1IROA

Rubredoxin (oxidized, fe(iii)) at 1.1 angstroms resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
b'MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title Zinc- and iron-rubredoxins from Clostridium pasteurianum at atomic resolution: a high-precision model of a ZnS4 coordination unit in a protein.
pubmed doi rcsb
molecule tags Electron transport
total genus 8
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1995-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1iroA00
1B13A 1BRFA 1CADA 6RXNA 4POGA 2RDVA 1YUZA 1S2ZA 1YK5A 4YWLA 1S24A 1VCXA 2M4YA 1YK4A 3SS2A 2VL6A 4AR5A 3KYWA 1R0JA 1LKPA 2K2DA 3KYUA 1NNQA 1T9PA 1RDGA 3A44A 3RZTA 4K9FA 1IRNA 2QL0A 4ME3A 1R0GA 3KYVA 3QVDA 1H7VA 4TPUA 1SMWA 1DX8A 1R0FA 4AR3A 3KYXA 4AR6A 1RDVA 1T9OA 1E8JA 3MPSA 1IU6A 7RXNA 1BQ8A 1LTLA 2HR5A 1YUXA 1B71A 3KYYA 1BE7A 1RB9A 2GMGA 5RXNA 1B2OA 2PVEA 1DVBA 1LKMA 1BFYA 1RYTA 1ZRPA 1RWDA 2KN9A 2KKDA 1R0IA 4YWMA 1SMUA 2MS3A 4RXNA 1T9QA 2LCQA 5IY0A 1CAAA 1IU5A 8RXNA 1C09A 2PVXA 1YV1A 1IROA 1FHMA 1JYBA 1S30A 4AR4A 3RZ6A 1LKOA 1R0HA 4POFA 2DSXA 2V3BB 1B2JA 1SMMA 3RYGA 1QCVA 1BQ9A 1QYBA 3PWFA 5AI3A 5AI2A 1FHHA 3PZAA 2PYAA
chains in the Genus database with same CATH superfamily
1TWHL 3RZOL 2JA8L 3GTOL 1NXEA 4A3CL 4A3ML 4B8CD 4BBRL 1I50L 2M4YA 3SS2A 3GTJL 5GADc 2NVQL 3LWOB 3KYUA 1NNQA 3A44A 1IW7D 4A3BL 3QVDA 2JA6L 1H7VA 4TPUA 2XJVA 3LWQB 1R9TL 4JADA 1RDVA 3MSUA 4A3DL 4E6YA 1LTLA 3J7Z1 2NYDA 3S17L 1YUXA 1B71A 1SFOL 3H99A 2JI1A 2GMGA 5C4JL 2PSMC 4BXXL 3J7Y1 3LWRB 2Z3RB 2R92L 4AI2A 1OWCA 2B63L 1SMUA 5MGNA 3I4NL 2YU9L 1F4LA 5MLC3 3CQZL 3H3VM 4X6AL 1ODHA 1CAAA 1VZIA 5K2ME 2L0ZA 4JAFA 4U671 8RXNA 1YV1A 2XJSA 1JYBA 1S30A 2BE5D 3HKZP 1LKOA 4LHNA 3HOUL 4POFA 5DM61 5C4XL 2DSXA 4C2M1 3H0GL 2ZIXA 5MFPA 3PWFA 3WWNB 2AYJA 2JA7L 1FHHA 2JI2A 3PZAA 2PYAA 3PL5A 1BRFA 5IP9L 3P2AA 5AN9H 1I6HL 2RDVA 1YUZA 2APOB 1S2ZA 1YK5A 4AI1A 3LWVB 2NVXL 3KYWA 1LKPA 3GTGL 4AI3A 1TWCL 2JA5L 2M6PA 1T9PA 2WAQP 1VZHA 1NXGA 1IRNA 3PIP1 4ME3A 4A3FL 1DX8A 2WB1P 1R0FA 4AR3A 3H9CA 4C3HL 3HOWL 5EINC 1T9OA 4A3EL 4AYBP 1Y1WL 4ZN3B 4AHZA 3HOXL 2E2IL 1DVBA 1LKMA 1ZRPA 4ZN1B 1RWDA 2E2JL 3GTPL 3FKIL 3LWPB 3S15L 1T9QA 4A3GL 4TVMA 2A69D 1OWBA 2PPTA 1PFVA 1PFYA 3S2DL 1FHMA 1I3QL 2ERJA 4A93L 1R0HA 4C3JL 3GTLL 5M5YL 3VPBE 4A3JL 3HOVL 1QYBA 2E2HL 5AI2A 2Z3QB 5DM71 1QQTA 4JAGA 5M3ML 6RXNA 4POGA 4BY1L 2XJUA 1Z92B 1WJVA 4YWLA 2NVYL 1S24A 2H12A 3IU3I 2C6BA 1YK4A 3PIO1 5JVH1 4AR5A 1R0JA 5FJ8L 2A68D 2RFKB 5GAGc 1RDGA 2ERSA 3P8BA 3RZTA 4Y52L 4LHLA 4K9FA 3RZDL 1TWAL 4AHYA 5GAHc 3KYVA 4C3IL 4BBSL 1SMWA 3QQCE 3HJWB 4A3LL 3KYXA 5FLML 2R7ZL 2Y0SP 1E8JA 2JI3A 2XJTA 1IU6A 7RXNA 2HR5A 1BE7A 1RB9A 5RXNA 3GTKL 1Y1VL 4XGHA 1B2OA 1VZGA 2PVEA 3I4ML 1RYQA 1RYTA 4GS7D 4A3IL 2V0FA 2J9UB 2KKDA 1R0IA 3FDJA 5C3EL 4YWMA 2MS3A 2AUSB 4RXNA 2CKAA 3B0AB 5IY0A 3LPEB 3B08B 1IU5A 2PVXA 2NVTL 4AI0A 1IROA 2A6ED 4G6BA 3PO3L 3M4OL 3S14L 4AR4A 3S1ML 3M3YL 3RZ6A 5IYDL 5JVG1 3GTML 1P7PA 1PFUA 2XJRA 2M6OA 3GTQL 2V3BB 4JAEA 1SMMA 1BQ9A 5AI3A 3HOYL 1B13A 3PO2L 1CADA 5IP7L 1K83L 2PMZP 1PZXA 2O5JD 1VCXA 2V0EA 3HAXC 3S2HL 3MQKB 4BY7L 2VL6A 3S1RL 2C6AA 1WCML 3K7AL 2K2DA 4WFN1 3HOZL 2A6HD 4Y7NL 5M5XL 5IYBL 3S1NL 1TWFL 3S1QL 2R93L 4XXBB 5IYCL 4UY81 2QL0A 1R0GA 2M4VA 2B5ID 4QIWP 5M5WL 4AR6A 5EIOC 3MPSA 1BQ8A 3KYYA 2XJQA 4A3KL 3S16L 3JR7A 3NFPI 1BFYA 2KN9A 5GAEc 2LCQA 5MF6A 2CKCA 2XJPA 2VUML 1TWGL 1C09A 4V196 2EY4E 3HJYB 5C44L 2CR8A 3PKJA 3K35A 3PKIA 2HVYC 5H1Sc 3LNLA 3WWLA 1PFWA 4AHXA 4AHWA 5M3FL 1B2JA 3RYGA 1QCVA 2AQCA 3H9BA 3H97A 5MFZA 3ZG6A
chains in the Genus database with same CATH topology
1B13A 5DM71 1BRFA 4JAGA 1CADA 6RXNA 3P2AA 4POGA 5AN9H 1NXEA 2RDVA 2XJUA 1YUZA 1Z92B 1S2ZA 4B8CD 1WJVA 2O5JD 1YK5A 4YWLA 1S24A 1VCXA 2V0EA 2M4YA 4AI1A 2H12A 3IU3I 2C6BA 1YK4A 3SS2A 3PIO1 5JVH1 2VL6A 4AR5A 2C6AA 3KYWA 5GADc 1R0JA 1LKPA 2K2DA 4AI3A 2A68D 4WFN1 2M6PA 3KYUA 1NNQA 2A6HD 5GAGc 1T9PA 1RDGA 2ERSA 3P8BA 3A44A 3RZTA 1IW7D 1VZHA 4LHLA 1NXGA 1IRNA 4K9FA 4XXBB 4AHYA 4UY81 2QL0A 4ME3A 1R0GA 3KYVA 5GAHc 3PIP1 3QVDA 1H7VA 2M4VA 4TPUA 1SMWA 1DX8A 3QQCE 1R0FA 2B5ID 4AR3A 2XJVA 3KYXA 4AR6A 4JADA 1RDVA 3MSUA 5EINC 5EIOC 1T9OA 1E8JA 4E6YA 2JI3A 2XJTA 3MPSA 1IU6A 7RXNA 1BQ8A 4ZN3B 1LTLA 2HR5A 3J7Z1 2NYDA 1YUXA 4AHZA 1B71A 1BE7A 3KYYA 2JI1A 1RB9A 2GMGA 2PSMC 5RXNA 3J7Y1 2XJQA 4XGHA 1B2OA 1VZGA 2PVEA 1DVBA 2Z3RB 1RYQA 3NFPI 1LKMA 4AI2A 1RYTA 4GS7D 1OWCA 1ZRPA 1BFYA 4ZN1B 2V0FA 1RWDA 2KN9A 2J9UB 2KKDA 1R0IA 5GAEc 4YWMA 1SMUA 5MGNA 2MS3A 5MLC3 4RXNA 1T9QA 2CKAA 3B0AB 2LCQA 5IY0A 5MF6A 1ODHA 1CAAA 1VZIA 2CKCA 2XJPA 3LPEB 3B08B 5K2ME 2L0ZA 1IU5A 4JAFA 4TVMA 4U671 8RXNA 1C09A 2A69D 2PVXA 4V196 1OWBA 1YV1A 2PPTA 4AI0A 2XJSA 2A6ED 1IROA 4G6BA 2CR8A 1FHMA 1JYBA 3PKJA 3K35A 3PKIA 1S30A 2BE5D 4AR4A 5H1Sc 3LNLA 3RZ6A 3WWLA 5JVG1 1LKOA 4AHXA 2ERJA 4LHNA 4AHWA 1R0HA 4POFA 5DM61 2XJRA 2M6OA 2DSXA 2V3BB 1B2JA 4JAEA 3VPBE 1SMMA 3RYGA 2ZIXA 1QCVA 1BQ9A 1QYBA 5MFPA 5MFZA 3PWFA 3WWNB 2AYJA 5AI3A 5AI2A 1FHHA 2JI2A 3PZAA 2PYAA 2Z3QB 3ZG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B13 A;  1BRF A;  1CAD A;  6RXN A;  4POG A;  2RDV A;  1YUZ A;  1S2Z A;  1YK5 A;  4YWL A;  1S24 A;  1VCX A;  2M4Y A;  1YK4 A;  3SS2 A;  2VL6 A;  4AR5 A;  3KYW A;  1R0J A;  1LKP A;  2K2D A;  3KYU A;  1NNQ A;  1T9P A;  1RDG A;  3A44 A;  3RZT A;  4K9F A;  1IRN A;  2QL0 A;  4ME3 A;  1R0G A;  3KYV A;  3QVD A;  1H7V A;  4TPU A;  1SMW A;  1DX8 A;  1R0F A;  4AR3 A;  3KYX A;  4AR6 A;  1RDV A;  1T9O A;  1E8J A;  3MPS A;  1IU6 A;  7RXN A;  1BQ8 A;  1LTL A;  2HR5 A;  1YUX A;  1B71 A;  3KYY A;  1BE7 A;  1RB9 A;  2GMG A;  5RXN A;  1B2O A;  2PVE A;  1DVB A;  1LKM A;  1BFY A;  1RYT A;  1ZRP A;  1RWD A;  2KN9 A;  2KKD A;  1R0I A;  4YWM A;  1SMU A;  2MS3 A;  4RXN A;  1T9Q A;  2LCQ A;  5IY0 A;  1CAA A;  1IU5 A;  8RXN A;  1C09 A;  2PVX A;  1YV1 A;  1IRO A;  1FHM A;  1JYB A;  1S30 A;  4AR4 A;  3RZ6 A;  1LKO A;  1R0H A;  4POF A;  2DSX A;  2V3B B;  1B2J A;  1SMM A;  3RYG A;  1QCV A;  1BQ9 A;  1QYB A;  3PWF A;  5AI3 A;  5AI2 A;  1FHH A;  3PZA A;  2PYA A; 
#chains in the Genus database with same CATH topology
 1TWH L;  3RZO L;  2JA8 L;  3GTO L;  1NXE A;  4A3C L;  4A3M L;  4B8C D;  4BBR L;  1I50 L;  2M4Y A;  3SS2 A;  3GTJ L;  5GAD c;  2NVQ L;  3LWO B;  3KYU A;  1NNQ A;  3A44 A;  1IW7 D;  4A3B L;  3QVD A;  2JA6 L;  1H7V A;  4TPU A;  2XJV A;  3LWQ B;  1R9T L;  4JAD A;  1RDV A;  3MSU A;  4A3D L;  4E6Y A;  1LTL A;  3J7Z 1;  2NYD A;  3S17 L;  1YUX A;  1B71 A;  1SFO L;  3H99 A;  2JI1 A;  2GMG A;  5C4J L;  2PSM C;  4BXX L;  3J7Y 1;  3LWR B;  2Z3R B;  2R92 L;  4AI2 A;  1OWC A;  2B63 L;  1SMU A;  5MGN A;  3I4N L;  2YU9 L;  1F4L A;  5MLC 3;  3CQZ L;  3H3V M;  4X6A L;  1ODH A;  1CAA A;  1VZI A;  5K2M E;  2L0Z A;  4JAF A;  4U67 1;  8RXN A;  1YV1 A;  2XJS A;  1JYB A;  1S30 A;  2BE5 D;  3HKZ P;  1LKO A;  4LHN A;  3HOU L;  4POF A;  5DM6 1;  5C4X L;  2DSX A;  4C2M 1;  3H0G L;  2ZIX A;  5MFP A;  3PWF A;  3WWN B;  2AYJ A;  2JA7 L;  1FHH A;  2JI2 A;  3PZA A;  2PYA A;  3PL5 A;  1BRF A;  5IP9 L;  3P2A A;  5AN9 H;  1I6H L;  2RDV A;  1YUZ A;  2APO B;  1S2Z A;  1YK5 A;  4AI1 A;  3LWV B;  2NVX L;  3KYW A;  1LKP A;  3GTG L;  4AI3 A;  1TWC L;  2JA5 L;  2M6P A;  1T9P A;  2WAQ P;  1VZH A;  1NXG A;  1IRN A;  3PIP 1;  4ME3 A;  4A3F L;  1DX8 A;  2WB1 P;  1R0F A;  4AR3 A;  3H9C A;  4C3H L;  3HOW L;  5EIN C;  1T9O A;  4A3E L;  4AYB P;  1Y1W L;  4ZN3 B;  4AHZ A;  3HOX L;  2E2I L;  1DVB A;  1LKM A;  1ZRP A;  4ZN1 B;  1RWD A;  2E2J L;  3GTP L;  3FKI L;  3LWP B;  3S15 L;  1T9Q A;  4A3G L;  4TVM A;  2A69 D;  1OWB A;  2PPT A;  1PFV A;  1PFY A;  3S2D L;  1FHM A;  1I3Q L;  2ERJ A;  4A93 L;  1R0H A;  4C3J L;  3GTL L;  5M5Y L;  3VPB E;  4A3J L;  3HOV L;  1QYB A;  2E2H L;  5AI2 A;  2Z3Q B;  5DM7 1;  1QQT A;  4JAG A;  5M3M L;  6RXN A;  4POG A;  4BY1 L;  2XJU A;  1Z92 B;  1WJV A;  4YWL A;  2NVY L;  1S24 A;  2H12 A;  3IU3 I;  2C6B A;  1YK4 A;  3PIO 1;  5JVH 1;  4AR5 A;  1R0J A;  5FJ8 L;  2A68 D;  2RFK B;  5GAG c;  1RDG A;  2ERS A;  3P8B A;  3RZT A;  4Y52 L;  4LHL A;  4K9F A;  3RZD L;  1TWA L;  4AHY A;  5GAH c;  3KYV A;  4C3I L;  4BBS L;  1SMW A;  3QQC E;  3HJW B;  4A3L L;  3KYX A;  5FLM L;  2R7Z L;  2Y0S P;  1E8J A;  2JI3 A;  2XJT A;  1IU6 A;  7RXN A;  2HR5 A;  1BE7 A;  1RB9 A;  5RXN A;  3GTK L;  1Y1V L;  4XGH A;  1B2O A;  1VZG A;  2PVE A;  3I4M L;  1RYQ A;  1RYT A;  4GS7 D;  4A3I L;  2V0F A;  2J9U B;  2KKD A;  1R0I A;  3FDJ A;  5C3E L;  4YWM A;  2MS3 A;  2AUS B;  4RXN A;  2CKA A;  3B0A B;  5IY0 A;  3LPE B;  3B08 B;  1IU5 A;  2PVX A;  2NVT L;  4AI0 A;  1IRO A;  2A6E D;  4G6B A;  3PO3 L;  3M4O L;  3S14 L;  4AR4 A;  3S1M L;  3M3Y L;  3RZ6 A;  5IYD L;  5JVG 1;  3GTM L;  1P7P A;  1PFU A;  2XJR A;  2M6O A;  3GTQ L;  2V3B B;  4JAE A;  1SMM A;  1BQ9 A;  5AI3 A;  3HOY L;  1B13 A;  3PO2 L;  1CAD A;  5IP7 L;  1K83 L;  2PMZ P;  1PZX A;  2O5J D;  1VCX A;  2V0E A;  3HAX C;  3S2H L;  3MQK B;  4BY7 L;  2VL6 A;  3S1R L;  2C6A A;  1WCM L;  3K7A L;  2K2D A;  4WFN 1;  3HOZ L;  2A6H D;  4Y7N L;  5M5X L;  5IYB L;  3S1N L;  1TWF L;  3S1Q L;  2R93 L;  4XXB B;  5IYC L;  4UY8 1;  2QL0 A;  1R0G A;  2M4V A;  2B5I D;  4QIW P;  5M5W L;  4AR6 A;  5EIO C;  3MPS A;  1BQ8 A;  3KYY A;  2XJQ A;  4A3K L;  3S16 L;  3JR7 A;  3NFP I;  1BFY A;  2KN9 A;  5GAE c;  2LCQ A;  5MF6 A;  2CKC A;  2XJP A;  2VUM L;  1TWG L;  1C09 A;  4V19 6;  2EY4 E;  3HJY B;  5C44 L;  2CR8 A;  3PKJ A;  3K35 A;  3PKI A;  2HVY C;  5H1S c;  3LNL A;  3WWL A;  1PFW A;  4AHX A;  4AHW A;  5M3F L;  1B2J A;  3RYG A;  1QCV A;  2AQC A;  3H9B A;  3H97 A;  5MFZ A;  3ZG6 A; 
#chains in the Genus database with same CATH homology
 1B13 A;  5DM7 1;  1BRF A;  4JAG A;  1CAD A;  6RXN A;  3P2A A;  4POG A;  5AN9 H;  1NXE A;  2RDV A;  2XJU A;  1YUZ A;  1Z92 B;  1S2Z A;  4B8C D;  1WJV A;  2O5J D;  1YK5 A;  4YWL A;  1S24 A;  1VCX A;  2V0E A;  2M4Y A;  4AI1 A;  2H12 A;  3IU3 I;  2C6B A;  1YK4 A;  3SS2 A;  3PIO 1;  5JVH 1;  2VL6 A;  4AR5 A;  2C6A A;  3KYW A;  5GAD c;  1R0J A;  1LKP A;  2K2D A;  4AI3 A;  2A68 D;  4WFN 1;  2M6P A;  3KYU A;  1NNQ A;  2A6H D;  5GAG c;  1T9P A;  1RDG A;  2ERS A;  3P8B A;  3A44 A;  3RZT A;  1IW7 D;  1VZH A;  4LHL A;  1NXG A;  1IRN A;  4K9F A;  4XXB B;  4AHY A;  4UY8 1;  2QL0 A;  4ME3 A;  1R0G A;  3KYV A;  5GAH c;  3PIP 1;  3QVD A;  1H7V A;  2M4V A;  4TPU A;  1SMW A;  1DX8 A;  3QQC E;  1R0F A;  2B5I D;  4AR3 A;  2XJV A;  3KYX A;  4AR6 A;  4JAD A;  1RDV A;  3MSU A;  5EIN C;  5EIO C;  1T9O A;  1E8J A;  4E6Y A;  2JI3 A;  2XJT A;  3MPS A;  1IU6 A;  7RXN A;  1BQ8 A;  4ZN3 B;  1LTL A;  2HR5 A;  3J7Z 1;  2NYD A;  1YUX A;  4AHZ A;  1B71 A;  1BE7 A;  3KYY A;  2JI1 A;  1RB9 A;  2GMG A;  2PSM C;  5RXN A;  3J7Y 1;  2XJQ A;  4XGH A;  1B2O A;  1VZG A;  2PVE A;  1DVB A;  2Z3R B;  1RYQ A;  3NFP I;  1LKM A;  4AI2 A;  1RYT A;  4GS7 D;  1OWC A;  1ZRP A;  1BFY A;  4ZN1 B;  2V0F A;  1RWD A;  2KN9 A;  2J9U B;  2KKD A;  1R0I A;  5GAE c;  4YWM A;  1SMU A;  5MGN A;  2MS3 A;  5MLC 3;  4RXN A;  1T9Q A;  2CKA A;  3B0A B;  2LCQ A;  5IY0 A;  5MF6 A;  1ODH A;  1CAA A;  1VZI A;  2CKC A;  2XJP A;  3LPE B;  3B08 B;  5K2M E;  2L0Z A;  1IU5 A;  4JAF A;  4TVM A;  4U67 1;  8RXN A;  1C09 A;  2A69 D;  2PVX A;  4V19 6;  1OWB A;  1YV1 A;  2PPT A;  4AI0 A;  2XJS A;  2A6E D;  1IRO A;  4G6B A;  2CR8 A;  1FHM A;  1JYB A;  3PKJ A;  3K35 A;  3PKI A;  1S30 A;  2BE5 D;  4AR4 A;  5H1S c;  3LNL A;  3RZ6 A;  3WWL A;  5JVG 1;  1LKO A;  4AHX A;  2ERJ A;  4LHN A;  4AHW A;  1R0H A;  4POF A;  5DM6 1;  2XJR A;  2M6O A;  2DSX A;  2V3B B;  1B2J A;  4JAE A;  3VPB E;  1SMM A;  3RYG A;  2ZIX A;  1QCV A;  1BQ9 A;  1QYB A;  5MFP A;  5MFZ A;  3PWF A;  3WWN B;  2AYJ A;  5AI3 A;  5AI2 A;  1FHH A;  2JI2 A;  3PZA A;  2PYA A;  2Z3Q B;  3ZG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...