1IPFA

Tropinone reductase-ii complexed with nadph and tropinone
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
259
structure length
259
Chain Sequence
b'AGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSERQELMNTVANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPEQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMANCGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPINONE REDUCTASE-II
molecule tags Oxidoreductase
source organism Datura stramonium
publication title Capturing Enzyme Structure Prior to Reaction Initiation: Tropinone Reductase-II-Substrate Complexes
pubmed doi rcsb
total genus 99
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 1.1.1.236: Tropinone reductase II.
pdb deposition date 2001-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ipfA00
4RQUA 3H9GA 1JWAB 1GADO 2FWMX 3F3SA 4HUJA 1P1IA 4TRNA 2NV6A 3RIHA 4Y6RA 1OZAA 1TT5B 1GD1O 4QTZA 5ES3A 1Y5MA 4BV9A 3V1TC 5ENVA 4N5NA 3ASUA 4W9NA 3CE6A 4IQ0A 4JBIA 1ORRA 1MLDA 1SC6A 4OH1A 1Z74A 2JFHA 3P7MA 2QX7A 4CR6A 5JSFA 2OGUA 2OP0A 4D3SA 5JC1A 1D8AA 2EGHA 4KTVE 3GVXA 1U3VA 3ZW9A 1P3DA 4MJLA 2O3SA 3ETGA 1AXGA 1U2GA 2LDBA 4CMBA 4RPLA 4E2WA 3DMTA 3RFXA 2EIHA 3EVNA 1JKJA 3AY7A 3PWZA 2O50A 1O5IA 3BXXA 3HN2A 3RUAA 1QYWA 3U9LA 5J23A 1EVJA 1F12A 4WEQA 3ZWXA 4UAGA 4CL8A 5BR7A 5ADHA 5CG2A 5DBGA 3PI7A 1VE9A 1JU9A 4I08A 4DL9A 4FBGA 1DC3A 3HNPA 3NKLA 5ER6A 3OECA 1MGOA 4JK3A 1E1NA 4GAEA 1PZGA 4ITUA 2NTJA 1ENPA 2VRCD 1ADBA 2WMDA 3KSDO 1IB6A 3RC9A 1NWCA 1GEGA 2P91A 1I0ZA 1ZXBA 4WJZA 4AJLA 1U3UA 1JVSA 4FDAA 4PLCA 1E7QA 3WB9A 1ZMOA 4CLDA 2EJVA 2DBZA 1YBMA 4CLXA 1E1KA 1VL6A 3BMOB 2DU8A 1JQBA 2X5JO 3AFNA 5H82A 3TSCA 3WICA 1PZEA 2EGGA 2IRWA 1BRMA 1FXSA 2GRAA 1HXHA 2HO5A 1CDOA 2Y1GA 2Q1SA 3OP4A 2P4QA 2BGMA 2BFPA 2VHZA 5C7LO 4FR5A 2HQ1A 4NIMA 4PRLA 2NQTA 3L4SO 3BIOA 3ZHYA 1LLUA 4J2OA 1RJWA 2Y68A 3D64A 4FB5A 3FHLA 3PK0A 2C54A 1JTVA 2QZ9A 2RHCA 1EFLA 3DZIA 2W98A 3JQGB 4BNXA 3VH3A 2PNFA 4UULA 1CRWG 2I6TA 4RDHA 4OSPA 1DRVA 2P5UA 3VPHA 1Q0QA 3JQCA 4HX5A 5IZCA 2D8AA 3ABIA 1H5QA 5G4KB 4EZBA 5C7OO 1QP8A 2YHIB 1E7RA 2WJPA 4WNCA 1H6DA 3DZBA 1PU2A 4IUYA 5BNFA 2O2SA 3RJ9A 4GVXA 4MIOA 4IIVA 4YTEA 3AK4A 4EITA 2O7SA 5LCXA 3JD0A 5T67A 4R41A 3D3EA 3OJ0A 1R6DA 1BTOA 1NVTA 3F1LA 3LYLA 4II2A 4R1SA 5TX7A 2BMAA 3PJEA 4YVFA 2ILTA 4A0SA 3NTQA 1NFQA 5KKAA 1Z7EA 4KZPA 3MJCA 1GPDG 5DP2A 5H83A 4GMFA 3E5MA 2CZCA 2J6IA 3GVHA 3E03A 3ZH2A 1O89A 3G0OA 2J8ZA 4RDIA 1CJCA 2QIOA 3F5QA 1GPJA 2HDHA 4J9VA 4I5FA 4A10A 4B4OA 3O03A 3ZWMA 2DC1A 4BQPA 1R4MB 4P22A 3PLRA 1PS8A 1NHGA 2FR1A 3DEYX 3DZJA 2NSDA 2Q99A 4CV3A 3DMTC 4U7WA 3PFFA 2WE8A 1O6ZA 3GVCA 3EDMA 3H5AA 1DEHA 3PHJA 4LVUA 2C0CA 5FF9A 4ALMA 1HETA 2ZTLA 4B4WA 1VJ0A 1DLJA 2NLOA 3RASA 1K6XA 4OHUA 4ZVVA 3ZNPA 5F1OA 9LDBA 3AOGA 4YRAA 1V6AA 5IDXA 4NJMB 2F1KA 2YW9A 2DM6A 2B4QA 1E7SA 2GYYA 2J5KA 3QVOA 2VCYA 2VHYA 4KMSA 3RU7A 5TNXA 3VDQA 4E5MA 2VWQA 3W8EA 1A71A 3A28A 2PD4A 4CLOA 4BO6A 3VH2A 1Y7TA 3GPIA 1NR1A 5CDYA 4BKPA 3WIEA 4UUNA 1UDCA 2IEDA 3GK3A 1C1DB 3JQ8B 4LRSB 1UZMA 4KUHA 1H0KA 1ZCJA 1A72A 1NX6A 1KVRA 3GFBA 4IDDA 1B8UA 3T4EA 3U49A 4M8SA 3JQBA 4NFHA 3LC1O 3LT0A 2VYNA 1V8BA 3BMOA 3ZN2A 2VN8A 3I9MA 4O1MA 1RKXA 2YFHA 3L4BA 2P68A 3DZFA 2YZ7A 4BNJA 2YQ5A 3GLQA 1QXSA 1DDOA 2VTDA 3PQDA 4IDCA 2HKIA 1LSUA 4TKMA 1I2ZA 3TDKA 1P9LA 4XYMA 3JYNA 1MA0A 1U8FO 3K30A 3BTOA 2UUOA 3I9KA 1N2SA 3E48A 1BMDA 1FF9A 2CVZA 4CM7A 3DOJA 2O48X 4DXHA 1B16A 3STHA 3DAFA 4WLNA 3VTZA 4J0EA 4B4UA 1HDZA 4IZHA 4S3MA 3K2BA 2JD2A 2ZKLA 4OO3A 4E3ZA 1JAXA 4NI5A 1Y9EA 5DNAA 1P45A 4XGKA 3LVFO 1VKNA 5IF3A 2Q45A 4AJKA 2CMDA 4KQXA 1QR6A 1TB4A 4FC6A 1F17A 3MTJA 4CMEC 4A73A 3ZGYA 3U09A 4Q9NA 1WNTA 2W4QA 1QMGA 4GX1A 4DPKA 2VTEA 4YPOA 2WM3A 3M1AA 5ENDA 1C0IA 1HDYA 4D42A 1KEWA 2AXQA 3GGGA 4Y6SA 1YVEI 3L6EA 2PY6A 1HYEA 5G0TA 4BO8A 3FRJA 3PJGA 1ZEJA 1DIRA 3VPXA 4WE3A 4DYDA 3LZ6A 3VKUA 2NU9A 4CM4A 3ZI0A 1QLHA 2IE0A 3V2UA 4QFDA 1PJQA 1HE4A 1C1DA 3F4LA 1X7DA 2RHRA 1RYDA 4CMCA 3A9WA 1EDOA 3SX2A 4D79A 3VPGA 5A3VA 1D7OA 3GVPA 4BO9A 4BV8A 4ZQBA 5JYEA 3ULKA 3N74A 1MC5A 1KS9A 3CMCO 3TZKA 3ITKA 4L0QA 2EF1A 3ITDA 1B3RA 3U4DA 1ZW1A 1WMBA 3WFJA 2X1HA 3BMCB 5TT0A 3WGOA 4ND2A 1R15A 1S7CA 2HLPA 1U7HA 2ZYGA 4L74A 2OFPA 1B8VA 1G0OA 2BELA 2C7VA 3KM0A 4NR0A 3I6IA 2NNLD 2GLXA 1U5AA 2Q1WA 3LLVA 2FPGA 3GEGA 4C7JA 3GNQA 4PG7A 1YL7A 2PGJA 5H81A 5GZ6A 3WG9A 1BDMA 3OJFA 2OHXA 3ZU2A 3VVBA 4P4GA 1QLJA 4CMHA 2JHGA 4PCVA 2QQ5A 2EEZA 4BNHA 1GZ6A 5JO0A 2EHDA 5A9RA 1ADGA 5JLAA 1H2BA 5TS3A 4C4OA 4E12A 2XF8A 1FMCA 4YCAA 3WGGA 5KVCA 1CQJA 2QRJA 4TVBA 4XJTA 2VWPA 3PRJA 2DFDA 1XEAA 2V6FA 1P1RA 4Q39A 3GNTA 4NBTA 4R16A 1M2WA 1EBFA 4HNGA 3NYWA 1T2CA 1UP6A 3WTBA 5KCZA 1ZVMA 1PJTA 3V2GA 1K2WA 5JDCC 1N92A 4O5OA 3GZNA 1EDZA 3NT2A 1LSJA 4OOEA 3W6UA 1Q0HA 8ADHA 1TLTA 3DBHB 5IDQA 3TN7A 4CQMA 1E6WA 3ASVA 4YYZA 4MP6A 4N18A 1Y6JA 4MO2A 1DAPA 1AXEA 1Z73A 9LDTA 4KWIA 4DA9A 4R51A 3T4XA 4BNLA 1LI4A 4ALLA 3JD1A 1BVUA 4R5HA 3E9MA 4E2ZA 1HTBA 3CXRA 4J9UE 4E0BA 3IKTA 1T1SA 1WZEA 1NWHA 2QRLA 5L7YA 1G6KA 1D4FA 1LDMA 3VH1A 3I6QA 3M1LA 1I24A 1GYPA 4CLEA 2RAFA 4YXFA 1LRKA 5HA5A 5TF4A 3GAFA 4QX6A 5JCXA 2EXXA 1IPEA 1Y5RA 4L4SA 4GGPA 3D1LA 2GN4A 2R00A 3ZHXA 4BO3A 4MVJM 3K96A 2FR8A 5TC4A 1YB1A 1A7AA 1MX3A 1MXFA 5ICMA 1HE2A 2VQ3A 3VZSA 1B0AA 2Y0DA 1KVQA 1W8DA 1BXGB 4J4BA 4YT8A 1HYGA 1PEDA 3PLNA 2Q2VA 4FOSA 4S1VA 1RM3A 3B1JA 1E3WA 4XJSA 4XQCA 5L3ZA 4EGFA 4KOAA 3WDSA 3SJ7A 3WJAA 4B4VA 3HSKA 2A35A 1IZ9A 3U4HA 3AM3A 1PQWA 5JY6A 2Y66A 5HTOA 4XWYA 1Q7GA 1ZH8A 2H1SA 1KOLA 3OQ1A 2WSBA 1VI2A 3JYPA 4IMRA 4R68A 1EVYA 3ANMA 4B7XA 4XB2A 3S55A 4PLPA 4MKRA 2B4RO 1OC2A 1LXCA 3ZWNA 2OUIA 3LT4A 4BNIA 1I2CA 3C7DB 2OORA 1NVGA 2E6UX 1VSVA 4BOYA 4YT5A 1BHSA 1U28A 1GU7A 2LDXA 1HDRA 4YT4A 2I76A 2VYVA 4YWJA 2BH9A 1LLDA 1O9BA 2XXBA 1KEUA 1BXGA 3WQSB 2GR9A 5AQ1A 1M67A 4HBGA 4FW8A 1FDWA 2WDZA 4CMKA 3HDYA 4Q3DA 1SMKA 5U9CA 1ENZA 3IS3A 4YJHA 2C07A 3EMKA 3ETDA 3HZZA 4NK4A 4AJ4A 5JYDA 3IC5A 2HJSA 2DAPA 3CMMA 3TL3A 4IJWA 4LMPA 1UXIA 4R1NA 4M49A 4CLOB 1Q2XA 2YYYA 1I5RA 3LU1A 1BG6A 1RM4A 4FC7A 4EI2A 4BO4A 1EVIA 3IDSA 3Q3CA 2DUUA 1P1HA 2BKAA 4HP8A 3GDFA 1XWFA 4BGEA 4M1QA 3AM4A 1VJ1A 2I5PO 5GMOA 2DTDA 2FZWA 2ZB3A 2Q1UA 3OIDA 2C59A 3DWFA 4PZDA 5IFLA 5A1TA 1OOEA 1B15A 1F0YA 1PQPA 4AVYA 1QYDA 4BNGA 1BVRA 4CQMB 5A9TA 2C2YA 3L07A 1E0DA 4EUEA 3KLMX 1SOVA 4E33A 2A9FA 2OMEA 2JFFA 3JQAA 1UXHA 4AJJA 4ND3A 5L7TA 3JD4A 1NHWA 2BFMA 1E3WB 4YJFA 5BT9A 3ADPA 4ZGWA 3LSYA 3L77A 5L40A 1M6HA 4Q3NA 3MTGA 4WNIA 3W4JA 5T8KC 3QWAA 3KYDB 5DBFA 5HRUA 1JA9A 5IXSA 3TFOA 1JKFA 4CJXA 4DLLA 4BB5A 3EYWA 3DXFA 4OL9A 3N58A 4TKLA 4W82A 1OI7A 3ANNA 2WYWA 2VHWA 1DRUA 4FFNA 1PJCA 2NTVA 2UV8A 3KETA 3PIIA 5C7IO 2PWZA 3UFXA 2Z5LA 4DQVA 1A5ZA 4PLHA 3HADA 2AEJA 3ZNNA 2Q3EA 5K6AC 5LC1A 4RLHA 2PLAA 1FK8A 3INRA 3NJ4A 3GGPA 3ZCXA 3ZWBA 3U62A 1E1MA 1C3VA 4ZICA 1UR5A 3I9LA 2NU6A 4GX5A 2C7GA 5CEFA 4HFMA 4D0RA 4LCEA 3VOSA 3G79A 3MJ4A 1EUZA 1DC6A 3F46A 3F5SA 1V3TA 2ZB8A 3PEFA 4XYLA 1ZKMA 2CVOA 3JQGA 3P19A 4BMNA 1I36A 3NGLA 3RUIA 3BMCA 2JD0A 1W0CA 5T5QA 1J4AA 5F1KA 1VJTA 5JXWA 3FCOA 4RVHA 3JYOA 3VZPA 2ZQZA 5JFOA 4L4XA 3EK2A 2BGKA 3IJRA 3FPLA 4JQCA 4DIFA 3PQFA 1WMAA 1I01A 1QKIA 2NACA 4MVJG 2WE7A 5AYVA 3PGJA 3EAGA 3TOXA 3BMQB 3DO5A 4NMHA 2VZ9A 4XKJA 2NM0A 4IJVA 3LT1A 3PFWO 1A27A 1NXQA 3QSGA 4E5KA 4W4TA 5I9MA 4ZJUA 1ZK2A 2GSDA 2Y0EA 4EUFA 3SJUA 2X4GA 3UF0A 3PGXA 1DAOA 2HMUA 1EFKA 1B8PA 4J7UA 4ALNA 4BUCA 4EUHA 4E5NA 2GGSA 4QUKA 4CLRB 4A03A 2GZ3A 3HG7A 3OEWA 4DTIA 4P8RA 2G76A 3SBOA 5EJ2A 2VHXA 3PTZA 1O0SA 3BMNA 4GBJA 1MB4A 2EP7A 4CM6A 1WW8A 1XELA 3MJSA 2FN7A 1R4NA 3OETA 3OIFA 4DVJA 4B79A 2NWQA 5CEEA 1IUKA 5HBRA 4BGUA 5FFFA 4XQGA 4DYVA 1BW9B 5A3JA 2J3IA 4WLEA 1EZ4A 2ZYDA 4J91A 5AXCA 3ONFA 5A05A 4ZA2A 2AG5A 4ZQGA 2Y1CA 3S2GA 4R3WA 2Y1DA 3PWSA 1R66A 4L9RA 5TQVA 3C8MA 5BSHA 4PZCA 3JQBC 1N1EA 5KWEA 2B36A 5DN9A 2J3JA 4XEHA 1DJQA 3RJ5A 4XIYA 1AUPA 2BLLA 3TNLA 4QSMA 4NQZA 1X0XA 5AXAA 3ZNQA 2HUNA 1DHTA 1YKFA 4ZN6A 4B8ZA 4PFJA 1KVTA 3RD5A 4XGNA 1P33A 1YJ8A 4Q3CA 4DUPA 3FNHA 3SLKA 1LSOA 1LQUA 3GDOA 1RM5A 3OEYA 1NFFA 1XCBA 3W4IA 4AG3A 3CTMA 3NUGA 3HJAA 3LC7O 4FFMA 4RVUA 5JPIA 1U4SA 5EQFA 4TRRA 5CPBA 3WNVA 4G81A 5L4SA 1NQOA 1XYGA 2YV1A 3F9IA 1NAHA 1DIGA 1YB5A 3M2PA 4I9HA 1CIVA 5F3RA 3RKRA 3QVTA 4K9DA 4RVDA 5IZCC 3BTSA 2OBNA 2V6MA 4CUKA 4R4JA 3ZNOA 4DREA 2VUUA 4AJEA 1SBYA 2RBEA 4K26A 4CMIA 1ZJZA 1Z45A 4HY3A 1NPDA 1ADCA 2VOEA 1UDAA 4NJOA 2PKQP 4MVJE 3V8BA 5KTKA 3OSUA 4HV4A 1GTMA 4PG6A 4WLUA 3ST7A 1MXHA 1HDGO 1PL8A 1YL5A 2AE1A 4CM3A 3WYCA 1P0CA 3ZWOA 3Q9UA 1H9BA 3QV1A 4DPMA 4IQGA 1ISGA 4KUEA 3KEOA 4Z9FA 4AJIA 1SB8A 1FDVA 2D5CA 2O2YA 2R6JA 4FS3A 1T2DA 1XU9A 1YH3A 2CDCA 2IYPA 2J3KA 3BHIA 4MVJH 1LRJA 4CM8B 1N9GB 5A4DA 1XKQA 4UEJA 5GY7A 4RPGA 3FR7A 4PN3A 1T4DA 4FN4A 3QW2A 3U5TA 3ROPA 3H8VA 2C2XA 3GDGA 3KRTA 2YV3A 4IS2A 4II3A 2QRKA 2Z95A 3S2FA 2BHLA 4BIIA 4XYGA 4YBZA 1HYHA 1C0LA 3WSVA 5TSDA 4M87A 1ZSYA 4GL4A 4NBVA 1XIVA 1LSSA 1BWSA 5CDUA 1ZXLA 3LC2O 3ZV3A 3V1YA 3RU9A 2E82A 4D3DA 3DAGA 3GUYA 5KVSA 3GPDG 4XD2A 1LX6A 1H93A 1GUYA 1VPDA 3C7CB 2PGLA 3DHNA 3LT2A 3AI2A 3UXYA 2P9GA 4NDNE 3C1OA 1LRLA 4IJKA 5A02A 3GG2A 3C3XA 4B3IA 2CUKA 3GVIA 3IJPA 4PLVA 5B37A 2D5AA 5K9ZA 1H6CA 3WIDA 4IS3A 4W9NC 5DCYA 1LEHA 5JCJD 1I3KA 1YDWA 3D4NA 3O8QB 4CM8A 4L4RA 1QG6A 1I30A 1X0VA 3DZHA 4RF5A 3AOEA 1XQ1A 5K0ZA 4U5QA 1A9ZA 2W2LA 2G17A 1YL6A 2P9EA 4JX8A 2B5VA 4J1TA 3DR3A 2GD1O 3O4RA 3PVZA 3QE3A 4KDEA 3VAZA 4GSKA 3GF4A 5KJCA 1XSEA 2WWRA 2AEFA 1GYQA 1KVSA 1KERA 1Q7BA 4Z0TA 3TPCA 3WWZA 4I5GA 3O38A 4ZRNA 2JCXA 3FD8A 5EL0A 4J3FA 5G4LA 3E18A 4EJ6A 3NTOA 4ILKA 4NHEA 2QG4A 2Q1TA 4QXMA 1GCUA 1PJLA 4BNKA 4H7PA 3GAZA 1UUFA 5G4KA 3TF5A 3JQFC 3B6ZA 3NDRA 1ID1A 1ARZA 3TQHA 2JAPA 4KUGA 2VUTA 4RORA 4BHTA 3NX4A 3JQEA 5CEJA 1I8TA 4HADA 5KVQA 2YFQA 3MEQA 2G5CA 2PK3A 4O0LA 3ROMA 1T26A 3RBVA 1CYDA 2J3HA 1MG0A 3WLEA 3PHIA 5JO9A 2GERA 1LDGA 4TROA 2CVQA 4O63O 3UW3A 4FD3A 2NUAA 4BO1A 3KSUA 5KNLA 3JQ9C 4P38A 3ZV6A 4DLAA 2OBYA 1E7MA 4MKXA 2I66A 1AHIA 1K0UA 3HDQA 3T7EA 1NYTA 2FHSA 4M54A 3WTCA 2O7QA 2W2KB 3WLFA 2DUWA 2ZJ1A 2PA3A 1N1GA 1NQAO 3HFSA 4R1UA 2XAAA 1M76A 4CQMD 3WQQA 3OQBA 2POQX 1VLLA 2VYND 2DVMA 2NU7A 3ADOA 5A5EA 4PGFA 2HCTA 2PV7A 3RWBA 4YACA 4BB6A 3HN7A 1ENOA 4LGVA 4JCOA 3P5SA 3DBHA 1IHYA 4GPD1 4AJ1A 1SPXA 2Q46A 3FR8A 4TVOA 4ZU3A 5TIIA 2Z1NA 5KVVA 1GQQA 4DQUA 4QFCA 3EZYA 4EBFA 5B4UA 4AJHA 1SAYA 4OM8A 4D44A 3I4FA 1K5HA 4PZEA 3ZHBA 3ZV5A 1E3JA 4YJGA 5I8ZA 3UCXA 4RCVA 4J43A 4C7KA 2O4CA 1K89A 1EMDA 1M6WA 4Y98A 5G2OA 3NGXA 3WGTA 4JP2A 4JLWA 4CUJA 1X14A 1YOVB 1U5CA 2JL1A 3PXXA 5COQA 3NAQA 4FOOA 3BMQA 3AUUA 1LNQA 2HAEA 3H2SA 3KOUA 4U0JA 1L7DA 4F6LA 3WGQA 3O8QA 1HEUA 2UAGA 3UHAA 3AFMA 3WGIA 2BFOA 3VH4A 3PDJA 4LW8A 4N7RA 3VPSA 1WVGA 3E9NA 2Z1MA 4NNJA 4XQEA 1X15A 3ICCA 1PWZA 2PD6A 1SCUA 4MVJA 3GUCA 2GZ1A 1KBZA 4J7CA 5CFZA 4FFPA 4U6QA 5KOIA 3PJFA 3QLJA 4Y67A 3KYBA 5JDIA 2CF5A 4GLOA 5IG2A 1P31A 3FNGA 1HE5A 3GQVA 3KUXA 3RC2A 3RBXA 4GI2A 4B8WA 1P1FA 3OJOA 4EJMA 4NG5A 3IL2A 2PKRA 3GRPA 1VL0A 1N7GA 1G0NA 3FBTA 4LRTB 4ROSA 3AUAA 5DF1A 1Y8RB 4MP8A 2JHFA 2O3RA 4AJOA 1Y8QB 4WCDA 4TZTA 1HL3A 1HDCA 1UDBA 4DLBA 3DHYA 4OAQA 5KKCA 2C5AA 4A5OA 4OGWA 2HMWA 2CF6A 4ZQFA 5JC8A 3C85A 1V0JA 2CY0A 3D5TA 4L8VA 1GAEO 2FRDA 3VTFA 6ADHA 4R3NA 1YQXA 4CM4B 5AXDA 4X54A 1T1RA 1DRWA 4PLWA 1U1IA 1UXKA 1GUZA 3L4BC 4DMMA 1T2AA 1PJSA 3CPSA 1PGNA 4RVGA 4JJIA 3IP3A 1E3SA 1PZHA 4LMRA 4TWRA 5B12A 1PS0A 4GVLA 1T4BA 1YOVA 2GN6A 4XZ3A 2X0NA 3DONA 5K6AA 1D1TA 5IN4A 4OXYA 3AU9A 2O3JA 4IBOA 2B5WA 4NU5A 4N54A 4Z3KA 3TZHA 3H9UA 4GX0A 2PTGA 2O3QA 3VKVA 2YHUA 2P4HX 5FYDA 4W7IA 2BRUA 4RJTA 2WEKA 1WZIA 3OICA 1I10A 2CDAA 3H4VA 1P77A 3GNSA 5IN5A 2Q2WA 3MZ0A 2EKLA 2JCVA 4Z9YA 2A4KA 3NTRA 1JN0A 1GCOA 4TMFA 4TSKA 3AI1A 1GUFA 5B1YA 4PVCA 5EESA 4BNTA 4CV0A 3KYCA 4AJNA 4MINA 1UZNA 3PJDA 4I9UA 3RAJA 3KSZO 4HFJA 1AE1A 4BQRA 2R00C 2QYSA 1ZK3A 4ND5A 3RSHA 4BL5A 2WD7A 3JQAB 3QY9A 1GEEA 2PH5A 1I2BA 2PZKA 4FQ8A 4ESOA 2AQIA 1PJ3A 4D43A 3GN2A 5C37A 4WKGA 4EDFA 1Y1PA 1YQGA 3KVOA 4GMGA 2EW2A 3H5NA 2I65A 4FJ2A 1MG5A 4ZQHA 2ZK7A 4K6FA 4B3JA 4DIOA 5C5IA 4LSMA 1VSUA 5JY1A 1YO6A 1Z82A 3DAPA 4FIZA 1ZBQA 4XX0A 4MVJF 4NJMA 3SC6A 1TT5A 4CODB 5JDIC 4RGBA 1DSSG 3RC1A 1ZUD1 4N5MA 4WASA 2GPTA 3CH6A 3JQ6A 3K31A 1RM0A 4RPJA 1ZNQO 1E6UA 3KYDA 1YBAA 4R5MA 1H94A 3A14A 4IMPA 5EMHA 2VZ8A 3HE3A 3WMXA 3W1VA 3UUWA 3F6YA 4IGEA 4RZHA 3DTTA 4DBZA 4YRBA 2Y99A 1OAAA 3ZDFA 3JV7A 4WOJA 1FJHA 4YAGA 4MDHA 2IDZA 2VRBA 3L9WA 5BNTA 2VNAA 3E82A 3E6AA 4JBGA 4GKBA 4NBWA 1O94A 1BDBA 4L75A 4E32A 4JJGA 2WYVA 4HWKA 4DBVO 4UEOA 1JDJA 1ZK1A 4RZIA 4LCJA 3A1NA 4KDFA 4LVCA 1QV6A 1T24A 1HSZA 3DBLB 5A5FA 2JJYA 3Q0EA 3N7UA 1EUDA 3V1UA 4A2CA 1E3IA 5KIAA 2I3AA 2RH8A 4K6CA 3I4CA 3KBOA 2O23A 4QO8A 1W4ZA 3CZMA 3OQ6A 2CSUA 5JMWA 2Q50A 2FZEA 4NU6A 3PZBA 5DOVA 3KHUA 1P74A 1IULA 4M55A 3UOGA 5I9NA 3WWYA 3LF1A 4BNFA 3EW7A 1DC4A 3QQPA 4GH5A 3UAGA 4IXTA 5KJ6A 5L4NA 3I83A 3PYXA 4ALKA 3MOGA 4O6VA 1DFGA 5IDWA 2X8LA 3GFGA 1LUAA 5BQFA 3DMYA 2X9NA 1C0PA 1KY4A 2PZLA 4GWKA 1P44A 4XA8A 4BNNA 2NADA 3JYQA 1E92A 1XU7A 2YV2A 1JWBB 3KEQA 4LISA 3FNFA 4J4TA 5B4VA 1HF3A 4FFLA 4OYRA 5CDTA 1LA2A 3GHYA 3ROKA 1NFRA 3LLSA 4IIUA 4KP7A 4ALIA 1IHXA 3CZRA 4BGVA 2FP4A 3SVTA 5KJFA 2D2IA 3GEDA 3QWBA 1PJ4A 1K6JA 2E37A 4Z3DA 3WOHA 3C1AA 1T25A 3JYLA 1EVZA 1ZK0A 3RUCA 3G49A 1TEHA 4OQYA 3VC7A 5BSGA 4CM9A 2IXBA 5CPFA 4OOFA 3K73O 1YRLA 4FPXA 2JD1A 3ZV4A 2EKPA 3ONEA 2VT3A 3R6DA 4LK3A 3TZQA 4GLLA 4WLOA 5AXBA 4PLGA 4WEOA 1NNUA 1LC0A 4L73A 4MIYA 4YJHB 3NRCA 4OXKA 1NTOA 3RI3A 1UJMA 2ZTVA 1JVBA 3FSRA 4RVSA 4MVJD 5KJ1A 3VPFA 1ML3A 2W2KA 4XGIA 1GFSA 1B3BA 2GDZA 2YHIA 4RLSA 3AUSA 2BF7A 1VRWA 2G82A 1L1FA 5F5NA 2G1UA 1HT0A 4INAA 3A06A 4BGIA 2H63A 3ZWVA 4YAEA 4RF3A 3IP1A 2HK9A 1E5QA 3JD2A 1R37A 3TZ6A 1ISHA 4YQZA 3ZU3A 2V65A 1PR3A 2YQ4A 4PG5A 1YONA 1BSVA 3S2IA 3K2EA 5MDHA 3JQAD 1I3NA 4A26A 4NK5A 4YT2A 4CUZA 1K3TA 3WFIA 3UICA 4CPDA 2EP5A 1HKUA 4IDFA 4DPLA 2ZTMA 4KTTE 1MFZA 5L95A 4WLFA 3K9QO 4R1TA 1YWGO 1P0FA 3DZKA 1U2DA 1H6BA 3X2EA 1HLPA 1PJ2A 1UAYA 2I3GA 5IJZA 1IL0A 2HMSA 3H2ZA 2UUPA 4YJFB 3F1KA 3WX0A 4D0SA 1Y81A 1D3AA 7ADHA 1R0SA 2DQ4A 3OFSA 1LDNA 3PYLA 3RVDA 1F8FA 3I23A 3QRWA 4L76A 2V6GA 3GY0A 3WMWA 1V3VA 2X58A 3K92A 1ZMTA 2X7HA 3K8ZA 1QV7A 4PG4A 2DKNA 2IXAA 5ILGA 2DLDA 1ADFA 4TQGA 3MCVA 3NEPX 1R16A 5KJEA 4CQLB 1Z75A 1NQ5A 1WAMA 1XHLA 4OXNA 2VUSA 1LU9A 1ZZEA 3MJTA 3Q1LA 4UEKA 2HK7A 4U8GA 2A92A 5A9SA 3JCZA 3V2HA 1H9AA 3KXDA 4UUOA 3OHSX 2H5LA 1KC1A 4R9SA 2BFAA 1CF2O 4OQZA 4FJ1A 3UCEA 3G3EA 1DO8A 1QSGA 4PLZA 4WLVA 4CLRA 5ITVA 1KVUA 1YGYA 5MGBA 1PR9A 2AQKA 3OA2A 4MKZA 2HK8A 1IPFA 2BI7A 3GR6A 3GG9A 4JXKA 4RF4A 5DCUA 3QIVA 5A06A 1ULSA 1MV8A 4CV1A 1I3LA 2ZYAA 5CHEA 4WOKA 2EV9A 3WXBA 4CV2A 1C1XA 3PHHA 4XYBA 5TRTA 2IZ0A 3EC7A 4B3HA 3KO8A 3OJLA 3OMLA 3WYBA 5LDHA 4UVGA 3VDRA 3GHHA 3RC7A 3UKOA 5AOVA 3FI9A 5COAA 2I99A 4QO7A 3ORFA 1E3LA 3GZ4A 1WDKA 5BNIA 4YJDA 4IQ8A 1U4OA 3MOIA 1PQUA 4E30A 4I8XA 4G65A 1J6UA 2DT5A 2VHVA 1LC3A 5A9SB 1MP0A 1C14A 2IZZA 1DB3A 5HWSA 3LF2A 4J1QA 1XR3A 5TT1A 3TL2A 1AHHA 2HJRA 5IZ4A 2I67A 3ENKA 1TVEA 2X9VA 4LN1A 3GGOA 4AL4A 3EY4A 5JBIA 3AM5A 4Q3EA 1WXDA 4PG8A 1SEVA 1ULUA 5IAAA 5JAMA 2Q4BA 2ZB7A 2R2GA 1DFIA 1SEPA 2W2LD 1XDWA 2CFCA 4TZKA 1JKIA 3DZGA 4P4LA 4OJNA 3WBFA 4CM1A 3PWKA 4CMGA 1U9JA 1UXGA 3AY6A 3G1UA 2IZ1A 4WUVA 3C7AA 5L7WA 5T64A 3BTUA 2B4TO 2EERA 2V6BA 3DOCA 3IUSA 4PRKA 2B35A 3CIFA 1UZLA 4HNHA 2JCYA 3QA9A 4RPHA 5THKA 1YS4A 1Q0LA 4GGOA 3IKVA 4M86A 3CINA 4K28A 3FPCA 1EQUA 1PL7A 3PPIA 4JBHA 4GX2A 4E13A 2NU8A 2DFVA 3PP8A 2BD0A 1B7GO 3FN4A 1XLTA 4NPCA 3WSWA 1KEPA 1X13A 3I1JA 4MVJP 4DQXA 2D1YA 4Q3AA 3O9ZA 3H65A 3FWNA 1P1JA 4N5LA 4UUMA 2CD9A 1HDXA 1VC2A 4CLHA 1MUUA 1K6IA 3WGYA 1OC4A 1XA0A 2D4AA 4ZQEA 3ZW8A 3TRIA 5I7SA 2JKVA 2NTNA 4Z0HO 3I52A 3QWHA 2J5QA 4XYEA 1E6EA 2VZ0A 4H3VA 1C1XB 2Y93A 4MPDA 3NDIA 2PR2A 4J49A 1ZSNA 4MVJI 2NVBA 3ZWAA 4G2NA 1IYZA 3MWEB 1N8KA 2X23A 5I9LA 2NVWA 2ET6A 1D1SA 2HU2A 4I5DA 4I5EA 3HUDA 2W8ZA 3FTPA 1EBUA 4Z6KA 1NPTO 3C1TA 5AVOA 1GV0A 3FWZA 2X5OA 4EEXA 3DTYA 1PZFA 3HDJA 3P2OA 4E2YA 5I7EA 3R0IA 2UDPA 2AW5A 1CERA 1G1AA 2CNBA 3M6IA 4J4HA 4YRDA 1TA4A 3KLPX 1TXGA 3AOEC 2P5YA 4P4NA 1GR0A 2GASA 2P2SA 1GQ2A 1C0KA 1HRDA 3R3SA 3Q11A 3H3JA 4CM9D 1UH5A 4Y8VA 4Y9DA 3W4KA 2NQ8A 5EINA 2OL4A 1AN9A 2HMTA 4J1NA 3U3XA 2I9PA 4XR4A 2SCUA 5ER9A 1KY5A 3G17A 2A94A 1GZ4A 2VOJA 1Q7CA 5JAIA 2VWGA 1M75A 2X9GA 3H9JA 3JQFA 2OP1A 4YB8A 3AW9A 3H7AA 4ZRMA 5DBIA 2ZQYA 1M66A 3FTNA 2ZB4A 5T6BA 4OKNA 1NM5A 1QYCA 1LLCA 4O59O 4EEZA 3RUEA 1PS9A 1YJQA 3CEAA 4WCFA 3ROQA 4F3YA 1EUCA 2EW8A 3LQFA 1UAGA 4F6CA 4I9NA 1HE3A 1VL8A 5EIOA 3ZWPA 3UCFA 4B7CA 5FWNA 1ISMA 2FSSA 2PKQO 2XOXA 1A4IA 2HMVA 4J7XA 1J49A 3IUPA 1NAIA 1ONPA 4JNKA 5BSFA 5G0SA 4BKQA 4R9RA 2GF2A 3W8FA 3Q2KA 4IDGA 1GY8A 2X0IA 3DC2A 3EZLA 3JQ9A 4J90A 2RCYA 1I32A 1RPNA 4RPKA 4E21A 1KETA 1TT7A 4KQWA 4YAJA 3H9QA 1I33A 1PIWA 1BXKA 3ANLA 3BA1A 3R3JA 4XCVA 4CR7A 1RWBA 3DHEA 4BMVA 5GZ1A 3JQ8A 5ITWA 1LLQA 1H6AA 1E7YA 2PH3A 1F8GA 2EKQA 4Z9XA 3B20A 4AICA 3C24A 1YDEA 4XIJA 3TZCA 3E1KA 2Y1EA 3FBGA 2PFGA 5A03A 1X7HA 5F1PA 1F06A 5JW6A 1ZO8A 1BXZA 1EE2A 1NVMB 2D59A 3MWDB 5JCJA 3VZQA 2VNSA 1SO8A 1ONOA 1I3MA 2VRCA 1DHRA 2DTXA 1XGKA 4UVDA 3HB5X 1ZEMA 3Q9NA 3V5NA 1LDYA 4D46A 1KIFA 3F4BA 5COBA 3GH3A 5HS6A 3RQSA 4BNWA 4PLYA 1CQIA 4GQAA 3AJRA 3B1KA 4EW6A 5T57A 1RYEA 4DMLA 4NBRA 1HDOA 4BNZA 3AI3A 1TI7A 4FSHA 2WD8A 2B83A 4W99A 3QVWA 1SOWA 2D0IA 3H6KA 4PLFA 3EGOA 3UVEA 4QT0A 3FF4A 3RBZA 3DFUA 4BVAA 4ND4A 2WD7B 3IAHA 3PYMA 4YEDA 4I1IA 1E77A 2B0JA 3WJ7A 3F47A 1EQ2A 4DIBA 3B70A 1NP3A 1R12A 4GKVA 4G5HA 1B26A 4E4YA 2YDYA 1YB4A 4UUPA 1T2EA 2IYOA 2PD3A 3BYZA 1R0LA 4PIVA 4WECA 1XG5A 3CSDA 4OMUA 5I7FA 1S6YA 5IXYA 4U0KA 3GMSA 3L9XA 4NBUA 4XRRA 1LTHR 3K5PA 2NVUA 2DTEA 2QHXA 3SLGA 2JFGA 2X0JA 3RCBA 2DBRA 1PGQA 2O3TA 5L51A 4ZHSA 2GN9A 4HXYA 4TRJA 4F45A 3W6ZA 4WCFC 5G0VA 2DBQA 2FY8A 4BO5A 5DOZA 3SEFA 3JQ7B 4YA6A 4R54A 1DBVO 5CAEA 3I5MA 3KTDA 3GA0A 1J0XO 2GN8A 3NV9A 2OO5A 5TJ9A 4IPTA 4EYEA 5EN4A 3WBBA 2V7PA 5FEUA 2DPHA 3SXPA 4NFSA 4YAIA 1DFHA 5T8KA 3R1IA 3HQ4O 4ZD6A 1N9GA 1WPQA 3TJRA 5L9AA 1B14A 3WGHA 1DC5A 8LDHA 4CM5A 1E3EA 3ZHZA 3L6OO 4FFOA 1T2FA 3INGA 1R0KA 2EG9A 1ZFNA 5CP8A 2Y67A 1ONNA 2JAHA 1OFGA 3P2YA 3QVXA 2OZPA 3OA0A 2H6EA 3IQDB 4XQ9A 3LK7A 1E7WA 4IDBA 3HDHA 5JMPA 3DBRB 1HWYA 3GEMA 5TJHA 4NFYA 3IMFA 3HB4X 3UN1A 3O26A 3KZVA 3WQRA 2Q2QA 4BO2A 4IDAA 2Y1OA 4WK6A 1OMOA 3AU8A 3NJ8A 3WS7A 1NQTA 3IOYA 3QJ5A 5FI3A 3RFVA 1IZ0A 1DOHA 4CMJA 3BZUA 3OJEA 1CEQA 1P1KA 1L7EA 4FCCA 1X7GA 1YE3A 4FJ0A 4QECA 5B4TA 2G0TA 4A7PA 2BGLA 1PJBA 5JE8A 2Q49A 3GMDA 3D4OA 3PIDA 5U1PA 4AJ2A 1HLDA 1MC4A 5HS4A 1FDUA 4OSOA 1V9LA 1Y9AA 4OIMA 2X6TA 4KWHA 3X2FA 2OXIA 4D45A 3I9OA 3H5RA 6LDHA 4UVIA 1DIBA 4CL3A 4JN6B 1LBEA 5I8WA 1QYVA 4MP3A 1U3TA 3DBLA 5THQA 1Y8RA 4Q3BA 3I9JA 1A9YA 2DPGA 5LDGA 4UVEA 5HM8A 1O8CA 1FDSA 2E4AA 4MIEA 2VYVD 2FPPA 2O3UA 4YQYA 2EJWA 1PWXA 2AHRA 2TMDA 1VKOA 4J2HA 4JROA 1H2HA 5EQDA 3QHAA 1KYQA 4QQRA 3ONDA 2ZIZA 3QWFA 4ID9A 1Z7BA 5EPOA 1V35A 5FI5A 1GDHA 3D3WA 3S8MA 3TFQA 4E5YA 1X1TA 5CDGA 1GQYA 2XPCA 4E5PA 2GUGA 4MOWA 4ONEA 1DLIA 1ENYA 1QYXA 1PGPA 1W6UA 2FOIA 5JDCA 3L6DA 3RFTA 3DQPA 2W90A 2IEBA 7MDHA 1A4UA 4DRYA 2ZTUA 4HFRA 5A04A 2FSVA 1YXMA 3AUTA 3IIEA 3KB6A 4PVDA 3UGKA 2FR0A 4NH4A 1WDMA 2WTBA 5DP1A 1F14A 4FFRA 1WWKA 3MJEA 4WGGA 5DCWA 3GT0A 4F46A 2UYYA 4XR9A 3DB2A 1DIAA 3INTA 3S1LA 1U3WA 4R01A 5GZ3A 3PDUA 5DULA 3TOZA 4HFNA 5L4LA 3B1FA 4RL6A 4A27A 2YUTA 2Y05A 3ENNA 1DIHA 3ZWCA 1KEVA 5G0WA 2YJZA 3K6JA 3AY3A 5IDYA 4BNUA 4DWVA 4W7HA 3NT4A 4EJ0A 4CMIB 4D7AA 3DL2A 2P9CA 4TRMA 3OIGA 1X1EA 1WP4A 2Q4EA 2YDXA 3RUFA 4WCFB 4ALJA 4GSLA 2C20A 4AFNA 4IM7A 3RUDA 1UP4A 4JIGA 1IY8A 2B69A 2GNAA 1LQTA 1QRRA 1YBVA 1BW9A 3D0OA 2AG8A 3DDNA 3G1TA 2HRBA 5EERA 3GC6A 1QORA 3GRKA 3QP9A 2Y1FA 4J1SA 1PGOA 1DJNA 2AE2A 2QW8A 3E9QA 1AGNA 4CQLA 3BAZA 3D5QA 3ZWYA 4W6ZA 3ZU5A 4XDZA 1WLYA 3E8XA 3OH8A 1ZIDA 4IDEA 3Q6IA 4IY1A 1ISFA 1EK5A 2AQ8A 5DDIP 2O4UX 5F21A 4U6SA 4XRGA 3M2TA 4RQTA 4RV9A 2QYTA 3OF2A 1LJ8A 2YY7A 1LDBA 3D3WB 2E48A 3AWDA 2B37A 3QVSA 3S2EA 2GZ2A 3VHRA 3D7LA 1W73A 2GCGA 4E31A 4Z0PA 4IZIA 2AA3A 2FPIA 1KC3A 2GO1A 4LSWA 3HFGA 2ZATA 3JTMA 1PX0A 1GL3A 2FMUA 4FGWA 2PZMA 4YDRA 4FGSA 5JAZA 4XB1A 1LDEA 2F00A 3VVCA 4OKIA 4URFA 1JAYA 2C5EA 3GOHA 2IODA 1WDLA 2EWMA 2WYUA 1BGVA 1PSDA 2HRZA 3EUWA 4B7UA 1ISJA 1GYRA 1HSOA 1UP7A 3QWIA 3UH1A 3ZU4A 3OM9A 4BO7A 4YAKA 5CDSA 4PLTA 3PHLA 4BO0A 1FDTA 1ZSVA 4JGBA 4ND1A 1Q1NA 2QZZA 1PTJA 4XDYA 4GWGA 1PGJA 3E5RA 3OBBA 1CWUA 3D4PA 1R4MA 3A4VA 2C82A 4CR8A 5C3MA 1V3UA 4BNMA 2VT2A 1SZJG 2DBVO 2VWHA 5L45A 1EEHA 4Y6PA 3ICPA 3W8DA 4AJPA 2RIRA 1J5PA 1B2LA 4BNVA 5L53A 3GZNB 2NVUB 4E2XA 4DC0A 4J0FA 1XQ6A 2J5RA 3L0DA 2ZCUA 4BKUA 1A7KA 1Y8QA 2ZCVA 3I9NA 3RUHA 4QEDA 5DT9A 3HWRA 4H15A 3JQDA 3MJVA 3WNQA 1U7TA 3JD3A 3T7CA 2X22A 5JNLA 5DZSA 1GV1A 3BHJA 5U4QA 2RH4A 4M89A 3WYEA 1ISIA 2BI8A 3H9EO 3RKUA 5JS6A 2D3TA 3JQ7A 1E5LA 4BMSA 5JAQA 1E1LA 3ZWWA 1SNYA 4JJFA 4BKOA 3KV3O 5TLSA 1N7HA 3EVTA 1ZK4A 3DBVO 3U0BA 4D41A 3PZRA 4D3FA 4NZ9A 3BTVA 1VM6A 3TWOA 3ZZNA 3DFZA 1IE3A 4RO0A 4UREA 2X86A 2XXJA 4IINA 2E49A 4JP3A 2AMFA 1DPGA 1ZJYA 5I7VA 4H16A 1PL6A 1NASA 2PGDA 1DXYA 3COSA 4IGFA 4IJUA 4J6FA 3DBRA 4CMEA 4YR9A 3DOOA 3I3OA 5F5LA 5G0UA 1R4NB 4DC1A 1OBFO 1O95A 2HSDA 1JW9B 2TMGA 1SB9A 1NBOA 3U4IA 4J16A 3BMNB 2Y0CA 4IXWA 2X0RA 5ILOA 2AQHA 3CKYA 3RROA 1EK6A 2ZJ0A 1NR7A 5TGDA 1HZJA 4RVFA 2PZJA 2X5KO 3Q2IA 3HHPA 3FNEA 4YJGB 3WGZA 3ON5A 5CG1A 1EE9A 1GZ3A 2OOSA 4HKTA 4CMAA 4E6PA 3NT5A 4BNYA 3PQEA 3ETEA 4UVHA 1UXJA 3WR5A 3U4CA 4RF2A 3SC4A 3GN1A 5ICSA 1IOLA 3H3FA 3CUKA 2C29D 4BS9A 4DGSA 2CDBA 2H9IA 4WPGA 1HZZA 3VZRA 3LDHA 3NDJA 1JLLA 5BSEA 3BHMA 1N5DA 1MFPA 1Z6ZA 3EHEA 1NPYA 3KYCB 1YQDA 2AEMA 2UVDA 3JSAA 1CETA 4R69A 3PHGA 4K1LA 1U8XX 4BKRA
chains in the Genus database with same CATH superfamily
4RQUA 5ELMA 5FIUA 4DB4A 4DUYB 3BD6A 3MTDA 1NIPA 2PXXA 4TRNA 4HUJA 5FJJA 1HH4A 1Q0SA 3FDZB 3OFNA 1KQGA 1KZ4A 2IH5A 1WHSA 1WCYA 3ZG6A 1THTA 5FWXB 3ASUA 4W9NA 2OVFA 2XWSA 5CX4A 1WF3A 3U3RA 5JCPA 1MLDA 2JFHA 4JUCA 5AH0A 1FMJA 5DLDA 2OP0A 4D3SA 5JSFA 4HGOA 3OCVA 1DEXA 4HGPA 4KTVE 3DCNA 3IE0A 4A8PA 1XZKA 3AB8A 3BSWA 2QVBA 5FULA 4MRMB 3I2JA 2Y71A 4OUDA 3MINA 2GMWA 3CRRA 4EG8A 2EIHA 1ZAYA 5DXJA 1JKJA 1KH1A 2O50A 3E22B 1T8PA 3OQHA 1O5IA 2CJFA 2R48A 2R1TA 3BXXA 3W2FA 3U9LA 1GRRA 2QTWB 3IHLA 3NAGA 5EP1A 1KE1A 3CLTC 3W06A 5J23A 4WEQA 2J6CA 1HG1A 1KU0A 4RL6A 2WUDA 3VX3A 2L69A 5JR3A 5BR7A 5CG2A 3PI7A 5EJ4A 2P0EA 1SXJA 2ZYRA 5AVJA 1RT9A 4EKYA 4GMXA 1KK2A 3O2JA 2UXCB 1T5LA 4HDNA 3PS9A 4HB0A 3QLVC 3DT6A 4CF7A 5B2EA 3TX6A 3OECA 4JK3A 5LQCA 1WRBA 4RFSB 1UOPA 4IVPA 2IYFA 1ONSA 2OMKA 4PTZA 3EZNA 1ENPA 4U4AA 1U1GA 1YR2A 1CZNA 2A33A 1TVKB 2B8NA 4MGKR 5EJMA 4BX2A 3CY6A 2WMDA 4BQSA 2O5CA 3RC9A 3WLJA 5KYYA 1NWCA 2PR7A 4RULA 4YJKA 5CIWA 2JK0A 4FLFA 1JVSA 3ZVMA 2O54A 4WUTA 7REQB 4L02A 4L9AA 2W6JA 4J0HA 3I0NA 4CLXA 3KQKA 3U81A 1JFLA 3E0XA 1TD9A 2X5JO 1JB9A 3WICA 5CB4B 1UMDB 2IRWA 3L4EA 4O4IA 4ZAVA 2XQKA 1FXSA 2EQAA 4AD8A 2Y1KA 2GRAA 3N28A 4IOJA 2I3ZA 1KRWA 2FRDC 3CUTA 4ERNA 2G4LA 3DP9A 4N8SA 5CNIA 1Z6XA 3EF1A 3GLGA 3P71T 5H8WA 2BFPA 4M0LA 5C7LO 4FR5A 2AOXA 1WCXA 1OGIA 2J6BA 4Q7JB 1CQZA 4MCIA 1RLJA 4UE3S 2VDMB 3LX8A 4MICA 1RJWA 4J0IA 2ERXA 3OU7A 3UYKA 4FB5A 3A6PC 4G0PA 3HEBA 2OAEA 3ZLTA 3HRHA 1JTVA 1EFLA 4RW0A 3LBHA 3AEZA 4B34A 4BNXA 1N8TA 3C15C 4TXMA 4UULA 4D8YA 4EB8A 2I6TA 4RDHA 3MWKA 3UC5A 4OSPA 1APBA 3R0XA 1Q0QA 3Q6MA 4ZVRA 2GK7A 5G4KB 1H5QA 1IUOA 4EZBA 1YR8A 4DA0A 4WNCA 3DZBA 1GPMA 4YV1A 3W2IA 1XDZA 2XIQA 1YZ3A 1U0HC 5D5PA 2CL6X 2P6UA 4N3CA 1Y4UA 2QTAA 1J8VA 3AK4A 4EITA 4M1MA 1WB6A 3P32A 2O7SA 4QARA 1PW7A 2CXTA 3I8OA 5EUCA 1TQ4A 1RRPA 4DLNA 1EK2A 3A4NA 1BTOA 2FGJA 1XDGA 1YZNA 2BKVA 1TJ5A 1SRQA 2R8OA 2BMAA 3LYLA 3PF8A 3PJEA 5LA6B 5FBHA 3ERCA 3A10A 3DZ8A 3U1TA 4QU5A 4GL2A 4XEUA 5DM0A 4YJ3F 2PRSA 3CEMA 3GAMA 1FP4B 3VOBA 4BX3A 3L84A 2IJGX 3MJCA 2HNKA 4KC0A 4KZPA 4M1OA 3IT3A 1V5IA 4X95A 4JQYA 4LDNA 1SVMA 2Z57A 2QN8A 1YDFA 3GVHA 1DARA 2BHNA 5JH7F 4D26A 1SR8A 1JL3A 2ZE8A 3K1TA 3OCWA 4HXFB 3IVAA 1RAGA 4J1TC 1E0AA 1GKIA 1N7JA 2V7QD 4A10A 1X38A 2YWRA 1CUEA 3ZWMA 4FD2A 4P22A 4PW0A 2PYZA 3PLRA 4YAFA 1NHGA 2SHKA 1UQTA 3DEYX 3ENZA 3O90A 2WE8A 4G85A 3AR4A 1THZA 1YQ9A 1VG9B 3ZE7A 4RJIA 3CVXA 4ITRC 1VLQA 2FW1A 3PHJA 3ME5A 2QZJA 1EYZA 3EN0A 1WV1A 4K03A 16PKA 2ZXFA 2ZWPA 3KB1A 4CU2A 2AC4A 4B4WA 3LQKA 5TX7A 2FW8A 1K6XA 4OHUA 2CD7A 9LDBA 4MMXB 4COKA 4N5IX 2OCLA 3L8EA 4BLQA 2Q6KA 1HGXA 1RLUA 1UFQA 4JIMA 3PD7A 4ZAYA 3ZK7A 4DCJA 4F4FA 2B4QA 3KOXA 1IDOA 1QHXA 2KSQA 1XMJA 1JFFB 4BC0A 5C1DA 1IBLB 2QW1A 3QVOA 1HX7A 4RABA 4RSHA 3VDQA 2R8YA 3AF3A 3FKJA 5LFAA 1N8NA 3A28A 5IDVA 2OCGA 4QU0A 3VV2A 4Z4IA 4AY3A 3BSFA 1FFYA 4BO6A 4O4IF 3C4VA 3GPIA 3VH2A 4FYKA 4BKPA 4AUEA 3E7FA 1MH9A 1VI5A 3BHNA 4W5RA 3DW3X 4LRSB 4EHIA 3A04A 2XGMA 4KUHA 1H0KA 3SDZA 1ZCJA 1TJNA 2D5LA 3GFBA 1B8UA 3ANXA 2FEMA 4ZOCA 3LO8A 4NFHA 3LC1O 3LT0A 4FDTA 2PH1A 3HEAA 1M54A 5K9ZA 4ZEWA 4P08A 1OBHA 3UXYA 4C4RA 2H4FA 1ECFA 1RKXA 3D8NA 1QZUA 2P68A 4OIFA 4U2GA 1G3IA 5JNTA 2H85A 2AOTB 2IGBA 3HXQA 1ZMBA 5ALSA 3KKNA 3ZXYA 2YQ5A 1N3YA 2VTDA 2HKIA 2P78A 3BE4A 3TDKA 3FJYA 4HQNA 4FK8A 4ZDIA 5JNSA 1KORA 3B3GA 3TDNA 3ETJA 1N2SA 4BRZA 1KI8A 4CM7A 1FF9A 1RRMA 3W34A 3QEAZ 3SK0A 2QM0A 4JC5A 3TW0A 2V0GA 4J0QA 4NONA 1P62B 4OY3A 3KP1A 5DMXA 1KJIA 1L4UA 3L0OA 4DXHA 3ADDA 3E0QA 5B6JA 1AIPA 2WIKA 1SQFA 3T9AA 8ATCA 3A2MA 1HDZA 3PXAA 3VR6A 4GR9A 1OVGA 2ZKLA 3JZIA 2VT7A 2W2QA 2FX5A 4O2AF 1JAXA 2JEZA 3EIUA 4HXEB 3DKPA 1US8A 3ECSA 1R18A 5DNVA 3SEAA 5BN3A 2DP4E 4XGKA 4V0NA 5AVKA 2WVAA 5IF3A 1KOJA 2CMDA 4BCCA 2C0QA 3EOAI 1QR6A 2GFIA 5EY5B 4FC6A 1F17A 3IV7A 4P35A 3ZGYA 4RQBA 1J8MF 1KXZA 2W4QA 3EIEA 3MIZA 4P86A 1NKVA 3W5SA 3M1AA 4BVLA 1C0IA 2XNHA 2G4CA 5DHRA 5CFLA 5K0TA 1NTRA 4C0LA 1YVEI 3FWHA 1FX0B 2PY6A 5IK2D 3DH0A 2JI4A 1ZEJA 1DIRA 4UHKA 1XZEA 1J70A 1FTQA 4LTNA 2CDRA 4WE3A 3VKUA 2SECE 2NU9A 3I6YA 1JSZA 4CM4A 3ESQA 2IVFA 4K6OA 2FUG1 5GONB 1QOZA 2XCQA 1HE4A 1C1DA 2HWUA 3F4LA 1PDOA 5HEKA 5I5GA 1X7DA 1WBBA 2J9YB 1A8QA 4CMCA 1X7WA 1HOXA 2AKYA 2X8WA 2HSWA 4HYQA 3GVPA 4ZQBA 1P39A 2R6DA 3BKXA 2HPZA 4B84A 1HQCA 3TTTA 3RVRA 5BV2P 5IBCA 2F1JA 5MN4A 2CMHA 4G6ZA 4MCHA 4V0KA 4L0QA 2EF1A 3ITDA 1XJ5A 3U4DA 3CRVA 2O8BA 2JFWA 1R8JA 2OPHA 3WFJA 4PYLA 3BZWA 4IJQA 2Q6OA 4POAA 1W6RA 4L74A 5JCZA 3O8BA 4BTLA 4G0NA 3VXKA 1M0SA 1QDEA 2C7VA 2QLNA 4D0GA 5ECDA 1WDTA 4K87A 4PFSA 4F7DA 3LLVA 5EGSA 2Z6VA 1WQ1R 2FPGA 2ISQA 3WLHA 4HLDA 4PRZA 1RXEA 4JI2B 1QQ5A 2PGJA 3OQJA 5AJTA 1RWQA 5GZ6A 1NUQA 3VR4A 5K3OA 3OJFA 2ODWA 2CV2A 4OH7A 4QNNA 1GLGA 4I6EA 4QNRA 1CEXA 2FUNB 2QAGB 1QLJA 3NTUA 3IULA 1TJPB 3PFBA 1C9YA 2QMUA 1E4OA 4GYKA 4BFWA 3BF7A 3CTPA 1IPHA 3DE5X 2EHDA 5A9RA 1ADGA 2HLDD 5A71A 2E3JA 2AJLI 5E9QA 3RRXA 1AK9A 5A5DA 1XQ9A 3LP8A 3WGGA 1I1OA 5JEEA 1AK2A 5CURA 2AOWA 1XXHB 3A9RA 1GIAA 1W4BA 2WUEA 3GJ7A 4GDMA 1EXMA 1IOZA 3PRJA 4G67A 2XDWA 2FQQA 3TNFA 1JMKC 1GNTA 1COWA 1XEAA 2V6FA 4Q39A 4FGUA 4P6VF 4DM7A 5ALVA 5CK5A 1M2WA 2X0KA 4B3GA 1K63A 1T2CA 4JR1A 4K9KA 2PSHA 3W2TA 4B2IA 5JDCC 2C5FA 4O5OA 2WT9A 2N3ZA 2P9TA 2VLIA 3DSRA 1CDZA 4PU0A 4DHWA 4IEFB 2ZAOA 3HGTA 4GP9A 3E9YA 4BN0A 1TLTA 4EL0A 4TVSA 3B48A 5D85A 4CQMA 1E6WA 3ASVA 2W37A 4QYXA 4YYZA 3EBPA 4N18A 4RTOA 3GBSA 2QSUA 2ZRNA 3A1EA 4JI7B 2ZS7A 1L4MA 4MPTA 1SBNE 4MO2A 5TXGA 2XODA 1TL7C 4FWTA 3HJCA 3KS9A 4FOTA 4GOOD 4BNLA 4DA9A 2JGAA 4BUJA 1UFKA 3O3MB 3CXRA 3FIJA 2JATA 3IKTA 1WTCA 4NKRA 1DX9A 1GSOA 1XMSA 1R0WA 3JATB 4O3FA 3HBFA 1RAHA 4F3CA 3B36A 5AK0A 1YMVA 1XU4A 1SVNA 1IY1A 2MR5A 1KK0A 1W1WA 3QOYA 5HA5A 5TF4A 4QELA 4QX6A 3TIXB 2PT6A 1GQFA 1NJ2A 2OSBA 4HT3B 3BCSA 4MV5A 1IPEA 4HYEA 1E2KA 1Y5RA 3CEHA 1E9DA 3LT5A 2G3YA 3OWOA 4GGPA 4RKEA 3HVHA 4UARA 1O94D 5FPPA 1MX3A 1N5RA 2ZOSA 3B5JA 3R3ZA 3RIGA 3THWA 3VR2D 4DXAA 1OV6A 3M5PA 2IXGA 1S2GA 3KE9A 2Y0DA 3ROXA 4G1VA 4D6YA 1BXGB 4J4BA 3QE9Y 3TIFA 1XAGA 3WMRA 1T4GA 4IDQA 2BBOA 4FGKA 3CUYA 5A3SA 2X13A 3N76A 4NBLA 2MSLA 1R1DA 1E3WA 3B1JA 3LVBA 3TB6A 4BLPA 2O2IA 1FZQA 1E9FA 3AC0A 9ABPA 4G1UC 4B3SB 3SJ7A 3NHUA 4G8CA 2FJPA 1ZUNA 1PQWA 4R9NA 3FGZA 5E7MA 2Y66A 121PA 3X1DA 2M98A 1ZH8A 1E1QD 2ORWA 2M1ZA 5A6VA 3OQ1A 1VI2A 4LC0A 3ANMA 4XB2A 3S55A 3C4QA 3NHZA 1VKRA 4RUKA 3ELYA 1LXCA 2BBWA 3BL5A 4FHZA 1OV4A 5KUTA 2RKWA 2OUIA 4FKZA 3LT4A 4C6SA 3W5CA 1C4KA 2YNMC 2ZSJA 3C7DB 3QPAA 2LCIA 4DCVA 2A1UA 1A97A 2FLVA 5CD1A 2Q6VA 4DIDA 4JJKA 1U28A 1Z18A 3Q8XB 5EC8A 4YT4A 3AONB 3D6VA 1B1AA 3BIWA 2I76A 5ISMA 1Z4PX 2BH9A 2NT4A 3KTOA 3TD2A 3B5IA 4H7KA 2XXBA 3VPAA 1CF4A 2IBTA 2GN0A 3NHPA 1R8YA 1Z0KA 3AEUA 3IUYA 4X7BA 2KB0A 1HNXB 1VPVA 2WDZA 5CJ2A 1GGFA 5BQ3A 3H0CA 4C87A 1XQWA 3ABQB 3MD0A 1OZ0A 2IX3A 1EGQA 4AMBA 5DLYA 1RE0A 5MN5A 4MV3A 1VYVA 3T1VA 4NC9A 1I6WA 1HUQA 4AJ4A 5I7WA 3GROA 5KOHB 5JYBA 3LGXA 5JPCA 3CA8A 3ZHRA 3SM9A 1UXIA 3IURA 4JI4B 3H8SA 1BU5A 3ZGLA 3W5IA 1NI4A 4CLOB 4DDUA 1NVAA 1IM2A 2OESA 4LHEA 2UZ1A 2OQRA 3AZOA 3IDSA 3GFTA 4CHTA 5E1BA 1TECE 4HP8A 4DQDA 4NV3A 1PRYA 5ALOA 3KJEA 4UJ5A 4M1QA 4NVRA 2FEXA 5KNDA 3HR7A 1N3IA 4KXQA 1ETHA 2ZBDA 1HL7A 2VDKB 5GMOA 2DTDA 2ZB3A 1VQ1A 4R2MA 2HNBA 4IH4A 4YIKA 1P2TA 1ZIOA 1B15A 2WW8A 1QZXA 1Z08A 3OJXA 4Q0MA 1H0RA 2I91A 4L0CA 4PICA 5E9JA 1L7AA 1PQPA 4AVYA 3EOBI 1Q3KA 4BNGA 4XVCA 4KMRA 1DELA 1D2CA 2C2YA 4BB9A 1Z2DA 1GGVA 1ZH0A 2QA5A 1FYWA 2OMEA 3CLSD 1SCQA 1UXHA 3KALA 3M4ZA 1ACMA 3MUFA 3MCUA 1DZ3A 3Q7IA 3E15A 1MU0A 1Y3AA 2BFMA 1UK8A 1FY2A 2XTAA 3JD4A 1E3WB 3F3MA 3I30X 3NG1A 1JEDA 3CRMA 4I9GA 3E35A 4EVQA 4FNOA 3WY9A 3KT3A 1YFKA 4WNIA 4MEJA 1CJKC 3W4JA 3H1AA 3HVKA 4CCYB 5HRUA 3JRNA 2XX3A 3TFOA 2PVCA 3LHDA 4MHSA 4ND6A 3DXFA 5JNUA 3ZJ4A 1GG8A 1K4KA 2ETVA 4YROA 4US0R 3KJIA 3HV2A 3B60A 1DRUA 2UV8A 3SCZA 3KETA 4KQIA 1AY0A 2FR8C 2W7TA 1J0BA 3VYSB 4PY2A 1GTJ1 3A4IA 4DQVA 1A5ZA 1PWYE 3AHDA 1U0JA 4XLLA 6ABPA 1GTG1 3GZTB 2HR1A 1MNQA 2I7VA 3PC2A 2JLUA 4RLHA 1WCIB 1JJFA 1FK8A 1XVIA 2WJIA 5GINE 3O91A 3PKJA 3MBOA 3KU1A 4RYDA 4UC0A 5JJKA 4G0MA 1U5BA 3E5HA 1KQFA 3ZTYA 3C3EA 1OXUA 2HM7A 2V7XA 4TXJA 5CEFA 2JGMA 3EEQA 2A5DA 1CY0A 1M1NA 3O31A 2FZKA 1IZZA 2I8AA 1SKUA 3E9EA 3MJ4A 1DC6A 4H08A 5ABPA 2X8JA 1FSGA 1U94A 2J08A 2ZB8A 3IT1A 4X24A 5REQB 4EJFA 2IV2X 2PUHA 3HUTA 3DE4X 3NGLA 1M8KA 3ZBPA 4QBFA 1EA5A 4UKDA 1W0CA 3NU1A 3N9IA 5CH5A 5T5QA 4HGRA 4KPUB 3RK1A 5FDFA 4UDOA 1FTGA 1KYIA 4ZCIA 4BCDA 1II8B 2J48A 4L2IB 2PCLA 4DTCA 2W11A 3NHWA 3BDAA 2BGKA 2OV3A 1KYYA 1C2YA 1A2KC 1DBPA 1F6WA 2OV4A 2JFXA 1N2EA 3FI0A 3IVMA 3L7DA 2F1OA 3MMPA 3R0ZA 1JXOA 4GPIB 4I1PA 1HEYA 2NACA 2NU7B 4GXRA 4MVJG 2WE7A 3I9FA 4M9XA 4RVNA 5AYVA 5LBUA 3TMYA 4G07A 3MW8A 1QVZA 2J5BA 2ZFUA 1VHWA 3BMQB 4NMHA 3N3BC 2P35A 2X77A 3ZLUA 1CNFA 1C3EA 1R5NA 1V96A 1ZA2A 1U2SA 1IONA 3L5KA 4IJVA 3SSAA 4BLVA 4FLMA 2G0NA 2BLNA 3O2NA 3PSAA 4E5KA 5JECA 5BUCA 4W4TA 1Z3IX 2H2IA 3TLZA 4UQPA 2NXWA 2ODNA 1IFXA 4TWAA 3SG0A 3UF0A 1KO7A 5IWAB 4MS3B 4WA7A 4B1FA 3T7TA 1Q16A 1OX6A 3ZCSA 4BUCA 1FNNA 1XKTA 4CLRB 3EVAA 4E5NA 5LU9A 2NQ2C 3DE3X 4JUFA 2BEWA 4DDHA 1L1QA 4E08A 1BE1A 2DZDA 2FUKA 2G6BA 4QYMA 1U0OC 2G76A 5CD9A 4FHDA 4MWTA 4I9FA 4RZQA 4D3XA 1O0SA 4LXTA 4GBJA 4CM6A 1NVBA 2ZIXA 4HDOB 2WKRA 1XELA 4L8YA 3RREA 4FW9A 4RK7A 3BIXA 1HR0B 1E0JA 1YQWA 2QN1A 1RI3A 3B6EA 3FWPA 3OETA 5AUQA 1KH3A 4F3KA 5BV8A 2NWQA 1IUKA 5HBRA 5EZ6B 1MBZA 3D9QX 1PTJC 1IWBB 1X80B 4OQDA 4K8RB 4XQGA 1XKXA 3RIYA 1BW9B 1JAHA 2ZPAA 4DZZA 3DB1A 1XHFA 3F6BX 2JIBA 4JB8A 1DEAA 3SC2B 4WLEA 4XX1A 2C3YA 5IC5A 3GJSA 2Q3BA 4MWBA 2OHOA 1SU8A 3E1SA 3B6JA 3PQ8A 4DSAA 4ZA2A 2F3SA 2OZVA 4WZZA 5GVSA 1YR3A 3T5MA 1RWKA 3HKDA 4LC9A 5GQSA 1L5HA 4UQLA 4LQ4A 3FLMA 5JD4A 3C8MA 5LQMA 3HK2A 3JQBC 1N1EA 4F3NA 5KWEA 3B1XA 5E8RA 3ZK9A 3UQYS 2A9PA 1H69A 2J3JA 3T7KA 4EMTA 4XEHA 4C29A 1DTEA 4ZJPA 4H9GA 2HBRA 4NX2A 4CETA 1SBIA 5EJ5A 1L5QA 5TEVA 2VBFA 3IA2A 4XIYA 4ZTUB 4QSMA 1DXQA 1A82A 1RVDA 4V38A 5CT4A 1X0XA 3W3AH 2V5UA 1P3Y1 4CDMA 2Q1XA 4UBLA 4PQGA 3ONNA 4WMLA 2GM4A 4RY8A 2DGDA 5ECGC 3H0EA 1LPOA 1Y7HA 3U31A 1K7SN 1KVTA 1RHRA 2CYCA 3HZOA 4FQ7A 5E8JA 4XGNA 3SXUB 5A5VA 3PI6A 1WEHA 4KPUA 5FUWA 4DUPA 3FNHA 1GVHA 2QL6A 3PQ4A 4R7TA 5DBEX 3LXXA 2DF8A 5DEOA 3SLKA 3OEYA 3W4IA 1ZLYA 1ULAA 3CTMA 3HJAA 4GICA 2BE9A 5M2QA 4RVUA 1J20A 1U4SA 2DPMA 2JGLA 3AF0A 3EQ8A 5JPIA 4BAUA 4WKBA 1L7NA 3BCUA 3MQ4A 2P27A 4RMHA 4AO6A 2YV1A 4B4DA 1GLNA 1ST3A 4EB6A 3I05A 3IQHX 3HM2A 3IUEA 3M2PA 3KKQA 4HQKA 1P75A 3ZK8A 1ZJ4A 3WBKA 2IY9A 3H1FA 3NDBB 2H52A 4K9DA 2OCDA 2Z1DA 1EUQA 2VP9A 4E14A 3I76A 2PKCA 2G07A 1GUDA 3OCXA 4RTLA 3RH0A 4DV3B 4R4JA 4R0VA 3V8QA 2I6UA 1REQB 1F9AA 2RBEA 4MA5A 5EXSA 5C0OE 1Z45A 5YASA 3V8BA 1ADCA 2VOEA 4KXWA 4UU7A 2PKQP 3SX4A 3ZQUA 1FUYB 2CXUA 3HYCA 3ZWQA 4BFTA 4UD6A 1KKLA 1EB8A 2F1RA 3CGGA 4DV0B 1UFRA 1XPUA 4KKVA 3LW7A 4QUAA 1HQDA 1X1SA 2AE1A 4RJ2A 3GB9A 3RSQA 2Z3ZA 4H6VA 3ZWOA 1ESZA 4DPMA 3EXAA 1WSDA 1ZVKA 3OLCX 4XSHA 4DC9A 1NZDA 3ABOB 1JECA 3FPGA 3KEOA 4MUFA 4QBKA 4BWYA 5JISA 3OPYI 2QE6A 3A3OA 5HDQA 1B0UA 3GJYA 1XU9A 1YH3A 3MWFA 3P9QA 2J3KA 5DSXA 3T3OA 1AB6A 1SGWA 2FJ0A 1S2LA 3RG8A 4G1FA 3IAUA 3U4MA 3V3TA 1RQLA 4RPGA 3T7SA 4IDHA 4F6RA 3DEJA 3GL9A 1HURA 5IANA 3IO5A 1FTYA 4HZUA 3DLBA 3QH4A 2FZLA 3QW2A 2PZ8A 4A2QA 4H3SA 4U9IS 1P80A 3PNKA 4II3A 2HGZA 3AHCA 4PCAA 3S2FA 1SXHA 1JA0A 2BHLA 5AI9A 4BIIA 1CDDA 5CDHA 2D6FA 1ZDMA 1VJ5A 1JXAA 1GGJA 2OILA 3JARB 4DJFC 2F3TA 1ZLXA 5JNWA 1E9CA 2QMZA 2OAGA 2JW5A 2BMVA 3M6MD 1D2RA 1FUKA 3NC1C 3L1IA 4M87A 1A9TA 2D1QA 2V7GA 4NYMR 1ZXLA 4F2GA 3LC2O 5G1NA 4YALA 3ZV3A 5J4HA 4EJSA 3RM3A 4BDTA 2GYWA 3MMSA 4AW9A 3HP4A 3O8RA 1H93A 4PHHA 2ZYIA 2PGLA 2BI4A 2GZSA 3DHNA 1FFHA 4CTOA 3V55A 3LT2A 4UMEA 4KVFA 1ZA1A 3SC3A 3HO8A 3VZCA 1X92A 4BNDB 1KAHA 5A02A 5FTLA 4JR0A 1BYUA 1JJAA 4Z4QA 3ZGNA 2P40A 2HHHB 4HX2A 3R3HA 2CUTA 4K0KB 4PLVA 3RBAA 2A7XA 1T6BY 5E2AA 4YFYA 1V11A 1PT5A 3WIDA 1J33A 4KQ1A 4CCAA 4JITA 1PF7E 3R7DA 3WGJA 4ZXPA 4K86A 4PCLA 3V32A 3WLIA 1YDWA 2QE7A 1ESMA 4K7JA 1OYYA 1X0VA 1I30A 2DFLA 2XQJA 3PUWA 1PUJA 4HS9A 3AOEA 4RF5A 3TEJA 1SG0A 1WW2A 2JLVA 1A9ZA 2XBMA 1M5UA 2P9EA 4M0UA 1FUUA 2B5VA 3FFTA 1ZJJA 3EPKA 1ZI6A 2GD1O 3O4RA 2ICAA 3GMIA 1PNRA 5F64A 2XE6A 3ACCA 4MVCA 3IMKA 4KDEA 3LGSA 1P4SA 4UDYX 2XXAA 1UC9A 1G5PA 2RCNA 1II9A 3SAJA 4C7XA 4RV4A 5KJCA 5C31A 1YNOA 1GYQA 3GFVA 4MRPA 1Q7BA 5CMLA 1REQA 5FORA 4Z0TA 1L5KA 3TPCA 3UK7A 1LPMA 4A6EA 1DTWA 3O38A 3K9WA 3X0DA 4ZRNA 2AOUB 2JCXA 5EL0A 2OVBA 4J3FA 3S3TA 3ZHCA 3FCYA 4HAOA 5G4LA 3ZEIA 1C8VB 4BV3A 1DTSA 4TLLB 4WA8A 4ILKA 1K5DA 4Z4CA 3EZFA 3EA0A 4YC7A 1VCOA 3NPAA 1PR5A 3NM4A 3I62A 3L1UA 1JE0A 4MEBA 3GAZA 5FR2A 4R1PA 2RJ3A 3SHWA 2ZUWA 2ZRQA 3WV4A 1I6LA 1LJUA 3JQFC 1R8QA 2NO9A 3ETLA 4XGIA 2R7MA 4BP8A 2QY6A 4I1SA 2JAPA 1CY4A 3KUUA 4KUGA 2IF2A 4ZV9A 3ZE8A 1X74A 3WLSA 1QAMA 4NU0A 1HT1E 3A1SA 3ZJUA 3FZGA 1O95C 3LLCA 1I8TA 2V4MA 4N39A 5EJ9A 5F98A 4D56A 4PC3A 1J21A 1WG8A 3H9BA 3MEQA 2PXHA 3TJMA 4F6RB 3U39A 1HORA 3NM5A 2G5CA 1ZC4A 2PK3A 1P17A 2VEOA 4MR8A 2GEFA 1T26A 2J30A 3LBAA 4H3KB 4PZ0A 2J3HA 3WLEA 1TJYA 4NEQA 2Y1XA 3DE0X 3EEYA 1ODLA 5G41A 3TQQA 3WGUA 5BMVF 3OOSA 4TROA 5HKKA 3GRAA 4E94A 2CVQA 2X4IA 1BQ3A 3WAKA 4BO1A 5KNLA 1G20A 3ZXIA 3HCFA 4KAXA 5IBQA 1OWNA 2V3VA 4BMPB 5IHXA 1YHYA 821PA 1I1HA 2PUTA 2FUG6 4TSFA 1RXSA 3EVZA 1ZINA 1NW8A 2IDMA 4FQ5A 4KO2S 4QOJA 3CNEA 2CBZA 2XVAA 1PYDA 3RT1A 5ITSA 4EY4A 4BYGA 1G8SA 3FFXA 3WLFA 2DUWA 2B25A 2PA3A 4JKIA 5E4YA 4EATA 1BDJA 4RBNA 4R1UA 1NJFA 1GT91 1SXIA 3ZGXA 2A7QA 1H2XA 3OQBA 2POQX 5TDHA 3WQQA 1ULZA 5BVHB 5LP1A 4MWDA 4TL9A 4II7A 4HWOA 4KQKA 1YDHA 2RK4A 2QGZA 3S2ZA 3SQMA 3QPDA 3VUFA 1ENOA 5AMXA 4LGVA 5J4YA 2Y3IA 4I81A 4BX0A 2R84A 3C5EA 4UXIA 1GDDA 3DBHA 1KMNA 4UAVA 1IHYA 4GPD1 1SPXA 2Q46A 2YJTD 3FR8A 4FEEA 2Z1NA 4EARA 4E07A 3MMZA 5SZHB 1EFCA 1Q44A 2XDQB 3GQBB 1Q12A 4FDUA 4F72A 1B6TA 2JVJA 1BS2A 3Q87B 1S96A 4D44A 2OENG 2WG2A 4Q4AA 3FOAA 4GU5A 4F5WA 4C0JA 3DDOA 5EHGA 1H2ZA 3O9MA 6CHYA 5ADWA 4J43A 1D6NA 2O4CA 2Y1WA 1K89A 2DHDA 3OCZA 4Y98A 3PWTA 4F85A 2PX0A 3SYMA 3L7IA 3NIDB 2QQGA 5FUYA 3WGTA 1SC9A 4IH9A 4JLWA 3U17A 3BQ9A 1UJ2A 4COOA 4URZR 1PNQA 1L5RA 1UOEA 3RE1A 1U5CA 4ETNA 3NAQA 2UUBB 4IH1A 3HJBA 3BWCA 3AQ4A 3G59A 4OFBA 4R98A 3H2SA 2H2HA 4UTRA 1J22A 3O8QA 1HEUA 1M3SA 1YZVA 3AFMA 2FMIA 4G37A 3VH4A 2XUZA 3M70A 1SHLA 3P96A 5A7HA 4O02B 2HIHA 3QTTA 2RHJA 4MX8A 4RTMA 2V8OA 5I47A 5FD8A 2VJYA 1WVGA 3RJZA 4AAYA 1FQWA 2EYQA 3E9NA 3WL3A 4NNJA 2JAQA 1E9AA 4XQEA 3N59A 3KNZA 1X15A 3ICCA 3RFCA 1M8GA 1W1UA 4A8JA 4A9AA 2G28A 2X4DA 2ZULA 3GJ5A 3QYAA 1FXUA 1KBZA 3EGXB 4J7CA 4QOEA 2B3TA 3W5UA 4Z1OA 2Y2UA 3PJFA 4ON9A 4PC1A 4G56A 4Y67A 3WYGA 3VJRA 1W19A 3QTLA 2G63A 3PL5A 4LNAA 1NT4A 3UMFA 4DRZA 4HNQA 1TZBA 5IG2A 1P31A 3QKSB 2OT3B 4G84A 1NBHA 1J0EA 4FDMA 3KUXA 4X91A 2EIXA 3OJOA 4OHRA 1ETUA 4RCYA 2PKRA 2H4HA 2BFFB 3GLIA 4XARA 2F1HA 4URUR 1SHKA 3L1VA 3A6FA 4G5RA 1SXJE 2XWPA 4ROSA 1VJCA 2AKAB 3SNKA 1FRNA 4FB4A 1Y8RB 4MP8A 2JHFA 1XEWX 4ODIA 3IDQA 1RP7A 5JANA 3F73A 2RHGB 3G8BA 4TZTA 1G7RA 2R6GA 2AWOA 3GDHA 2JPDA 3L7JA 4F1JA 4OU5A 3ZIUA 4A5OA 3H16A 2CF6A 4CT4B 1XTZA 5JC8A 2AVNA 1V0JA 5JVDB 4MYSA 4E22A 1GAEO 3GRFA 4EYKA 1UMDA 1FP4A 6ADHA 4LF4B 1BMTA 1CRPA 3TECE 1T1RA 1UXKA 1GUZA 3L4BC 1PEYA 3FGPA 3T8YA 1PJSA 3WSTA 1W46A 2VQDA 4YRTA 2E5LB 1E3SA 3A05A 4LMRA 3B8EA 5TV2A 3I2FA 3VC2A 2ZETA 1L9KA 4ENSA 4RWEA 4OBEA 5HX7A 5JJLA 3AL2A 1S2OA 3LPNA 1JFVA 1T6YA 4HPJB 3REFA 3T99A 2OHHA 3RRBA 4LZLA 3R75A 2VDVE 5KC9A 4IBOA 4UOQA 5BO5A 3UGTA 4QWMA 1T4CB 4D9BA 5C8ZA 2CLIB 4JLAA 4RHXA 1RHUA 2WPNA 1S8OA 3IDFA 3IBSA 2G9RA 4C7VA 3W2GA 3H9UA 3O1LA 2O3QA 3H2JA 5FPKA 2FVYA 5K0SA 5J1TB 2ZI3A 3CV3A 4GO1A 3G2OA 4FZRA 2RI6A 1IY2A 1SHJA 3H4VA 1P77A 4Y2JA 1M6VB 1I5OA 1YVDA 4QJ5A 3NHRA 3MZ0A 1ECPA 5EIHA 4Z9YA 4WERA 1JN0A 1K08A 5C32A 4YMLA 4TS4A 4TSKA 2OQVA 1N2GA 4U7JA 1XZ8A 1Y1LA 4UCXA 1JF8A 1O77A 2WC1A 3HHEA 4I9UA 5KDOA 2ZLBA 3NGMA 6NULA 1R0YA 4HEHA 5LUBA 4R8VA 1U2QA 1TMKA 1ODCA 1GPBA 3RSHA 1A1SA 4LNUB 1F8UA 4Q9AA 4FMCF 3BL8A 2G1JA 1TAUA 1I2BA 3USES 1PQYA 2BPOA 4RDXA 2PZKA 2QPOA 4ISBA 1PFKA 1FSSA 2D0PB 1PJ3A 3BH6A 3KSRA 5FA5A 3GN2A 3D0KA 3TRDA 4EDFA 2X3YA 3PHCA 2O8CB 2LKDA 1VYUA 2C5HA 1A7JA 1KPHA 2EW2A 3IV6A 3NP9A 2ZS9A 2BUAA 2I65A 1N75A 1RHJA 4FJ2A 1S5PA 1MQ8B 3RIXA 1PDWA 1F0NA 5JQGB 4EKIA 1EXWA 2QJRA 3RAPR 2OHJA 1JAIA 1F2UB 4MVJF 1XZBA 4PAGA 3Q7QA 4CFYA 3ZDEA 5CIYA 3I5UA 5B55A 1QC5B 4ABYA 1EFTA 2QLBA 3W6PA 2OV8A 4C07A 3C5WP 1ZUD1 1JR6A 2FETA 4N5MA 3P2KA 4RM2A 1WABA 4EL5A 4XJVA 3JQ6A 1WXFA 3PICA 3LOQA 2FOXA 3C5CA 1RM0A 1IG0A 5J4KA 2ZTSA 1QYIA 4NESA 2Q5OA 4N7MA 4A6DA 2IHYA 1T3ZA 1YBAA 5KNBD 5ALFA 2X3FA 4D4HA 4D80A 4MRAA 5AVSA 1BDHA 3WMXA 3C5VA 3W1VA 4PC6A 1JVNA 2QTZA 3OQVA 4TTIA 4WESB 4HI0E 4IGEA 1AA9A 5TVKA 3HYNA 3KB8A 3KAJA 4IRXA 4YRBA 4BATA 1U2PA 2R85A 4I2VA 4IHKA 1GITA 5AKXA 5IH3A 4NXMB 1EG2A 3AESB 1FJHA 3OT5A 4JJAA 1XNJA 2IDZA 4B9EA 3ZKAA 4EGSA 3E9DA 1XBTA 3E82A 2H0QA 4ZGGA 2YIDA 4MAFA 4EAQA 5AI4A 2QVGA 5KIAA 1EUYA 4ZCRA 5JUWA 2Q2NA 4UEOA 4LCJA 2WQ6A 5BWBA 1QV6A 3B2QA 3O1JC 1NBMD 3QF7A 4S1OA 5A5FA 3HY3A 1UJ6A 3C3JA 3KX2A 2RH8A 4K6CA 2F62A 3L01A 1R9NA 4NBNA 1NF8A 4WZAA 5TY0A 3COJA 2C8JA 1MOQA 1SXJB 5JMWA 2JCSA 3TJZA 4M55A 3WWYA 3U5TA 3IUNA 4GH5A 5ELLA 1HMPA 5KJ6A 3RVBA 1IBCA 3T7AA 5TPWA 3AVUA 2XMSA 4C0SA 4LY3A 5IDWA 1Q0TA 3GFGA 3BQNB 4U7FA 1QR2A 2OBLA 3DMYA 1G21A 4PXSA 1YDGA 2JCGA 2NADA 4V0QA 3SYKA 2X0FA 3N07A 3VR6D 3FCCA 3UHFA 4TWJA 1WF6A 1MRNA 2FRVA 1E2QA 1EZ1A 2Z8YM 1XU7A 3KEQA 3NAZA 5B4VA 1HF3A 5CFNA 4GECA 4JS0A 4OYRA 4S12A 2ZCJA 1OX5A 5EKXA 3G5LA 5H16A 4MW2A 3CEJA 3LLSA 3ROKA 3WMEA 4DWJA 1XNRB 4FE3A 4JEMA 4D57A 1A04A 1VMAA 2FN4A 2ZVDA 2I2DA 5IMBA 3X1MA 2OYCA 4AECA 1K6JA 4CKZA 4JB2A 2E37A 3VR6H 2F4VB 4JOQA 4Z3DA 3CCFA 3KOOA 2WP0A 1TAQA 3H2IA 1DX6A 4NNPA 4V0OA 4UU1A 1TEHA 2LIPA 5SY9A 1DG9A 2ZITA 5ALPA 3GLHA 4RA9A 4Z7QB 2X8BA 3PC7A 5BSGA 5HQJA 2Y92A 1FBTA 5CPFA 2YASA 4OOFA 4FPXA 3ZV4A 2QG9A 2I4IA 2O59A 3EIXA 2WJAA 1MAUA 2VT3A 3I73A 1WMSA 3ONEA 3R6DA 3MLBA 3TZQA 3UOAB 4GDFA 3CRW1 3QXCA 4XVUA 5IM4A 4WEOA 3LVRE 5C34B 2A0KA 2PUGA 1V8FA 4L73A 4AS3A 4OXKA 4XQ0A 1VIVA 2K7ZA 5LVAA 1IQUA 1ZYUA 2NSJA 1DQPA 2ZTVA 5IAOA 1YR7A 3X1YA 3MTQA 2HQRA 1IOWA 4JVMA 4ZO9A 2OG2A 2W2KA 4MUYA 3IPAA 1GFSA 1Z6PA 2ZBRA 3AVPA 1ZHHA 4GMKA 4V3CA 2J85A 2QOEA 5IKOA 1Y3CE 4BFYA 1V4BA 4YXWD 3AUSA 3C8DA 1EIWA 3IQEA 4OPMA 2BF7A 4X7MA 1VRWA 2JBHA 1XTBA 3KXPA 4B2PA 2AYYA 2NO1A 1N2XA 3G9UA 4FR2A 4C3ZA 2VF8A 4HN4B 4INAA 1UT6A 1M1ZA 1V95A 2NOAA 4N7BA 4MA4A 1U9YA 1WHTA 3CPEA 2AR9A 1NVXQ 1XD2A 2DCMA 3OHMA 1S8AA 1J0DA 5H9WA 3ZU3A 1ISHA 3DMHA 4YQZA 3ZJVA 4TTQA 1XTKA 2YQ4A 1IQPA 1WVMA 3EGWA 2ZAIA 3HB1A 1KO4A 4LVOA 3KLBA 3VC1A 3FH0A 2IS2A 3OZAA 3JQAD 4EHNA 2FCRA 2JS7A 4CUZA 1K3TA 4CPDA 2P0AA 3DEFA 1FVHA 1HKUA 1SBQA 4V3BA 3ZDXB 4C4ZA 2ZRFA 4KI7A 4FM9A 4XOUA 5CB4F 1P0FA 4RGYA 3U0VA 3X2EA 3EVCA 5DK6A 4UOEA 3OY7A 1PJ2A 1L5LA 4YQFA 1NXXA 4W9MC 2BTEA 5G53C 5BMVB 5IJZA 1PZNA 4D0SA 2B1JA 5I4BA 2SKEA 1MORA 2OY0A 2H4ZA 2GPBA 5ALEA 5CA1F 1D3AA 1VZ3A 3LPDA 2Q4DA 4AIIA 2IBSA 4ERXA 4EI9A 2FSIA 3LH5A 1LDNA 2JDIA 2IYYA 3RVDA 2HT6A 3I23A 1XWIA 4DJDC 3PSHA 2BJWA 4L76A 2WMOB 2BSQA 1DAGA 3K92A 4Q4JA 1ZMTA 2X7HA 4Q9DA 1TEXA 2Z98A 1U02A 4MSUA 5ILGA 3TKYA 1TIPA 5C7YA 5KINB 3KUDA 2DLDA 2WT4A 4EKEA 1A2OA 1H2AS 3NEPX 5DGXA 3GPCA 4CQLB 4DLKA 2DB3A 1NQ5A 1WAMA 3LBIA 1ZUIA 3V4ZA 2QVLA 5KQRA 1NOJA 1YQEA 3MJTA 3Q1LA 4WKNA 1NBEA</