 3OJ0A 1O95A 3SJUA 1RJWA 1ML3A 4YAEA 1LRJA 1DC3A 4GL4A 4TRNA 1NHGA 3FWZA 4R1UA 3LLSA 2EKLA 4GPD1 2O3JA 5CPBA 4FOSA 3EC7A 1OMOA 1EBFA 1HLPA 2FOIA 2JD0A 3ZWXA 3CZRA 3JQEA 5BQFA 4CLOB 4TVBA 1D1TA 2VNSA 4KTVE 4D0SA 3MTGA 2D59A 4E3ZA 1Q0LA 5G0VA 4TZTA 2OFPA 3X2EA 4RGBA 4UVDA 1PJLA 1BGVA 2C7VA 2X6TA 3AUAA 3RUAA 4UEOA 4II3A 1AHHA 3F47A 2B35A 4IS2A 5G4KA 2PFGA 1NASA 2EWMA 3JQAD 4DBVO 2HMUA 4LVUA 4W9NA 4D3FA 3DZIA 4D43A 2W98A 5JMWA 3B6ZA 4BGIA 3QWFA 5B12A 4GX2A 3K73O 4L4SA 3VH2A 4J6FA 3W6ZA 4CMGA 2I5PO 3WGGA 3UVEA 4MVJH 1KVRA 1N1GA 1KETA 4D7AA 2RAFA 2CVZA 4CLRA 5JW6A 5COAA 2NVBA 1YH3A 4D0RA 4EJ0A 5DCUA 1XU7A 1HSZA 2CUKA 1LLDA 3NGLA 4XB1A 5EJ2A 5AXDA 4BO3A 1NVTA 4PLCA 5JCXA 4Q3BA 3F9IA 1PS9A 3F4BA 3AFNA 4R3NA 2Q1UA 5KJFA 5A03A 1K6XA 5HA5A 3U3XA 1G0OA 2CDCA 3FNEA 1UZNA 1KEWA 1T2EA 2P5YA 5HS4A 1BW9A 1TVEA 4AJLA 3PHLA 1YDEA 1LC3A 3U49A 3KYBA 3D7LA 3DEYX 2FZEA 2NQTA 2B5VA 2YY7A 4YAIA 2OXIA 4FQ8A 4IQGA 3LT4A 5THKA 1Z7BA 1WLYA 3KYDB 4F45A 1Z7EA 4L76A 5IDYA 5COBA 2BGLA 5ER6A 1HE3A 2DQ4A 2IZ0A 5I8WA 2FR8A 1PR3A 2G1UA 3OHSX 3WS7A 3ZU2A 3C1OA 2EW2A 2Q50A 3WOHA 1ENOA 1ID1A 3WGOA 2PKRA 4JP3A 1NPYA 1I30A 3BTUA 4C4OA 4IGEA 3PI7A 4IDAA 3RUCA 1PGNA 4A03A 2D4AA 1T2FA 3FPCA 4ZRNA 3DHYA 1YBVA 4L4XA 3UF0A 4PVDA 4RPLA 4BNHA 3GFGA 1DO8A 2O3UA 3GFBA 3L4SO 2CY0A 3AU9A 3B1KA 4ZA2A 2JHFA 3AI3A 1Q0QA 4MKXA 1NAHA 4MOWA 1KC3A 3I23A 4NMHA 5AQ1A 5JC8A 5KIAA 2J3IA 5L40A 4OKIA 4WLVA 2EGHA 4E2ZA 5L45A 1A7AA 3BHIA 4ROSA 2AEMA 3RCBA 3WNQA 4CPDA 2GCGA 3PQFA 1K89A 5AXCA 1OFGA 1PGOA 5KJCA 1FDUA 3VDQA 4YT8A 3SXPA 3PTZA 4PG4A 4KUEA 3PJGA 4LISA 4IQ0A 2PLAA 4TVOA 5COQA 4Q3CA 2W2KA 1EMDA 1MX3A 4RLHA 3EVNA 3QA9A 4YR9A 2B4QA 4BKOA 4UREA 3FR7A 3PFFA 4AICA 2IRWA 4FC6A 5G4KB 1O6ZA 2BMAA 3IIEA 1GUZA 3PZRA 4I5GA 1H6BA 1QP8A 1ZXLA 5G0UA 3KB6A 4WNIA 1MV8A 4Q3EA 1JKJA 4ZQHA 3ZV5A 4BKUA 3EDMA 5A5EA 4CLRB 1MXFA 4URFA 3HDJA 1HWYA 1U2DA 4IZIA 3D64A 5JO9A 2IYOA 5TRTA 4UULA 1DRUA 1EQUA 1OI7A 1DFHA 4FJ1A 1XU9A 4HP8A 3VH1A 3WR5A 1QV6A 1U5CA 1YJ8A 9LDTA 4BL5A 4IMRA 3M6IA 1E3SA 4RQTA 5CFZA 3LK7A 1LUAA 3GDGA 3MJCA 3QJ5A 4RQUA 4JN6B 3AM3A 2NSDA 3UH1A 3I6IA 2BKAA 2P68A 3JQFC 3U62A 2GPTA 3WTBA 3HDYA 3VZPA 4R69A 1BW9B 1ZSVA 1GYRA 5FF9A 3SLKA 1Q2XA 5L7YA 2HJRA 4DL9A 1DIGA 4GVLA 1LI4A 5TJ9A 4U8GA 4A27A 4FJ2A 3H3JA 1TT5A 2I99A 3GRKA 4CM4A 4JLWA 3DHEA 3JYPA 2NUAA 3SX2A 4DQVA 1LTHR 1U9JA 3QV1A 4BO8A 4CQMD 1T26A 1UXJA 3GN2A 2E4AA 3GG9A 2NACA 1F06A 2ZB7A 2Y1FA 3KSUA 2VYNA 3TOZA 5A1TA 4PFJA 1JVBA 3CINA 4Y98A 3WB9A 4CM1A 3Q2KA 4B4UA 3I9KA 3D5QA 2ZTMA 3IKTA 4YXFA 2C59A 3JQ6A 2A35A 1B2LA 2R00C 1R12A 2YHIA 3C3XA 3JQBA 4XYBA 3WNVA 3GUCA 1PS0A 2H63A 4IXWA 2CZCA 1YB1A 4RV9A 3BIOA 3HDQA 5G0SA 3H5NA 4QO8A 1NP3A 2DLDA 3CH6A 1Q0HA 3ZNQA 4U0KA 1MGOA 4YT4A 4IBOA 5I9LA 1ISMA 4RVDA 5J23A 1SEVA 4U7WA 2B4TO 1P77A 1C0PA 3H5AA 1E3EA 4WECA 3L9WA 4GX1A 4NFHA 1KVUA 4O6VA 2VRCA 5CDGA 4IS3A 1YDWA 2C82A 1I3LA 2E49A 1P9LA 3RROA 2O7SA 1ZCJA 1R4NA 4XCVA 2DAPA 7MDHA 1TXGA 2BLLA 4RCVA 1YB5A 3F5SA 2HLPA 1N8KA 2HSDA 4UUNA 1H2BA 2CD9A 3HB5X 4JBHA 2B36A 3GDOA 3VAZA 2W2KB 4BNXA 1LSJA 2P2SA 3ZHYA 2AA3A 4IDDA 3O4RA 4L73A 3IC5A 4QT0A 4E5YA 1HRDA 5JCJD 3GHYA 2GN8A 5LC1A 3U4IA 3ZV6A 3AY7A 1GD1O 1U2GA 1D3AA 3NTRA 4ZQGA 3V5NA 4OXNA 4E33A 3Q9UA 2I65A 4BUCA 1HYEA 4HFNA 1DHTA 1X1EA 4YRAA 1ZK1A 2B0JA 3ZHBA 3DOCA 1O89A 4E5KA 1BHSA 3JD2A 1P1JA 2C0CA 1DAPA 3VHRA 1GQQA 1WZIA 5K0ZA 3DBVO 2WDZA 2JCXA 1OBFO 1NQAO 3ZV3A 5ITVA 4DA9A 4EI2A 1DHRA 3RQSA 3EVTA 3O26A 4H16A 2ZK7A 3DAPA 3GGOA 3DONA 1C1DA 2JFGA 2Q4EA 3QVXA 4KQWA 1D7OA 1T25A 3L6DA 4WLOA 2J3JA 3FF4A 4NG5A 1H9BA 1UXHA 4MP3A 4HFMA 4S3MA 4J9VA 3WGQA 3PIIA 2FMUA 4RVFA 1A27A 1JAYA 1GYQA 4I5EA 3VPSA 4F6LA 1NWCA 2P4QA 3PIDA 3H4VA 4BMNA 1YVEI 5ICMA 1PL7A 4CV2A 4XGNA 3ICCA 1FDSA 3E18A 1N92A 2DT5A 5FWNA 4CMEC 1MC5A 1Y6JA 1YQDA 1P1KA 5JDIA 1TT5B 1J4AA 3ENKA 4NNJA 3GR6A 4CM4B 1WPQA 1EBUA 3LC2O 4YTEA 4CMIA 5K6AA 2JL1A 1A7KA 4MVJD 4C7JA 1E7RA 2VUSA 4Q39A 1B0AA 4JXKA 4FB5A 1ZKMA 3LF1A 3EK2A 1C0LA 1ZNQO 4AJOA 1SMKA 1X7HA 4QECA 4CMCA 1JWBB 3RBZA 5A5FA 1ULSA 3INTA 3AFMA 1PGJA 2DUUA 4GI2A 1E6WA 3B1FA 2UUOA 2CDAA 4OOFA 5A9RA 4HX5A 3DHNA 2X5JO 3GVXA 3PP8A 4NK4A 3BZUA 2J8ZA 1X15A 2YHIB 4BKPA 3KSDO 1QORA 4HADA 3RC2A 3L4BC 1BMDA 4FBGA 3B70A 4IDEA 1HTBA 4B4VA 1ZSYA 2G5CA 3GPDG 4PIVA 5C7OO 3C7DB 4DXHA 3PQEA 2GLXA 2O50A 1UDCA 3P2YA 5IN5A 4PLVA 3RUDA 1KVSA 1PQUA 3DWFA 2VHZA 4R9SA 1VKOA 2NU7A 1JA9A 4RVHA 3WSWA 2ZTUA 4PGFA 1N2SA 3GVHA 1YL6A 4CQLA 1RM5A 3ZWPA 5F5NA 4YJHA 1ZJYA 5CAEA 2VQ3A 1FJHA 4I08A 5B4VA 1MXHA 2OOSA 3MWDB 3WGZA 3TSCA 4ESOA 2PKQO 1ZH8A 1R4NB 2D0IA 1JW9B 2I66A 1E3LA 4WJZA 4JIGA 2WYWA 2PZLA 2C2XA 3F6YA 4XD2A 3TZCA 3WGTA 5A9SA 5DOVA 4Y67A 2VOJA 4A0SA 5ITWA 2HK8A 4XWYA 3GDFA 1KVTA 2Y67A 2CVQA 5TLSA 1WVGA 2Q46A 3FWNA 2NADA 5JDCA 1DBVO 1G1AA 3R1IA 3SC6A 5KCZA 3PVZA 1CQJA 1OAAA 4OH1A 5I9NA 2Y05A 1EZ4A 4HNGA 3RJ5A 1E1LA 1HT0A 4ALJA 4OQZA 1H93A 2UAGA 2VUTA 3W6UA 2C29D 4OHUA 3OA2A 4XJSA 5L4NA 4OAQA 4W99A 2RCYA 3FTPA 1ISFA 2WD8A 1JN0A 4ND2A 1LDGA 2FPPA 1SCUA 3I52A 1X1TA 1EK5A 5JLAA 2DBRA 1UDAA 2PR2A 1ZFNA 2I76A 3E9MA 1ENYA 4DBZA 2H1SA 4JX8A 4RVGA 4EEZA 2VOEA 4PLPA 4OXKA 4HNHA 4OGWA 3RC1A 4AL4A 3PYXA 5ES3A 3DZFA 3FNFA 2AHRA 3RU9A 5CDYA 3PYMA 4TRRA 3ANNA 3BA1A 3QLJA 3PLNA 5JFOA 3SLGA 4QQRA 2PGJA 3QIVA 4W7IA 4Q3NA 4XYEA 3PFWO 4H15A 4U0JA 3JV7A 3RI3A 1Y8QA 1LSUA 4IPTA 2Z1NA 1CIVA 3NDRA 3JCZA 4NPCA 2VWQA 4OO3A 4X54A 3CSDA 2DFVA 5DULA 3ZNOA 1JKIA 1QKIA 4WCFA 2O4CA 2OL4A 1B8VA 1FDWA 2Z95A 2X8LA 3TZ6A 3JQ9A 1D4FA 2HMWA 4CMIB 3GMDA 1RKXA 1K5HA 1W6UA 4WOJA 4PLTA 1A72A 4DC1A 2VZ0A 4NU5A 5FYDA 2QZ9A 3VKUA 1NX6A 4ZU3A 4BMSA 1PZHA 4GSLA 2GN4A 5THQA 2BF7A 2XPCA 4MPDA 3DZGA 2VT2A 3BMQA 4XGKA 2GSDA 1P1RA 1XGKA 3NTOA 3HDHA 3OICA 1DOHA 2P5UA 4NIMA 4IDCA 5EQFA 4WLNA 2W2LA 2RH4A 3ROQA 5HRUA 1Y81A 3BMCA 5F1KA 1U1IA 5IF3A 2GGSA 4CLXA 4Z9YA 2WE8A 5JAQA 4DIBA 4J2HA 1WWKA 1PZGA 3E8XA 1M2WA 1DIBA 4C7KA 3RVDA 3ZHZA 1H0KA 1VJ1A 1X7DA 2OBNA 3GAFA 3NDJA 2WM3A 3KOUA 3ZGYA 4G65A 2X0JA 4E32A 2D1YA 1VLLA 4ZQEA 1FDVA 3I9OA 3K92A 3WFIA 4CM7A 3AOEC 1W4ZA 5G2OA 5KOIA 2A94A 2VZ9A 4GQAA 5HM8A 1LSSA 3MJEA 2GZ3A 2DKNA 1IL0A 2HMTA 1X0VA 1YBAA 4D45A 5K9ZA 2BH9A 4W7HA 2XOXA 3AJRA 1ADGA 5A05A 1LU9A 3QVSA 4YJHB 2C5EA 1GR0A 2D3TA 4HUJA 3CZMA 3MTJA 3GF4A 4CR7A 2J3KA 2V6BA 3T4XA 3E9QA 3OJFA 3INRA 2ZCVA 5KTKA 4FOOA 4R1NA 1RYDA 1BXGA 1DSSG 2JD1A 3ENNA 5B37A 3QVWA 2P9CA 5A9SB 6LDHA 1ZK3A 3Q0EA 4D3SA 1ENZA 4CMKA 2BELA 1A9ZA 3H65A 2VT3A 1R15A 1F8FA 3OMLA 3RC7A 1UZLA 3NV9A 5ER9A 3DZJA 2PWZA 2W2LD 1O5IA 4A7PA 4JQCA 5T8KA 4Z3KA 2O48X 3DO5A 1ULUA 2FWMX 3U5TA 4J0EA 3UKOA 2BRUA 1QV7A 3QY9A 3ZWCA 2P91A 3PDJA 4DYDA 2GERA 2Q3EA 3KZVA 4XZ3A 2FSVA 3F1LA 3KUXA 2Y1OA 1JTVA 2Z5LA 4XEHA 3S55A 4YAKA 1VKNA 1LX6A 3KBOA 4D44A 3FSRA 1PIWA 2P9EA 1DFIA 4J91A 1T1SA 1GUYA 4WGGA 3OF2A 3OIFA 2HO5A 3ONFA 2X1HA 1RM0A 1BVRA 4IQ8A 3F46A 3VKVA 1HDXA 1PQWA 4DWVA 1V9LA 4PLFA 2O3SA 3ON5A 3HN2A 4K26A 1Y7TA 3R3JA 4J0FA 4CM9A 3OQBA 4Y9DA 1PL8A 2WD7A 3DZHA 1WP4A 3HNPA 3RIHA 4RVSA 1SZJG 4R5MA 4E6PA 4FFPA 3A28A 3OM9A 3WJ7A 4EUHA 5IN4A 1R16A 2EHDA 3A1NA 3W8FA 4BV8A 4E2WA 5KJ1A 1Y8QB 2FPGA 3JYQA 4M87A 3CEAA 4ZICA 3NRCA 1NYTA 5L95A 1GFSA 1DFGA 1G6KA 1V6AA 5CEEA 4WCFB 5JXWA 3ZHXA 4MKRA 4FIZA 1IUKA 3W8EA 3FRJA 3P19A 2VYVA 2UDPA 1I24A 4JJGA 3O8QA 3GRPA 4PLHA 1NTOA 2GRAA 2Q4BA 3DBLA 1XQ1A 2Q2WA 2WJPA 5TJHA 3DAGA 1JDJA 3KSZO 3ORFA 3OETA 4UEJA 3W4KA 2YJZA 3GGPA 1R0SA 4IMPA 1QMGA 4FJ0A 3BMQB 5JO0A 1NNUA 3KO8A 3K2EA 4CLHA 4EJMA 2BI7A 2PD6A 1PJ4A 1JKFA 3LU1A 3OFSA 4INAA 4FGWA 1MG5A 1VL0A 3M2TA 3PWKA 5FEUA 2OP1A 3OQ1A 3L0DA 2VTDA 3U09A 2YQ5A 5F5LA 4B8ZA 4PLWA 3LSYA 2O4UX 5TNXA 4JP2A 3HE3A 1VE9A 1GZ4A 5EIOA 4O0LA 1EFKA 5DN9A 1J5PA 3D3WA 1P74A 3G1UA 4PVCA 4ALIA 4RPHA 3HQ4O 4XR9A 1PZEA 2IXAA 3TDKA 3T4EA 2B5WA 2PGDA 1KC1A 5FI5A 1OC4A 5BNTA 4XIYA 1EVYA 3C1TA 2YDYA 2CFCA 2AE1A 5U9CA 6ADHA 1KVQA 2EW8A 2Q49A 1U8XX 3MOIA 2ZCUA 4RORA 2Y99A 3EZLA 2X5OA 4E5PA 2PD4A 1SBYA 3JQCA 5JE8A 4DC0A 3PGJA 5JC1A 3GEMA 4WLEA 2V7PA 2D5AA 4N7RA 1BXGB 5IJZA 5KWEA 1ZBQA 1Y1PA 4JBGA 1PR9A 4A2CA 4LW8A 1LA2A 4DLLA 1HDYA 1SB9A 2IYPA 3WDSA 2HK7A 2R2GA 1IPEA 3A06A 3UAGA 2CDBA 4G2NA 4G81A 3O9ZA 4ALMA 4Z0HO 4NQZA 3GC6A 4WEOA 4AVYA 1YL7A 2UVDA 4P22A 2C07A 4CM8A 4YVFA 2B69A 4CJXA 3GN1A 3C1AA 1GV1A 4ZN6A 2HAEA 4MVJE 5L4SA 4QO7A 4YDRA 4D3DA 2BFPA 4WASA 1M76A 2GDZA 2XF8A 3GPIA 3HUDA 3PLRA 3IL2A 3ZCXA 2POQX 4AJNA 1XYGA 4P4NA 4XRRA 1VL8A 3L9XA 3Q11A 5B4UA 4IJVA 1XQ6A 3WXBA 1GTMA 1MA0A 1E7SA 4GGPA 2BGMA 1H9AA 2PY6A 4NI5A 4BO5A 4CLEA 1GEEA 3IKVA 4OXYA 4MINA 1ONPA 3GGGA 1KEUA 3HHPA 1E3WA 3FR8A 3I83A 1LEHA 3H9GA 4R5HA 5TF4A 2Y93A 4CUKA 1K6JA 3UCXA 1M6HA 2ILTA 3JD3A 1C14A 1ZUD1 2WD7B 5B1YA 3EY4A 1HETA 1R4MA 2PNFA 3L77A 3GNTA 1GPJA 4NDNE 3U9LA 3ETGA 4RL6A 3E6AA 2C20A 2H5LA 2I3AA 3ITKA 3X2FA 4D79A 1X13A 2UYYA 4K9DA 5GZ6A 5IDXA 1D1SA 5DOZA 1MP0A 3TZKA 2C5AA 3NDIA 3RU7A 4YJGA 1MLDA 3LYLA 1RM3A 3CKYA 2AQHA 1P1IA 2EP7A 4E30A 3EMKA 1E3JA 2X23A 1BSVA 5ADHA 2WE7A 3L07A 4BGEA 1EDZA 1B3RA 2RH8A 2IEDA 3DBLB 5FI3A 4GMGA 1L1FA 5I7VA 2HQ1A 3TFQA 4DMLA 4ND4A 3VTFA 4TRJA 1NXQA 4ZQFA 3TJRA 1GADO 3M1LA 3JQ7A 4ND3A 3LC7O 3WQSB 1UP7A 5F21A 3K96A 4BNNA 3FCOA 1K0UA 3WBFA 4EITA 2IE0A 3Q6IA 3RWBA 4BOYA 3E5MA 5HBRA 1HDCA 5C7LO 3I6QA 4IJKA 5EMHA 4PLYA 4JK3A 3V1UA 4GX5A 1KS9A 4DPLA 3GNQA 1HYHA 1A4UA 2VCYA 1ZIDA 5AXAA 3EGOA 4UVIA 2Q2VA 1I2ZA 1V35A 2ZQZA 4CODB 1VSVA 5L4LA 2DVMA 3KEQA 4ZGWA 1WXDA 5BSHA 3VPHA 2O23A 3D3WB 3LT0A 2O7QA 1TI7A 1NWHA 4CL8A 1E3IA 1MFPA 4BO7A 4UUOA 3DOJA 4AJKA 4YWJA 4BNIA 2EJWA 2J5QA 1K2WA 5BNFA 2VHYA 1IYZA 4MVJM 4HFRA 2SCUA 3DBRA 3B1JA 1PJSA 1J6UA 4BO2A 3PQDA 3BMOA 3AUUA 1YO6A 3JQBC 4J1SA 4YAGA 4W6ZA 1Z74A 3MJVA 2RHRA 5A3VA 4KOAA 3HWRA 1GEGA 2UV8A 3JQFA 2P9GA 3NEPX 1AXGA 3KRTA 1VJ0A 1SC6A 5BR7A 4IJWA 4CM8B 5KVCA 3D1LA 4ALLA 4L9RA 1F8GA 2NLOA 2OBYA 5A3JA 3KEOA 4B8WA 4IDGA 3K2BA 2PA3A 2NU8A 1VSUA 1LJ8A 3IUPA 4AJ4A 3DB2A 2ZKLA 1ONOA 4BO1A 3DMTA 3K30A 1UZMA 1U7HA 4N18A 2HKIA 1QSGA 1ENPA 3HFSA 4DIOA 3UN1A 4B7XA 4TKMA 1QYDA
chains in the Genus database with same CATH superfamily
1DJNA 1XZNA 4M8NE 1A0OA 1XHFA 2DU8A 2GVZC 3FW1A 3PUZA 1G6OA 4AO7A 4EUSA 1LDYA 3AKEA 2BGUA 1VL6A 3GLVA 4Z8YA 5FNVF 2EP5A 2COUA 3BF8A 4BBZA 1LZKA 4DM4A 5AIBA 2QQEA 3Q7PA 5FRDA 3BFXA 5IPFA 2OCDA 4J8PA 3WK7A 1UPAA 1ORIA 3OQHA 5GM2A 2R8BA 3RS9A 4EKNB 1XCGB 2OVBA 1BEZA 2P9FA 4RFLA 4YALA 2R00A 3GEPA 5H70A 4EG7A 1R4MB 2J0UA 2BPOA 4MYSA 2B1JA 2GMWA 3KELA 4AYXA 4Z3OA 2TYSB 2O8BA 3CF2A 1FJGB 4MUGA 2C2WA 1XDBA 2BI8A 4KFRA 4FFRA 4C05A 4DQXA 1GZHB 1T2DA 4BN5A 1YF3A 3A4VA 5DHRA 2V3CC 1YVPA 2H4XA 2DWUA 1IZYA 2D1QA 2JJ8A 2ZIUB 4QJ5A 3W2IA 3JR7A 5KNCA 4JL5A 5HF6A 5EP2A 3OPVA 1ZJ4A 2VZEA 4FSHA 3R2JA 2BZSA 5TY0A 1UQRA 3I4CA 2ACVA 2QRPA 2P9TA 2ZRIA 4ZPXA 2V6GA 1NF2A 2VNAA 2IITA 3SVLA 2SHKA 1ZVMA 2G4CA 1U28A 3PXEA 4ZIRA 2O8FB 1RI4A 3K16A 3OD5A 2VJYA 4RNDB 1FK8A 1M67A 1TDJA 2O1XA 1II9A 3O7MA 2YR0A 1UXKA 4MYCA 4XQCA 2R1TA 3N2EA 3GLGB 1ID8A 4F1KA 1M83A 1PYGA 3NU1A 4LHXA 1ZH4A 1HEUA 2LWIA 2QRGA 1THMA 2HQBA 1H5QA 4ZZIA 1SQFA 2PD3A 1NLMA 1ULHA 4L6IA 3VV2A 4UPEA 3PGKA 5EHQA 1U0BB 3VVBA 3LKDA 4LYEA 1HE2A 4RKWA 2DFNA 3D3EA 1GDTA 3H5OA 2FEXA 2VRCD 3KETA 4P6VF 5AHXA 2D5IA 4U39A 4PRLA 4JZKA 4LPKA 4E94A 1NBOA 4MAMA 2OV1A 3IKJA 4QPDA 3G2OA 4R9VA 5C4GB 1TCAA 2DYKA 2OB2A 2EBWA 4IZHA 1CY7A 1NBMD 4HDRA 3K1ZA 1WBBA 4MGEA 2BJVA 4PPGA 4D42A 3AR4A 1SXJE 1WPGA 1GRRA 3IHLA 1Q7CA 4R83A 2OHIA 1PT9A 1FSSA 1GQRA 2Z3WA 4H9GA 5JMPA 2C98A 2XLCA 4P7JA 4REQB 3IEVA 1RD4A 2IZ1A 1D2GA 1QGAA 1XPJA 4N40A 4OI0A 4U5QA 1T5HX 1Y3CE 1ISGA 1NW5A 2X0DA 5DNUA 2ADMA 4NK5A 4E5NA 2E9SA 1W7AA 2HCTA 3EFEA 2PEZA 5E3JA 4MWOA 2QM0A 2AEFA 2HMVA 3GEDA 4NV3A 3A6HA 5K01A 3AF4A 3SVZA 1FMLA 4MLPA 4BCBA 5MHTA 1S6YA 4PG7A 1MKYA 2APJA 3AJ8A 1V4BA 3OPYA 3NYWA 1JHRA 1IHYA 1PW7A 1JFVA 1YE5A 2GAAA 3T7DA 4EW1A 4OU5A 1DQSA 4X9XA 4JOCA 1F4PA 1SHJA 2JKYA 4BQFA 1KJ8A 4FBLA 4AKSA 4C4ZA 1NY6A 1J39A 3IQXA 3AP3A 5FFFA 2RI6A 3M4JA 3UW3A 1V7QA 1K3FA 5JS1A 2QNBA 4YECA 1Z75A 3OQMA 4GH5A 1LX7A 3FPLA 4OYLA 1QX3A 4RU1A 1VHTA 5IAGA 4BNLA 5IASA 4WZAA 5F64A 1FF9A 1ZN2A 3ZCUA 1T1IA 4HGOA 4BKQA 3AEKA 2A1UA 3DO6A 3LO8A 1HNWB 5E4JA 2WIKA 1PJRA 4XWTA 2GD1O 1J1IA 2ODTX 3ZZMA 4DM7A 4LFCB 2WHPA 4J0HA 3NETA 5IKMA 1OASA 3G0DA 3DE6X 4DS3A 2HSWA 1G3IA 5AT1A 4YK7A 3C6BA 1VHDA 2VNIA 3Q8XB 2E82A 4KTTE 3JAWA 1UAYA 3PXBA 4FINA 2RBKA 1VPEA 4MRMB 4FCCA 4B81A 5IXSA 5BMVF 4Y6PA 4R3WA 3WSVA 3P32A 7YASA 2QSUA 4O2LA 3DT6A 3QXCA 1Z34A 2QD5A 2XI4A 2LZ0A 1XA4A 1XXHA 1XG5A 3DKRA 4C0BA 4F38A 2Z6QA 1E2BA 1RXIA 5NULA 4MWEA 3TG8A 4C0QC 3EVEA 1H6AA 1V95A 2NXJA 3H42B 5JWOA 1E6UA 2QQFA 1DLJA 3L8GA 4YP5A 4MVCA 4TSFD 3ACBA 2XMDA 1AA9A 2HPVA 4OBBA 1WXFA 2AI2A 2OFOA 5KVSA 3DTTA 3UPDA 3KT6A 4DLBA 2BHLA 3FYUA 3QVVA 4RKRA 1C0KA 4MWDA 1G2IA 5B7NA 5IJ9B 2AUMA 2IU6A 1UC5B 5I9MA 1GZ3A 2WG1A 3Q5EA 4GXTA 4DWWA 5IAOA 1GKYA 4PZCA 3WQHA 1MT0A 1ZD4A 4ZVNA 4B6FA 2H8GA 1Y4AE 3KKLA 3HSSA 2GTPA 4DJEC 3AUFA 2JJ2D 2YMPA 3PNVA 2PUGA 3TSOA 1UBKS 2ZB4A 4OB7A 1UMBB 2I1QA 1FVXA 1DRWA 1BU5A 3I2HA 5ECWA 5KNLA 1YDFA 1Y1TA 4KKVA 3ZS9A 4EJ6A 1CLEA 1RWVA 1V8BA 5LIPA 3AZPA 4X97A 1C7RA 4MEBA 5SYAA 2VHEA 1K27A 1N5MA 2L0XA 3EGXB 3O1HB 4L0CA 4YO7A 4IKEA 4C0HA 1JNXX 2F43A 2ZIZA 1OREA 2H2DA 2GEFA 1BD4A 3AM5A 5KWJA 4PBTA 4F2WA 5L3QB 5BQ5A 3CJRA 3L8ZA 1A9YA 1EP3B 4I4TB 4FIDA 2PZMA 1UJ4A 2YINC 3OJWA 4AJIA 4H4CA 2ZSIA 1AN0A 1PZNA 1K7XB 3WWYA 1JBQA 1IHXA 4JLOA 3TYXA 1TJYA 2C61A 1ZS9A 1W5FA 4PTYA 3ZVMA 2Q29A 1KOGA 4RXTA 4MJLA 2YBDA 5KKCA 3B52X 1H0SA 1V11A 1VBNA 2Y66A 1T2CA 3UXMA 1PLLA 1XDZA 3AR6A 4EGQA 4HI0E 3CFYA 2M1ZA 2YJNA 3UGTA 4DJJA 4V0LA 3SP1A 4EKGA 2PUCA 3VU9B 5LA6F 2FQXA 2XBLA 5KYKA 4KNVA 2HA5A 4EYQA 3R6GA 2SKCA 1ANKA 1J0DA 4XOUA 5D3MB 1HURA 5EJAA 4KR0A 3ZBPA 3JTEA 4AUNA 3C7AA 3EDRA 1Z83A 3RRJA 4C4SA 4XWWA 1SQ5A 1GP2A 2FTKE 1G64A 3MJSA 2C7QA 2PUEA 5BWNA 5I7SA 4Z1MA 2YJ4A 3PHHA 2JGIA 3ZQ6A 3ROPA 5MF6A 2Z9DA 1HQYE 3GA7A 2KLHA 3C6MA 3IOBA 1TD1A 4OM8A 4G97A 1T8RA 2AXPA 4HYYA 3UJ3X 3AL0C 4BJ3A 1S01A 1F2DA 1XZDA 1K3TA 5AW8A 3TFOA 4O33A 1LVUA 1P6XA 2V3WA 3MMXA 3OQVA 1X7ZB 4XA8A 3JD1A 5LZ5A 3RK4A 4DSTA 4FDUA 3HLKA 3EMBA 5CD9A 4NOMA 5KWVA 3FBTA 2C2YA 2YCBA 5FWXA 3ZD8A 2WWWA 1KEPA 4FX5A 2DHEA 3WIOA 4BATA 4BMXA 4FE3A 1R6BX 3KL2A 4JC8A 4ND1A 4TTSA 2X4GA 4BP8A 4U1RA 3B20A 4TUYF 1LNSA 3TGLA 2FXIA 1KZGB 3C74A 1TKAA 2PGIA 3I58A 4U63A 3TL2A 1IN6A 1J2JA 1YRQA 4U2GA 4WZBB 4YUXA 1ZD2P 4RSHA 5B2FA 5CEJA 3G79A 3PNPA 1GRCA 3MNFA 4HY3A 1ZMBA 3NOQA 3K9LA 3WMEA 1QRUA 3KB2A 1MABB 2A9RA 1N0WA 3HVJA 5HMMA 3KB8A 1P81A 2E1PA 3VRHA 4FYKA 2HIAA 3FBWA 3PEEA 5DYWA 2DR2A 3ZWQA 3KSRA 3PC4A 3M6LA 1VPLA 1Z2CA 1RU3A 4JYCA 2E4WA 4HDAA 1LKZA 3FZNA 1JTFA 4A3SA 3DEJA 3WJ2A 4IDBA 5K6TA 3L6EA 5AM1A 1GOTA 1CJVC 2C31A 2B9EA 1IHPA 1ONSA 2YJ6A 4UHCA 1Z5GA 1F6BA 3IUEA 1OXTA 4BV9A 1RXWA 1JYFA 4M8SA 5CAEB 4EECA 1J8YF 3ZNNA 3JYHA 3BQNB 2QYTA 3IP6A 4DMUB 1L7BA 3WLSA 8MHTA 5JD4A 1OLUB 3W8RA 5A3RA 3NBQA 4FLMA 2BGIA 1DKMA 3T5GA 5DM60 3ZK9A 5CG2A 2JCVA 3VPGA 5BVHA 2DTEA 4RK5A 4I9HA 4ZV4A 3Q3JB 2EIHA 1JJVA 4LE1A 4RZ3A 1M0WA 1HLGA 3ZH2A 1LDEA 3CJQA 4G0QA 5EP3A 1MO6A 1DKOA 4MQLA 4B6EA 4BUZA 1K92A 4PONA 2WKPA 3DVSX 4D9GA 1E7MA 1FX0B 2LR0A 3JASB 3K0HA 4WCDA 1YTUA 3X43A 1LRLA 1ABFA 1P62B 3R9XB 1TUEA 1JHPA 3GLUA 4KRYA 1P1FA 1H2HA 2YIJA 2YYZA 3WGNA 2XCIA 4EX6A 1U98A 1XZPA 2NZVG 1JIKA 1E9AA 2EW1A 4G5HA 4LOKA 4WLFA 4XDYA 1Q1NA 3D6UA 3O73A 4QUHA 3BYZA 5TE9A 3V8BA 4ZD6A 2YZ7A 3N05A 2XAUA 3R5KA 4M8IA 4I4CA 1GTL1 2XDQA 4QASA 1RAEA 2WUGA 3EGDB 1SOAA 2A0XA 3DWEX 4YP0A 1EFRA 5K0GA 2VHVA 3I04A 2FP4B 3M83A 3ZV4A 2W22A 3RT9A 3GLGE 4JI7B 2VJDA 3PJDA 2H11A 3FOZA 4COKA 2W48A 4NWIA 4EDFA 1IM5A 4ZOCA 4IHJB 3BHMA 4B46A 1NBWB 2MU1A 4YAOA 1R6DA 3IT3A 3KYCA 1ZHHA 3LF2A 1NC1A 3LYAA 3LCRA 1BQ4A 4K5QA 4PLZA 3RD5A 3V4OA 4CYMA 3K71B 2IPMA 2Q5LA 3SF8B 1SPXA 4F4DA 1P4RA 1KKMA 2XGJA 1Z0UA 5M3BA 4AWBA 4I9UA 1E2UA 1FMTA 1GSOA 2BFOA 3B1VA 3EHEA 1O58A 5A71A 3E9RA 4ADSG 3IS3A 1M6VA 5TT1A 1E3TA 3SIWA 3N6VA 4QUKA 4I2VA 4FM9A 1W9HA 3QU9A 5I7RA 1PX0A 1R8JA 1ZIPA 2IWHA 3LRXA 4HH4A 3T1OA 2PT6A 4EFNA 1HYQA 1UBTS 2I4OA 3IJPA 4W9NC 5TS3A 3M6VA 4L16A 4MKGA 1JQ3A 4P7GA 5F4ZA 1JDTA 1L4LA 3KQTA 2YKGA 3RYTC 3JD0A 3ABSB 3NP7A 4P08A 3CLRC 1PGPA 3F6PA 3TW8B 4IIUA 1YJBA 2X0NA 4BFSA 1JDZA 2VAMA 2O3TA 3RTEA 5DTJA 5EUBA 1OLSB 3L7DA 2V97A 1ZW1A 1X7XA 2QRZA 1NPDA 4XDGA 3TL3A 2W6NA 4F2GA 4K9OA 4L4RA 2O0JA 3H8WA 1N5JA 3RF6A 5B58T 1QU2A 3TVTA 3VC2A 3GEGA 3K1AB 1A7JA 3WQQA 4B2YA 2DY0A 3N5KA 3NXSA 5CJJA 2ERYA 4IL5A 3AF5A 3UFBA 3O4FA 2RGYA 3PR2B 5FBZA 5DZSA 4XM0A 1NBHA 2ZIVB 4QDUA 1U0RA 4KPEC 4LY0A 1PR0A 4JODA 5B3JC 4RK6A 2ZQYA 4LOHA 3U4AA 3VGJA 5JNWA 2Z08A 4PG8A 3KKEA 1CZOA 2P78A 1IG3A 2PSEA 3NHMA 2HD4A 4CEIB 1R4AA 1X1RA 4BVHA 3WBBA 1V3UA 2W6ZA 4OG2A 2C97A 3Q12A 2A1TS 3LFTA 1G8FA 3I1FA 3OX4A 2XIQA 1HMYA 2CEKA 4R1MA 4X3PA 3ZXSA 2NP6A 5K9ZA 1ORTA 3L8HA 3OBIA 1K7EB 3IIIA 1OY1A 1ZK2A 1QHHA 4UAGA 3TAUA 2H2AA 3R3WA 1V8ZA 5L7TA 2C00A 3FLEA 1EDOA 2F3UA 1YIOA 3MVEA 1S2MA 5FORA 1LK0A 4URYR 3WRYA 2RBGA 4D9JA 1W87A 3X1MA 4LRQA 2QN8A 4EZBA 4EJFA 1EUCB 4TMXA 2XYPA 3NMUF 2WVAA 3BMNB 4OKSA 1NKVA 1WEKA 2JKVA 1U3FA 2XZDA 4FUQA 4OQPA 1VFNA 4P4TA 3GB9A 5U4XA 3H4MA 2P6RA 5F9FA 3PUHA 4D96A 2JCYA 3QJYA 4YRGA 3OUUA 2VTBA 1NBME 5GJWC 1II0A 1KSHA 1JEYA 5DT9A 4M86A 4CCYA 3V80A 1YQQA 2AOUA 2BCGY 1XEFA 3KCNA 2HRZA 4RZHA 3X1KA 1PVVA 2I7DA 1VECA 3E7PA 1NIJA 4EWLA 2JIRA 1ACMA 1R5JA 4QE3A 3OAAA 1Y5MA 3RG8A 3HLTA 2WEKA 3AY0A 4N8SA 1SXPA 2YMQA 5C4IA 1YJQA 3EEBA 3GFRA 4OQYA 5G1NA 1YCHA 2AKYA 1RQLA 1T8YA 4KQGA 4IG4A 1PWXA 4DWJA 2F4VB 2ILVA 2VNJA 1TMGE 3RVBA 1UPTA 1ZL0A 4OVKA 2GBLA 2JZNA 4LYGA 3UT5A 3AEZA 3K72B 4AG3A 3AI2A 1H4SA 1FYEA 2OE2A 4RO0A 1R6XA 1KNXA 2Z5VA 2HBYA 1NW9B 1NQTA 4HNVA 5B6IA 2C9BA 6PFKA 3LDGA 4E13A 1GCOA 3CUYA 4GLBA 4N3BA 4F4IA 3OT1B 1GGEA 2FPIA 2A3RA 1U3WA 2G6BA 2GDJA 3C8DA 1R9MA 1XN1A 2AG1A 2GEDA 5F12A 3KPJA 2EBHX 2QTTA 4Q1BA 4F11A 3ZDAA 4HLQB 3KKMA 2ET6A 1ODSA 3IUBA 1EPUA 1V3TA 3DXFA 1R4ZA 4Y6SA 1RRKA 4TL7A 1Y5RA 3P9RA 3D0OA 1P31A 3JQAB 3K31A 4FQ5A 5B2ZA 5LA6A 4CBVA 5LWHA 4CF7A 1G4HA 3AOGA 3LVFO 1GRVA 5ESWA 4DV2B 1KJQA 3IURA 4U2FA 3H5RA 2E4ZA 2OBLA 3RRBA 3W2HA 4M0DA 3T15A 4C9BA 3KQNA 3EW7A 2BMJA 4XDZA 4R0VA 4H60A 3KR9A 3WFJA 5DW0A 1DKLA 1JI0A 1QIFA 3U0BA 4DUGD 3SVTA 4L3OA 2XCSB 1KQ3A 4GLOA 4HDNB 4KBYA 3AL2A 5I8PA 5FTNA 3FWKA 4DJ5X 1JRLA 2WW8A 2KW5A 4HQLA 5CT9A 4BLSA 3O91A 3K4PA 1KAEA 2RE8A 2C57A 2QN7A 3GIWA 4D46A 3FX2A 4X8HA 2A0UA 1OTYA 4TMTA 1TYZA 3G2PA 2II6A 4EY7A 1UBFA 3SQOA 5F76A 5D00A 3ELYA 3F8TA 2FE1A 4G24A 4DQUA 3WLAA 4BFLA 1O8CA 3ESRA 3I30X 4UATA 4E14A 3PFIA 5IJ0A 1IOLA 5KKAA 1II8A 1E77A 1E2EA 1SM4A 3CIFA 2P9HA 3DD1A 4M37A 4P93A 4ZOAA 5EKXA 4KQIA 1YDGA 1HYBA 4ENUA 4RELA 5FOWA 5BN4A 5HUHA 3H1EA 3STTA 2O57A 3K35A 2V0CA 4NZ9A 1WDTA 3ZCQA 4JL6A 1K1EA 3NQ41 3RANA 3SNHA 3QQPA 2VKTA 3ZQKA 1OB2A 3WB1A 1S8AA 4C7BA 3FB1A 4IJQA 5A02A 2FSFA 3AEQA 4D1YA 2H51A 1MD9A 3KPVA 2E4UA 4WBNB 4P83A 2LCIA 4D6XA 1N7JA 1TZKA 1MZVA 2YMMA 4NBWA 5BRJA 3O3NB 2BTQB 3U80A 2O2EA 3H2SA 5NLLA 3BTSA 3HCFA 2FMFA 2RHLA 3K1YA 3GRCA 4WESA 4AKIA 4F2DA 4GSYA 2ZRGA 1CUJA 2AYZA 2HA0A 2Y76A 4S35A 4JT2A 5ALZA 1E6EA 5EP1A 3ZYZA 1ZHOA 4TVSA 4PS0A 5T4EA 4CM6A 1IAQA 4BO9A 2YQZA 2J7KA 1L4FA 1P2TA 2C7PA 3H9BA 1QBGA 1XR3A 1R0XA 2XF2A 2NYUA 4BBPA 1DQYA 1K68A 1KZ9A 1UBUS 2ID9A 3K9HA 4JVLA 4NE2A 2QTVB 1T6XA 2OCXA 2FZVA 4N39A 4UD2A 2PH3A 3I9JA 1S2GA 2BP7B 1JR3D 2IUSA 1O6GA 3HKDB 2F1JA 3C7CB 4U7FA 4OSOA 1N2CB 4ARAA 2PZJA 2ZI3A 5JNUA 1YQEA 3MMPA 1QRSA 1R9NA 1FRFS 1X1AA 3ZN2A 4GPTA 5DLPA 3QFSA 3DOHA 3IHKA 2ADFA 4PNPA 1PD0A 4LOLA 4RVUA 2R87A 4WFKA 1XZGA 3ZGNA 1AXRA 1LK7A 1I32A 2AB0A 4L5CA 1IXZA 3OQIA 5LXTF 1YRBA 4YPVA 3AESA 1OLXB 4AFNA 5A4KA 3CO0S 3D5EA 4YJFA 3PWZA 1DPGA 3VYRB 2AZTA 3PNLA 4N5MA 2XXJA 3RC8A 3UV7A 1IBCA 3EEIA 3LIPA 1ISHA 2OV2A 4Y2VA 1RHMA 2XRYA 3BGIA 1AXEA 1P39A 4AZVA 2XBMA 4Y2SA 2VK8A 3GJ7A 3DPUA 5CRIA 4YCSA 1LVGA 3VHLB 4F3TA 1Z0JA 1EVZA 4B3HA 5JAIA 2WKWA 3E5RA 3RSOA 1PJTA 1C9NA 1MDBA 1TADA 1XP8A 3B85A 1JDBC 2QYSA 5IDQA 4QTZA 5CH3A 4W5TA 4NR0A 2BVNA 4G0PA 4Y9TA 1F9EA 3JPWA 5HFJA 4UUPA 2XB2A 1FUKA 3UGKA 1RLOA 2QW8A 4G0YA 3CY6A 3BIWA 4J9UE 4IY1A 2PL3A 3RVRA 2FLVA 4JI1B 5FPYA 3Q85A 1P4SA 3W5AA 5C8ZA 1LJUA 5JCJA 4B3RB 3AP1A 4BQRA 1E7WA 2DTXA 4ARCA 5JYCA 2IP2A 2FEWB 1RJ9B 1VG9B 4RWEA 5I4BA 3QE9Y 2ZBGA 1XZAA 3EWAA 4EG1A 1A8IA 4A10A 5EWLB 3VSDA 1I8TA 3WYNA 4XPIA 5IP5A 3HWWA 4MUFA 3ULKA 3UUGA 2C3PA 1XO1A 3RF7A 5AKGA 3QH4A 5JUWA 2OFXA 4HNAA 3T9CA 3SC4A 3NBFA 4JR0A 2X5KO 3QF4A 4RPJA 4FCTA 3INGA 2YJGA 1DXQA 4QYTA 4WD3A 2HREA 3S2FA 1CP2A 4FKZA 2WFMA 3VOAA 4LDQA 4EY3A 1S7GA 2VIIA 3RG2A 4MS4A 2AF3C 3CRW1 4IIGA 4KRFA 5C8YA 1EE9A 2B83A 3G5AA 1MRNA 4QX6A 5JNLA 2SNIE 1MB4A 1QOZA 1W1WA 4DSNA 1TYEB 2MSDB 2HWWA 2IS1A 3A36A 4I9FA 3WB0A 1E9EA 5J4HA 6AT1A 1ZO8A 3GJQA 4NJMA 2WJGA 3EQ9A 4B2PA 1YKFA 4UNRA 5ALLA 5KHLB 1OXXK 2DEUA 4K46A 1B42A 1WL8A 3TNDA 2AYXA 4IO1A 3NUGA 2X8WA 3T3OA 2ZETA 1G2OA 1ZYUA 4HXYA 4G63A 1KH2A 1V1MA 3KWLA 2N1BA 2A9FA 2GFHA 2YYYA 1YJ5A 2Q1YA 1Z4PX 2F67A 2Z04A 1Z2PX 4PSKA 4QYMA 3PFGA 1V7ZA 2ARKA 4FFMA 4R01A 4TTIA 4MLDA 2PLWA 1YR7A 3BWMA 3BGSA 3RASA 2CHEA 1LRKA 3BORA 1TZJA 1GPDG 3QITA 4IOJA 4K6GA 4KIGA 4O4IF 4WKPA 2D13A 3WDLA 4HBGA 1G9XA 1PT5A 2FG5A 1RQGA 1KI1A 5ILGA 1KY5A 1ISJA 2X9GA 5INTA 1EVKA 4H77A 4I9GA 5BRNA 2OHHA 3ZBUA 5HQTA 3FIUA 3EQ8A 4NKRA 4QXQA 4R2WA 1KI2A 3CCCA 2BHNA 3AFGA 4YI3A 4GG1A 1LLFA 3KXLA 5CH8A 5EXSA 5LQCA 1B16A 2O1EA 3IP8A 3DDZX 3OTGA 4L74A 3ZE2B 5ADUS 4I55B 4N6NA 2ALJA 3F3SA 1GNRA 2H57A 1XTIA 4Q7EA 3G2QA 3E7XA 3UK0A 3H9UA 1U0SY 1XDSA 2IFTA 3HCRA 3RJ9A 3TNYA 4RH3A 4KN9S 1LS1A 1LBEA 3B2EA 4LZAA 4AKTA 2FG7C 1AGXA 4QZVA 2VI5A 3U9SA 2PSFA 4O59O 5JDIC 3CKMA 3N8HA 2D2EA 3BWVA 4Q4AA 2E6UX 1RPZA 2H08A 1KI9A 2E5WA 1SGWA 3G6WA 4Y2PA 4PFQA 1T10A 4RF5A 3RRXA 2IEBA 4YMLA 4OPMA 3RNLA 3GARA 5KNCD 5BOSA 3SJAA 3I37X 3ZV7A 3GHHA 1PJAA 4P3XA 5EFZA 3VNVA 5CIQA 3JQGB 1E61A 3L7OA 2FVYA 2Z4RA 3I5YA 4B5KA 3QSGA 3KTFA 3GQBA 2OHVA 4NH4A 5E7MA 1QHSA 1XLTA 3H7IA 4DR7B 2YS7A 2FZWA 4RUKA 5BWOA 4O4JB 3FNGA 4H1TA 5B30A 2FHSA 1N7HA 2FJUA 1B26A 4GQBA 4YFVA 4B6SA 3DE5X 3U1BA 2H4JA 1NP7A 5LCXA 2C77A 5BT8A 1QQ7A 4H1VA 5F51A 4DMMA 4EFMA 5BR4A 3M4ZA 4KO8A 4L75A 4FYXA 2X1VA 3PVCA 4EPWA 2WAAA 3SYKA 3D7RA 2PK3A 1LNQA 2OYSA 1IZ0A 2AFHB 3WGKA 5FV7A 3LSTA 2BSQA 1W4LA 1JG2A 5CM8B 5B3LA 4ZI5A 1X14A 4WHMA 1E79A 2C84A 1QLHA 1U7TA 2WIGA 5FULA 1O1YA 3W9SA 5EQDA 2AVDA 3W79A 2ZOSA 2GNOA 1IWPB 3HMKA 1NQVA 2C4KA 1RPNA 3I76A 3ANMA 1LXCA 4E5MA 2GBCA 4OMUA 4DRXA 1WZEA 4TKVA 3K5PA 3UATA 5CFQA 1JPNA 3AWDA 3MSXA 4ZCPA 2YWRA 3H2ZA 5UKDA 3P7MA 3EBLA 5EUQB 3E15A 1PBNA 1HDRA 1FYWA 5CK5A 3TLBA 4C7XA 4RENA 3BXZA 1B6SA 1IG0A 4J0QA 4WQMA 3RM3A 4NBRA 2OD2A 1SVOA 1JEAA 4FW8A 3WYAA 1PJBA 5DYTA 4QA9A 1RAAA 3PHIA 4WINA 1CRZA 1P17A 2HY7A 4QXRA 5LLSA 4EZEA 2DG2A 3CUTA 3LZ6A 1AHNA 2O0HA 4OUDB 2V0NA 5KYTA 4QAJA 3IE1A 4DR4B 2HWKA 4YBZA 5CB4B 5J47A 2FPUA 2G76A 4KU4A 1XRRA 4XKJA 1XEXA 2ODBA 1RQXA 2CCJA 1RJDA 4C14A 1G2QA 1WSAA 1R0KA 4KB5A 3LZCA 1RWMA 1QIGA 4EA7A 2P11A 1TU3A 2QBYB 1T9DA 2X2PA 1WTCA 2AYYA 1L7AA 2OC9A 2KS6A 3KWJA 4PHCA 4L9AA 2VUUA 1CRWG 4HQKA 4LRXA 4XX1A 5K0LA 3FMVA 3ICOA 5D3KA 3ZDYB 3SJBA 5F9HA 3RCBA 1XVVA 1M1UA 5KYWA 4JVSB 5IC5A 2GK3A 1BX3A 1JHYA 2Y2UA 3DMYA 3ZZNA 2UZ1B 2Z2ZA 3N7UA 2EZUA 1WPRA 2NVWA 5KJEA 2QTBA 4IFEA 1MHPA 5HF5A 1Q83A 1Q16A 1ADCA 5GJCA 3A4IA 3D4IA 3FFAA 3QW2A 5GM1A 4F8YA 3BHJA 1CETA 3UJBA 3G9ZA 1XDWA 1QH1B 1X1CA 2N3ZA 3GGDA 4OJMX 1ZPDA 1KMNA 2R2AA 5HZKA 5KNBH 2AEEA 2DHRA 3V32A 1H6DA 2ICAA 5HK8A 1RSZA 4C88A 3N2NA 3B9RA 1N57A 4FTWA 4F97A 3HJTA 4XLLA 3AXTA 1KI8A 1VMEA 4OJNA 4OLHA 5CFLA 1QYRA 1Z63A 5KAPA 5HJ7A 4LYJA 4S0ZA 3LWBA 2GF0A 4B09A 4ZDKA 1VJCA 2CVFA 4V0QA 1RS0A 3BGVA 5HE9A 1TEHA 3VUFA 4C4TA 3NHYA 4LRSB 3V7YA 2ZAGA 2ZIXB 4Q1CA 3ECSA 3T1HB 1ARZA 3QNWA 1F12A 3G9TA 1H2WA 3GJRA 4FHZA 1X0XA 2PTHA 2PRSA 4MZXA 5LXTA 5JBIA 1N2CE 2HA2A 5G4LA 4CKWB 1N9KA 4IJMA 5K45A 2O0MA 1FEZA 2QD1A 2B1GA 1IZ7A 4UUMA 2YVAA 5F2EA 3O8OA 3ZDBA 2NX2A 1QTRA 1E0JA 4ZV7A 4NMLA 2CSUA 4PGMA 5D01A 2IVZA 1GQ2A 1XZKA 3GP5A 3K6JA 2IODA 1NVAA 2AD5A 1PJ2A 1TE2A 2WKRA 3TNLA 5KDOA 1QONA 4IJUA 5AUPB 3A1DA 4HDKA 3HO1A 1AN9A 1RHKA 1WMAA 1GAXA 3D1VA 3OTWA 2YVUA 2C5GA 4CLOA 3PDHA 3LPAA 2AF4C 2BGNA 1R00A 4IWYA 2BF4A 3T5CA 3OPYB 4F5DA 1ZJWA 4W82A 2YBEA 1SU4A 2C96A 2F3QA 5CJPA 4DPMA 1PV4A 1YQGA 2Z1MA 5B4TA 1QWSA 3Q9NA 1KSGA 4E21A 1AGNA 4YMGA 1IDOA 2GK7A 1OJLA 1L7OA 1VIAA 3WICA 1WZUA 3E81A 5AOVA 1K6EA 4JAVC 2GZHA 2ZS9A 2I1VB 4OQFA 1G5QA 2CLMB 4IUCS 1OHHA 3MT9A 1I2DA 4PXYA 3K70C 1R9JA 3M6UA 4YX9A 2OORA 2W2NA 1ZMOA 1HT2E 3NVDA 1NMXA 3R6LA 4YCMA 2IA5A 1MTOA 1N9GB 4OFBA 4X20B 1BDBA 1CK4A 1YZVA 2A1UB 4L8FA 4TMYA 4WUTA 5MGBA 5K2MA 2QD4A 4QOGA 3PPYA 2ZI9A 4B2IA 3L8FA 2P8JA 4GXRA 3TOCA 3UPTA 5E2AA 4HGYA 2WHPB 3FLMA 2EDCA 4D4JA 1X74A 4DDVA 4HJXA 1QYXA 3BL8A 2F7SA 4G5XA 5F7JA 4X65B 1LC0A 1MQ8B 3U4HA 1U7ZA 3OLCX 1PTJA 2K4MA 1QFYA 4WA7A 3FNHA 1Z9BA 3UMCA 5I6DA 5IAKA 4ITUA 4Q66C 5JCPA 1NRJB 4BO0A 2G07A 4Z1MD 1P4JA 5DFAA 3VOTA 4E09A 2ZU6A 1Z4JA 3BL6A 2CD7A 3P71T 2XMCA 5BSKA 4R8VA 1GQSA 4KL8S 4XIJA 3Q8LA 3OIDA 3VI4B 4FUTA 1E60A 1RRGA 2VEDA 1NRWA 4TT3A 1L1EA 1XVLA 1ATIA 1FQOA 5G41A 1P33A 3G3EA 1ABBA 1RM4A 1JR3E 1EXWA 3V7UA 5HWSA 4OIFA 1ZGHA 4WBXC 5CYFA 3FYUB 3PKZA 2BRUC 1T5SA 1P0FA 2BZGA 2G7ZA 2VJOA 4JQOA 2VEOA 1G41A 1YC2A 3D8RA 3WXMA 2EEZA 2ZUCA 2ZUWA 1KOFA 2IU4A 1ISIA 4GW3A 1EE2A 2WJAA 3A1VA 1WCIA 2FA9A 3GEEA 1NUHA 3A9UA 1NQ5A 1NLFA 3WWEA 1W581 2H4YA 2YIMA 2IDKA 4KSCA 1RR6A 1PE0A 3W8NA 5H81A 3K9FC 5ARCA 3E3MA 1E9RA 1GAJA 1KI6A 2C54A 1I36A 3A11A 3E5HA 2WOJA 2WU1A 3UJ9A 4US2R 3D4NA 3N70A 3LFHA 3L0BA 2NWQA 3R0IA 2J59A 3F71A 3JALB 3NFYA 4DDHA 2ZE5A 1VL2A 4ZTZB 2I91A 1LDMA 3OKPA 1JU3A 1U3GA 4RGQA 1RPTA 4HOYA 3RWMB 3T5PA 2PMBA 2ECFA 4H4DA 2FFAA 3QI7A 4EW6A 4DLWA 2HRDA 2X86A 3F6CA 4HKTA 3T34A 1Z6XA 4O0MA 4E22A 5I48A 1J9GA 5BT9A 5JZ9A 4L95C 3OCWA 5LOVF 1TJ4A 4Y2QA 5EQJB 4BP9A 2WUWE 5IMSA 5IRCD 2IH2A 1U8CB 3O75A 1N8SA 2C3UA 2RHOA 3NOOA 2AW3A 1A4IA 1V11B 1ZZGA 3MCVA 5ALFA 4YLYA 1A9XA 4H59A 3AUKA 2OP0A 4M1YA 5E6UA 5JS2A 2ZI5A 4LZPA 2O8VA 1I2CA 1L5YA 2W0SA 4KVAA 1OGYA 3WMRA 3W0LB 1JECA 1RDFA 3I6MA 4BE4A 4XDHA 1TYAE 1MJHA 1JLHA 5TDHA 1S2IA 4J3FA 2AG8A 5KYGA 1NVXQ 1NU6A 3SJUA 2PL5A 4MWZA 4YR7A 4TRNA 1NHGA 4BZQA 1QFMA 3V4LA 3I9V6 1Z35A 5CPBA 5LNK6 3AEUB 3TIVA 1DTSA 2F1HA 3EC7A 1Z4LA 1EVEA 5BURA 1HLPA 3C70A 1M1NA 2FOIA 2JD0A 2RH5A 5EUMA 3ZWXA 3JQEA 2Z8YM 5FA6A 1G4AE 2FPLA 3E9ZA 4TVBA 4YIHA 2GPAA 2WF6A 1XRMA 3KQOA 3KX2A 4OYYA 4CKCA 3Q7QA 1QDLB 3HUFA 1SJ9A 4DV4B 1JTEA 3H5LA 4HN9A 5G0VA 1EIWA 1E99A 3X2EA 1Y6ZA 4GYWA 1PJLA 3LPCA 5KI6A 4JDUA 2PKEA 2E4YA 2JBWA 4HCJA 1YRAA 4IEEA 3LX4A 4NAHA 4OLJA 1KMHA 2E1RA 4UEOA 2VSYA 2AHOA 1AHHA 1PYDA 2B35A 2OGZA 4I1UA 4KLNA 4II3A 2PFGA 4R98A 2EWMA 1MC1A 3HXOA 3H1TA 1CKEA 5GADl 4L5AA 4LVUA 4Q12A 4EA8A 4C2AA 3ESQA 5B12A 3TR5A 4GX2A 3SYLA 1I9CA 3PSAA 1ISSA 5C7YA 5H7XA 1CCWA 2P4UA 2EX4A 3MGCA 4I50B 3O5AA 2XDYA 2VFAA 3HYSA 1JJ7A 1N1GA 1E3DA 1KETA 1REQB 2FNAA 2XIJA 4K6KA 2CVZA 4D7AA 2PXXA 4DDKA 5HKAA 5IH7A 4LEIA 4CLRA 2Z6AA 1XUOA 1RAGA 5JW6A 4X3OA 4D0RA 3I2IA 1OW3B 5FNVB 4D9NA 1VPTA 4XWGA 1ZDMA 1IJFA 1ORVA 1RTTA 1J23A 5DCUA 1KQFA 1Z6GA 3EXFA 2B6NA 4KK3A 4NTZA 3QOXA 4W9MC 5EJ2A 4BO3A 1JLSA 3FDZA 3P1JA 4WKOA 4RMHA 2CB9A 4UKDA 4LJ9A 1SWWA 4BQIA 1KFEB 3G8YA 4Q3BA 3I5XA 3IYLW 5T41A 3PE4A 2Y9PB 1K6XA 2H0RA 3NHPA 3KQHA 2GVDC 1KL7A 1P9WA 5FBKA 1CR2A 3FNEA 3G0CA 2WLSA 6CHYA 1FS4A 3CLTD 5K3OA 5C35A 3GL9A 3VQTA 3PRHA 4TT8A 3T3HA 3UJPA 2JS7A 1DTEA 1EA5A 2JGDB 2OVFA 3FGOA 5FWAA 4AP6A 4UXIA 2JEOA 3PHLA 1L5OA 2PYDA 1GG8A 5B36A 1JNYA 5F7OA 1PUJA 2JEZA 1Z7BA 2I4NA 3EVGA 2AUNA 4P3NA 3KQQA 3KYDB 1Z7EA 4L76A 4GDFA 2ATIA 4FOPA 4FN5A 4DV6B 1Q0PA 2P6OA 3NWPA 4KRXA 1SXHA 5ER6A 1HE3A 5T4HA 4QGSA 5BWLA 3EPHA 2FR8A 1PR3A 4WDRA 3WS7A 3ZU2A 1SIOA 2XTZA 1T8PA 3NYRA 5EY5B 2R8OA 3TJZA 2HWYA 1DI0A 1IJBA 3OFJA 2H9YA 4RY0A 2PKRA 4WJLA 3NIGB 2VG8A 1ULZA 2RHJA 4TS4A 1UPFA 3MUOA 5EMKA 2W42A 1T0PA 4ZVMA 1HG1A 3FMGA 1PZXA 4M9CA 5DYGA 1ZRHA 4CV3A 4D9KA 3MBKA 3GZTB 3PI7A 4IDAA 1NXWA 1PGNA 2HCJB 4A03A 3TXAA 2HHCA 3DHYA 4QQKA 4L4XA 4UE6A 4W5HA 1R18A 1R8QA 2WTEA 3A1FA 1L4KA 2HJWA 3THSA 4IG9A 2BAGA 2O3UA 3WIVA 2DQYA 1J2RA 3AU9A 3GWZA 2C1XA 4KQEA 4ZA2A 3ZI4A 4B7AA 5IT0A 1U3DA 5E6SB 2R4TA 1NUQA 1XWIA 4RABA 1JQJC 1L4BA 4XUDA 1B0ZA 3FYDA 2OWDA 1Q0QA 5AK5A 4MOWA 3I23A 5JC8A 2QX4A 2R3SA 2HCRA 4OKIA 4WLVA 1M6VB 3BHIA 4JP1A 5ALRA 2AEMA 4QJ4A 3WNQA 3B51X 1YB2A 2PVCA 5CDHA 1B0PA 2QUHA 3IE2A 5J5CA 4RIGA 5CD1A 3PQFA 3OAAD 5IC6A 2EDAA 2V6JA 5AXCA 4YMUA 4MPTA 2XWPA 4FGUA 3L1VA 3HDGA 5KJCA 1NUPA 1U80A 4C7OB 1OWLA 2PL9A 3H5VA 3LUGA 1JHXA 1LW7A 3DMRA 3KQVA 4PZZA 1FOEB 3I0MA 3TK1A 4DQDA 1RQ7A 3A25A 2IP4A 3LXXA 4MQ6A 4PG4A 5FOQA 4OH7A 1FTSA 3TW6A 2ZVQX 1PHPA 1O03A 2JBAA 4B2LA 3ZGXA 3K0KA 3OU6A 1SBHA 4NNOA 4RLHA 5THXA 5B64A 4A9AA 3EVNA 2RMKA 3QXHA 2F3RA 3OM8A 4OCZA 1LBTA 3SOPA 4BTLA 1VHJA 3QEBZ 3DTVA 4UM9D 5LNK1 3FR7A 2V5UA 3PFFA 3QKUA 1C3EA 4KBGA 4KMMA 5CB0A 2Y6UA 3RADC 1SU7A 5G4KB 1O6ZA 2PJUA 1HQCA 4M60A 3V8VA 2D7JA 2ECQA 4PYLA 3EF3A 2ZITA 4WZAE 3T7TA 5GOTA 3H75A 1A1SA 1H6BA 1CEXA 1QP8A 1ZXLA 2ZJFA 3KQMA 2VNKA 4HGNA 1A82A 2W58A 3C6YA 3S8EA 4RPCA 1WHSA 3HR7A 4JENA 4DKJA 5BMVB 4JEHA 4HH3C 2GBGA 2HDWA 3OLXA 1PWHA 2DFPA 5FQNA 2IS4A 3DMPA 4MHOA 3HDJA 3Q6MA 1J09A 4HDSA 4X93A 1U2DA 5KWIA 1KBOA 2V6IA 1G7RA 4U7GA 4ZTUB 1BX0A 3DMDA 4DY4A 3WLIA 4B35A 1EQUA 2BV3A 5I5GA 1OI7A 2GEVA 3GDWA 4FJ1A <